(data stored in ACNUC7820 zone)

EMBL: AY318564

ID   AY318564; SV 1; linear; genomic DNA; STD; MUS; 933 BP.
XX
AC   AY318564;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus olfactory receptor Olfr1355 (Olfr1355) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-933
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-933
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; b7e293b1fd873c28eacdec3dfb49bc08.
DR   Ensembl-Gn; ENSMUSG00000062873; mus_musculus.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017295; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000078414; mus_musculus.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025804; mus_musculus_nodshiltj.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..933
FT                   /organism="Mus musculus"
FT                   /chromosome="10"
FT                   /map="10B5-10C2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>933
FT                   /gene="Olfr1355"
FT                   /note="synonyms: GA_x6K02T2QGN0-2932609-2931677, M65,
FT                   OR27-3, OR912-47M4, OR912-47M7, OR912-47M8, rF12m,
FT                   GA_x5J8B7W4DUT-12263-11330"
FT   mRNA            <1..>933
FT                   /gene="Olfr1355"
FT                   /product="olfactory receptor Olfr1355"
FT   CDS_pept        1..933
FT                   /codon_start=1
FT                   /gene="Olfr1355"
FT                   /product="olfactory receptor Olfr1355"
FT                   /db_xref="GOA:Q7TQU9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031189"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQU9"
FT                   /protein_id="AAP71739.1"
FT                   /translation="MESGNRTRRISSFFLLGFSENPHLQFLIFVLFLSMYLVTVLGNLL
FT                   IIMVTITQSPLHTPMYFFLANLSFVDICFTSTTVPKMLVNIQTQSKAITYADCISQMSV
FT                   FLVFGELDNFLLAVMAYDRYVAICHPLYYTVIVNQQLCMLMVLLSWVVSILHAFLQSSI
FT                   VLQLTFCGDVKIPHFFCELNQLSQLTCSDSLSSHLIMHLVPVLLGAISFSSILYSYFKI
FT                   VSSICSISSVQGKYKAFSTCVSHLSIVSLFYSTGLGVYVSSAVVQSSHSSARASVMYTV
FT                   VTPMLNPFIYSLRNKDVKKAVERLLEGKL"
XX
SQ   Sequence 933 BP; 230 A; 229 C; 168 G; 306 T; 0 other;
     atggaatcag gcaacagaac aagaagaatt tcaagttttt ttcttcttgg attttcagaa        60
     aacccacacc ttcaattcct catttttgta ctgttccttt ccatgtacct ggtaacagtg       120
     cttgggaacc tgctcatcat catggtcacc atcacacagt ctcccctgca cacacccatg       180
     tacttcttcc ttgctaacct gtcctttgtg gacatctgtt tcacctccac cactgtccca       240
     aagatgctgg taaatataca gactcaaagc aaggccatta catatgcaga ctgtattagc       300
     cagatgtctg tcttcttggt ttttggagaa ctggacaact ttctcctggc tgtgatggcc       360
     tatgaccgat atgtggctat ctgtcaccca ttgtattaca cagtcattgt taaccaacaa       420
     ctctgtatgc tgatggttct gctgtcctgg gttgttagca tcctacatgc cttcttacag       480
     agctcaattg tactacagtt gaccttttgt ggagatgtaa aaattcccca cttcttctgt       540
     gagcttaacc agctgtctca actcacatgt tcagacagct tatcaagcca cctcataatg       600
     catcttgtac ctgttctatt gggagccatt tccttcagta gtatccttta ctcttatttc       660
     aagatagtgt cctccatatg ttctatctcc tcagttcaag ggaagtacaa ggcattttct       720
     acatgtgtct ctcacctttc cattgtctcc ttattttata gtacaggcct tggagtgtat       780
     gtcagttctg ctgtggtcca aagctctcac tcttctgcaa gagcctctgt gatgtatact       840
     gtggtcaccc cgatgctgaa ccccttcatt tatagtctaa ggaataaaga tgtgaagaaa       900
     gctgtggaaa gactattaga aggaaaactg taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page