(data stored in ACNUC1829 zone)

EMBL: AY358087

ID   AY358087; SV 1; linear; mRNA; STD; HUM; 3063 BP.
XX
AC   AY358087;
XX
DT   09-OCT-2003 (Rel. 77, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens clone DNA128422 EGDC3042 (UNQ3042) mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3063
RX   DOI; 10.1101/gr.1293003.
RX   PUBMED; 12975309.
RA   Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D., Brush J., Chen J.,
RA   Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D.,
RA   Foster J., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A., Kim H.S.,
RA   Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.,
RA   Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J.,
RA   Smith V., Stinson J., Vagts A., Vandlen R., Watanabe C., Wieand D.,
RA   Woods K., Xie M.H., Yansura D., Yi S., Yu G., Yuan J., Zhang M., Zhang Z.,
RA   Goddard A., Wood W.I., Godowski P.;
RT   "The secreted protein discovery initiative (SPDI), a large-scale effort to
RT   identify novel human secreted and transmembrane proteins: a bioinformatics
RT   assessment";
RL   Genome Res. 13(10):2265-2270(2003).
XX
RN   [2]
RP   1-3063
RA   Clark H.F.;
RT   ;
RL   Submitted (01-AUG-2003) to the INSDC.
RL   Department of Bioinformatics, Genentech, Inc., 1 DNA Way, South San
RL   Francisco, CA 94080, USA
XX
DR   MD5; 99a3c32b085e2c3d211da8ecd21d9e16.
DR   Ensembl-Gn; ENSG00000157570; homo_sapiens.
DR   Ensembl-Tr; ENST00000340160; homo_sapiens.
DR   Ensembl-Tr; ENST00000520358; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3063
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="DNA128422"
FT                   /db_xref="taxon:9606"
FT   gene            1..3063
FT                   /locus_tag="UNQ3042"
FT   CDS_pept        163..909
FT                   /codon_start=1
FT                   /locus_tag="UNQ3042"
FT                   /product="EGDC3042"
FT                   /note="PRO9858"
FT                   /db_xref="GOA:Q96SJ8"
FT                   /db_xref="H-InvDB:HIT000252133.12"
FT                   /db_xref="HGNC:HGNC:20660"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96SJ8"
FT                   /protein_id="AAQ88454.1"
FT                   /translation="MEGDCLSCMKYLMFVFNFFIFLGGACLLAIGIWVMVDPTGFREIV
FT                   AANPLLLTGAYILLAMGGLLFLLGFLGCCGAVRENKCLLLFFFLFILIIFLAELSAAIL
FT                   AFIFRENLTREFFTKELTKHYQGNNDTDIFSATWNSVMITFGCCGVNGPEDFKFASVFR
FT                   LLTLDSEEVPEACCRREPQSRDGVLLSREECLLGRSLFLNKQGCYTVILNTFETYVYLA
FT                   GALAIGVLAIELFAMIFAMCLFRGIQ"
XX
SQ   Sequence 3063 BP; 656 A; 966 C; 752 G; 689 T; 0 other;
     gtggaaagag gtgagcatct cctggaccac cctcaagctt caggtgagct gagcttctaa        60
     cactaccatc aaagcaactg gaaccccttg aatttgattt ctggagacgc gagcataatc       120
     cttttgcaga catctcaacg ctggctctcc aggtggagca ccatggaagg cgactgtctg       180
     agctgcatga agtatctgat gtttgtattc aatttcttca tatttctggg cggggcctgc       240
     ctgctggcca tcggcatctg ggtcatggtg gaccccaccg gcttccggga gatcgtggct       300
     gccaatcctc tgctcctcac gggcgcctac atcctcctgg ccatgggggg cctgctcttt       360
     ctgctcggct tcctgggctg ctgcggggcc gtccgtgaga acaagtgtct gctgctattt       420
     ttcttcctgt tcatcctgat catcttcctg gcagagctct cagcagccat cctggccttc       480
     atcttcaggg aaaatctcac ccgagaattc ttcaccaagg agctcaccaa gcactaccag       540
     ggcaataacg acacagacat cttctctgcc acctggaact cggtcatgat cacatttggt       600
     tgctgcgggg tcaacgggcc tgaagacttt aagtttgcat ctgtgtttcg actcctgacc       660
     ctggatagtg aagaggtgcc ggaggcctgc tgccggaggg aaccccaaag tcgggacggg       720
     gtcctgctga gccgggagga gtgcctcctg ggaaggagcc tattcctaaa caagcagggc       780
     tgttacacgg tgatcctcaa caccttcgag acctacgtct acttggccgg agcccttgcc       840
     atcggggtac tggccatcga gcttttcgcc atgatctttg ccatgtgcct cttccggggc       900
     atccagtaga gggtatggcc tgaagcctga agactcgccc cacccaccac tgcccagcac       960
     ccaatgtcct cccgtgcccc tccccgctgt cctcttggcc ccaggggaga agatgaggcc      1020
     atcagagatg gccaggagaa gggccagggg aatagagcta tttttttaac aaaacaaaat      1080
     gaagacaaaa atatggactg atgtatcctc gcctggactc agggcaggtg ccgtgggttc      1140
     tccagagacc ccagcacctg gcccaggatg caggctgctc tagagaccaa aggaacacca      1200
     ggcccagcgc cctctttggt ccagccagac cctgggccct ctctcctcac tgcaccagga      1260
     cctgatgcca agaaagtgag gatttaggca acaaggaggc aaaagcaaat ctcagagaag      1320
     tcatcaaagc ccaggggctg cacggagatt cagctgccat gtctttgagg actcggaacc      1380
     cacagcgcaa tccctggtcc actggaggat ggactgttcc ccccttcagg ccggggccaa      1440
     gagtgagctg ctaacacggc atccaagaat ggcccagctg gtaggatcct tgctttcccc      1500
     atctgttgga ccaaataatc tcaaaggccc agagaggaca gtgaccatcc acagacacac      1560
     agcacaggcg tgacagttct gaaaagaagc tgagttgtct ccaggctgct gtcactgcat      1620
     ccaggactct gtcagctctg ctgcccacat gcacccctgg cctcagcatc ccggttcccc      1680
     cagacaagag agggcaagtc agccaggaac tgcctcctcc ctgctctaca gctaagaaaa      1740
     caccattcca tgacttccca ccgcgccctc gctcctacct ccccacacct ctctctcagt      1800
     ccccaggaac acacagaggt gcacatcaca ttcccttgtc cacactgccc gcctctccca      1860
     catgccaccc ccttccctgt ccttccccaa ctccccagct ccaagagtgg aagaaatccc      1920
     caagatcatc tgggtctccc tctccacacc cagaactgag gcttggatat cttcttcaac      1980
     atccttgcca agacttctcc accctcttgc atacctccag ggacagagag cttactacct      2040
     cccaaggcag cctcctgcct ttggactgct ctgactttag catcagctta atacacagaa      2100
     gaggtttctg tttttctgtg gctctgtcca tggcatccca cttgcccact ctccttcctg      2160
     gagtgttgag gtcacacatt gactcccctg agccctcttc tctccaggct aaagaatccc      2220
     gaaggcatcg aggccatttc tgctgcaaca aggtttcctg tctcttcact gtccgcacat      2280
     ttcttagtat tccctccagg cttgggcagg gagactcgca gatgcacacc cacaagtatt      2340
     cagttctcaa actctagacg agtgttggca actggattgc aagatgctcc taccctgata      2400
     gatcaggggt ggctgctgga ggctgtgctg gggatctgag gtttggtctg ggctcagtgg      2460
     gagatggcag tgcaatcctg atgagtgatg tctgccaggc accgtaagtt tgattagtga      2520
     tgtctgccac gggcagggat ggaaggagca gtgtgatgtc tgctctcttc tctcccctct      2580
     gtccctcttc aggaagaaag agctcattct gtctcacaag ccaccggcat cctgtatcag      2640
     cttccagcct cccctcaggc tttccagtca ccagggacac tcggagccac agcctagagc      2700
     cccgtgttcc ctggcctgtg cgtctgcccc cttctgagat gcagccagaa gctctgtgcc      2760
     tgctgcaaag attcaggtgg accctcctct aatctcctcc tgctgtgccc gccagtcctt      2820
     gccctcccac caggtctctg agctcagtct taccaaattc gccctttaac agcttgctct      2880
     ggcaacccca taaatgacac ctgagctccg tagaagctaa gctcctgaga cccaggggga      2940
     cctgccactg gtaccgcggc ccagcctggg gcctgggggc tgcccctctt gaaccaccca      3000
     catgcttagc cccagctttt tggaagaggc aaatggctgg tctgaggatg acacacaaaa      3060
     aca                                                                    3063
//

If you have problems or comments...

PBIL Back to PBIL home page