(data stored in ACNUC7820 zone)

EMBL: AY318560

ID   AY318560; SV 1; linear; genomic DNA; STD; MUS; 930 BP.
XX
AC   AY318560;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   27-APR-2004 (Rel. 79, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor Olfr1352 (Olfr1352) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-930
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-930
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; e769dbc1c1a9e1ef6d903094ababb5e4.
DR   Ensembl-Gn; ENSMUSG00000046493; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017436; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017414; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017377; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017376; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017199; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017831; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016769; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017171; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017279; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017271; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017348; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017298; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017871; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016550; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016828; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000058991; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026014; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0025990; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0025956; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025959; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025765; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026450; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025332; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0025689; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0025818; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0025814; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0025928; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025810; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026498; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025041; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025302; mus_musculus_wsbeij.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..930
FT                   /organism="Mus musculus"
FT                   /chromosome="10"
FT                   /map="10B5-10C2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>930
FT                   /gene="Olfr1352"
FT                   /note="synonyms: GA_x6K02T2QGN0-2828447-2827518, MOR139-1,
FT                   GA_x5J8B7W5685-288383-287430"
FT   mRNA            <1..>930
FT                   /gene="Olfr1352"
FT                   /product="olfactory receptor Olfr1352"
FT   CDS_pept        1..930
FT                   /codon_start=1
FT                   /gene="Olfr1352"
FT                   /product="olfactory receptor Olfr1352"
FT                   /db_xref="GOA:Q8VGX5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031186"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGX5"
FT                   /protein_id="AAP71736.1"
FT                   /translation="MEPRNNTHILEFFLLGFSQDPNLQPVICGLFLSMYLITVVGNLLI
FT                   ILTIISDANLHTPMYFFLSNLSFVDICFVSTTVPKMLVNIQTKRKSISYADCITQMYFF
FT                   LIFVELDNFLLAVMAYDRYVAICHPLHYTGIMNRRLCGFLVLVCWIVSVLHALLQSMMV
FT                   LRLSFCTDLEIPHFFCELNQVAQLTCSDTFLNDVVMYFALVLLAIVPLFGILYSYSKIV
FT                   SSIRAMSTVQGKYKAFSTCASHLSVVSLFYFTGLGVYLSSAVSHSSQASATASVMYTVV
FT                   TPMLNPFIYSLRNKDVKGALKRLLGVKL"
XX
SQ   Sequence 930 BP; 227 A; 218 C; 175 G; 310 T; 0 other;
     atggagccaa gaaacaatac tcatatttta gaattttttc tattgggatt ttcacaggac        60
     ccaaacttgc agcctgttat atgtggcctt ttcctctcca tgtacttgat cactgtagtt       120
     ggaaacttgc tcattattct caccatcatc tcagatgcca acttgcatac acccatgtac       180
     ttttttctct ctaacctgtc atttgtggat atctgctttg tttccaccac tgtcccaaaa       240
     atgcttgtga atattcaaac aaagagaaaa tccattagct atgcagattg catcacccag       300
     atgtactttt ttctgatttt tgtggaattg gacaacttcc tcctggctgt aatggcctat       360
     gaccgttatg tggccatctg ccatccactg cattatactg gtatcatgaa tcgcagactc       420
     tgtggatttt tggttcttgt atgctggatt gtgagtgttc tgcatgcctt gttacaaagc       480
     atgatggtgc tgcggctgtc cttctgcaca gacttggaaa tcccacactt cttctgtgaa       540
     ttgaatcagg tggcacagct aacctgttct gacacctttc tcaatgatgt ggtcatgtat       600
     tttgcacttg ttttattagc cattgttcct ctgtttggca tcctttactc ttactccaag       660
     atagtatcct ccatacgagc aatgtccaca gttcagggga agtataaagc attttccacc       720
     tgtgcatctc atctctccgt tgtctcctta ttttacttca ctggtctagg agtatacctc       780
     agttctgcag taagtcacag ctcacaagca agtgcaacag cctctgtgat gtacacagtg       840
     gtgactccca tgctaaaccc tttcatctac agcctgagga ataaagatgt aaaaggagcc       900
     ctgaagaggc tcttaggggt aaaactatga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page