(data stored in ACNUC4482 zone)

EMBL: AY358325

ID   AY358325; SV 2; linear; mRNA; STD; HUM; 1450 BP.
XX
AC   AY358325;
XX
DT   09-OCT-2003 (Rel. 77, Created)
DT   31-JAN-2018 (Rel. 135, Last updated, Version 5)
XX
DE   Homo sapiens clone DNA57039 ITGA10 (UNQ468) mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[Genome Res. 2003 Dec;13(12):2759]
RP   1-1450
RX   DOI; 10.1101/gr.1293003.
RX   PUBMED; 12975309.
RA   Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D., Brush J., Chen J.,
RA   Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D.,
RA   Foster J., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A., Kim H.S.,
RA   Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.,
RA   Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J.,
RA   Smith V., Stinson J., Vagts A., Vandlen R., Watanabe C., Wieand D.,
RA   Woods K., Xie M.H., Yansura D., Yi S., Yu G., Yuan J., Zhang M., Zhang Z.,
RA   Goddard A., Wood W.I., Godowski P., Gray A.;
RT   "The secreted protein discovery initiative (SPDI), a large-scale effort to
RT   identify novel human secreted and transmembrane proteins: a bioinformatics
RT   assessment";
RL   Genome Res. 13(10):2265-2270(2003).
XX
RN   [2]
RP   1-1450
RA   Clark H.F.;
RT   ;
RL   Submitted (01-AUG-2003) to the INSDC.
RL   Department of Bioinformatics, Genentech, Inc., 1 DNA Way, South San
RL   Francisco, CA 94080, USA
XX
RN   [3]
RC   Sequence update by database staff to remove vector contamination
RP   1-1450
RA   Clark H.F.;
RT   ;
RL   Submitted (29-JAN-2018) to the INSDC.
RL   Department of Bioinformatics, Genentech, Inc., 1 DNA Way, South San
RL   Francisco, CA 94080, USA
XX
DR   MD5; aee9e0c41f8f94f3fe7562a0e8b0f38c.
DR   Ensembl-Gn; ENSG00000143127; homo_sapiens.
DR   Ensembl-Tr; ENST00000369304; homo_sapiens.
DR   Ensembl-Tr; ENST00000539363; homo_sapiens.
XX
CC   On Jan 29, 2018 this sequence version replaced AY358325.1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1450
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="DNA57039"
FT                   /db_xref="taxon:9606"
FT   gene            1..1450
FT                   /locus_tag="UNQ468"
FT   CDS_pept        98..472
FT                   /codon_start=1
FT                   /locus_tag="UNQ468"
FT                   /product="ITGA10"
FT                   /note="PRO827"
FT                   /db_xref="GOA:O75578"
FT                   /db_xref="H-InvDB:HIT000252369.13"
FT                   /db_xref="HGNC:HGNC:6135"
FT                   /db_xref="InterPro:IPR000413"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR013649"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="InterPro:IPR032695"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:O75578"
FT                   /protein_id="AAQ88691.1"
FT                   /translation="MELPFVTHLFLPLVFLTGLCSPFNLDEHHPRLFPGPPEAEFGYSV
FT                   LQHVGGGQRWMLVGAPWDGPSGDRRGDVYRCPVGGAHNAPCAKGHLGDYQLGNSSHPAV
FT                   NMHLGMSLLETDGDGGFMVS"
XX
SQ   Sequence 1450 BP; 373 A; 336 C; 415 G; 326 T; 0 other;
     ttgggagggg gcaggatggg agggaaagtg aagaaaacag aaaaggagag ggacagaggc        60
     cagaggactt ctcatactgg acagaaaccg atcaggcatg gaactcccct tcgtcactca       120
     cctgttcttg cccctggtgt tcctgacagg tctctgctcc ccctttaacc tggatgaaca       180
     tcacccacgc ctattcccag ggccaccaga agctgaattt ggatacagtg tcttacaaca       240
     tgttgggggt ggacagcgat ggatgctggt gggcgccccc tgggatgggc cttcaggcga       300
     ccggaggggg gacgtttatc gctgccctgt agggggggcc cacaatgccc catgtgccaa       360
     gggccactta ggtgactacc aactgggaaa ttcatctcat cctgctgtga atatgcacct       420
     ggggatgtct ctgttagaga cagatggtga tgggggattc atggtgagct aaggagaggg       480
     tggtggcagt gtctctgaag gtccataaaa gaaaaaagag aagtgtggta agggaaaatg       540
     gtctgtgtgg aggggtcaag gagttaaaaa ccctagaaag caaaaggtag gtaatgtcag       600
     ggagtagtct tcatgcctcc ttcaactggg agcatgttct gagggtgccc tcccaagcct       660
     gggagtaact atttccccca tccccaggcc tgtgcccctc tctggtctcg tgcttgtggc       720
     agctctgtct tcagttctgg gatatgtgcc cgtgtggatg cttcattcca gcctcaggga       780
     agcctggcac ccactgccca acgtgagcca gaggaaggct gagtacttgg ttcccagaag       840
     gagatactgg gtgggaaaaa gatggggcaa agcggtatga tgcctggcaa agggcctgca       900
     tggctatcct cattgctacc taatgtgctt gcaaaagctc catgtttcct aacagattca       960
     gactcctggc caggtgtggt ggcccacacc tgtaattcta gcactttggg aggccaaggt      1020
     gggcagatca cttgaggtca ggagttcaag accagcctgg ccaacatggt gaaactccat      1080
     ctctactaaa aaaaaaaaaa tacaaaaatt agctgggtgc gctagtgcat gcctgtaatc      1140
     tcatctactc gggaggctaa gacaggagac tctcacttca acccaggagg tggaggttgc      1200
     ggtgagccaa gattgtgcct ctgcactcta gcgtgggtga cagagtaagc gagactccat      1260
     ctcaaaaata ataataataa taattcagac tccttatcag gagtccatga tctggcctgg      1320
     cacagtaact catgcctgta atcccaacat tttgggaggc caacgcagga ggattgcttg      1380
     aggtctggag gtttgagacc agcctgggca acatagaaag accccatctc taaataaatg      1440
     ttttaaaaat                                                             1450
//

If you have problems or comments...

PBIL Back to PBIL home page