(data stored in ACNUC15260 zone)

EMBL: AY318633

ID   AY318633; SV 1; linear; genomic DNA; STD; MUS; 939 BP.
XX
AC   AY318633;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   27-APR-2004 (Rel. 79, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor Olfr1416 (Olfr1416) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-939
RX   DOI; 10.1186/gb-2003-4-11-r71.
RX   PUBMED; 14611657.
RA   Young J.M., Shykind B.M., Lane R.P., Tonnes-Priddy L., Ross J.A.,
RA   Walker M., Williams E.M., Trask B.J.;
RT   "Odorant receptor expressed sequence tags demonstrate olfactory expression
RT   of over 400 genes, extensive alternate splicing and unequal expression
RT   levels";
RL   Genome Biol. 4(11):R71-R71(2003).
XX
RN   [2]
RP   1-939
RA   Sanders K.;
RT   ;
RL   Submitted (06-JUN-2003) to the INSDC.
RL   Celera Discovery System, Celera Genomics, 45 West Gude Drive, Rockville, MD
RL   20850, USA
XX
DR   MD5; 9267ca27564c34811fae3453928df2eb.
DR   Ensembl-Gn; ENSMUSG00000067064; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016317; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016297; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016258; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016253; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016082; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016712; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_DBA2J_G0016162; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016160; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016233; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016186; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016753; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015725; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000086837; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214928; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0021376; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0021345; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0021308; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0021293; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0021112; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0021813; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_DBA2J_T0021190; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0021203; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0021284; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0021176; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0021855; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0020698; mus_musculus_wsbeij.
XX
CC   AY317244-AY318733 were obtained from Celera Discovery System Mouse
CC   Genome Assembly Release 13.  Some of these may be redundant with
CC   the previous dataset (AY072961-AY074256, AY096300-AY096356 and
CC   AF500625-AF500776) which was obtained from an earlier assembly
CC   release.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..939
FT                   /organism="Mus musculus"
FT                   /chromosome="1"
FT                   /map="1D"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>939
FT                   /gene="Olfr1416"
FT                   /note="synonyms: GA_x6K02T2R7CC-81277975-81278913,
FT                   MOR103-3, GA_x5J8B7W88U1-3184557-3185495"
FT   mRNA            <1..>939
FT                   /gene="Olfr1416"
FT                   /product="olfactory receptor Olfr1416"
FT   CDS_pept        1..939
FT                   /codon_start=1
FT                   /gene="Olfr1416"
FT                   /product="olfactory receptor Olfr1416"
FT                   /db_xref="GOA:Q8VGU4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031250"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGU4"
FT                   /protein_id="AAP71793.1"
FT                   /translation="MRGENITKVSTFILLGFPTAPELQYLLFLLFLLAYLFVLVENLTI
FT                   ILTVWSSASLHRPMYYFLGSLSFLEIWYVSDIIPKMLDGFLLQRKRISFIGCMTQLYFF
FT                   SSLVCTECVLLASMAYDRYVAICHPLRYQVIMTTGLCVQLVAFSFASGFTISVIKVYFI
FT                   SSATFCGSNVLNHFFCDISPILKLACTDFSTAELVDFILAFIILVFPLLATILSYGHIT
FT                   LAVLRIPSATGRWRAFSTCASHLTVVTFFYMAMIFMYVRPQAIDTRSSNKLISAVYTVL
FT                   TPMMNPLIYCLRNTEFKDAVRRTLGLGNTPQ"
XX
SQ   Sequence 939 BP; 174 A; 302 C; 196 G; 267 T; 0 other;
     atgagggggg agaacatcac caaggtcagc accttcatcc tgctgggctt ccccacagcc        60
     cctgagctgc aatacctgct cttcctcctc ttcctgctcg cctacctctt tgtgctggtg       120
     gagaacctga ccatcatcct cactgtctgg agcagcgcct ccctccacag acccatgtac       180
     tacttcctgg gatccttgtc tttcctagag atctggtatg tgtcagacat catccccaaa       240
     atgctggatg gcttcctctt gcagaggaaa cgcatctctt tcattggatg catgactcag       300
     ctctacttct tcagctccct ggtatgtaca gagtgtgtac tcctggcttc catggcctat       360
     gaccgctatg tggccatctg ccaccccctg cgctaccaag tcatcatgac cacagggctg       420
     tgtgtccagc ttgtggcctt ctcttttgct agtggcttca ccatctctgt gattaaggtc       480
     tactttatct ccagcgccac cttctgtggc tccaatgtct tgaaccactt cttctgtgac       540
     atctccccca tcctcaagct ggcctgcact gacttctcta ctgcagagct ggtggacttc       600
     atcctggcct tcatcattct ggtgttccca ctcttggcca ccattctctc ctatggccac       660
     atcaccctgg ctgtgctgcg catcccttca gccacaggcc ggtggagagc cttctccacc       720
     tgtgcttccc acctcactgt ggtcaccttc ttctacatgg ccatgatctt catgtatgtg       780
     cgaccccagg ccattgatac ccggagctcc aacaagctca tctctgctgt gtacaccgtc       840
     ctcacgccca tgatgaatcc tttgatctac tgtctgagga atactgaatt taaggatgct       900
     gtgagaagaa ctttgggatt gggaaatact ccccagtag                              939
//

If you have problems or comments...

PBIL Back to PBIL home page