(data stored in ACNUC15260 zone)

EMBL: AY374998

ID   AY374998; SV 1; linear; genomic DNA; STD; MUS; 918 BP.
XX
AC   AY374998;
XX
DT   18-SEP-2003 (Rel. 77, Created)
DT   17-DEC-2003 (Rel. 78, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor 99 (Olfr99) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-918
RX   DOI; 10.1093/hmg/ddg317.
RX   PUBMED; 14506126.
RA   Amadou C., Younger R.M., Sims S., Matthews L.H., Rogers J., Kumanovics A.,
RA   Ziegler A., Beck S., Lindahl K.F.;
RT   "Co-duplication of olfactory receptor and MHC class I genes in the mouse
RT   major histocompatibility complex";
RL   Hum. Mol. Genet. 12(22):3025-3040(2003).
XX
RN   [2]
RP   1-918
RA   Amadou C., Younger R.M., Sims S., Matthews L.H., Rogers J., Kumanovics A.,
RA   Ziegler A., Beck S., Fischer Lindahl K.;
RT   ;
RL   Submitted (26-AUG-2003) to the INSDC.
RL   Howard Hughes Medical Institute and Center for Immunology, Southwestern
RL   Medical Center, University of Texas, 5323 Harry Hines Blvd, Dallas, TX
RL   75390-9050, USA
XX
DR   MD5; 2cfa439b988c289ad9be335fecd41021.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..918
FT                   /organism="Mus musculus"
FT                   /strain="129/SvJ"
FT                   /mol_type="genomic DNA"
FT                   /note="polymorphisms observed between sequences in strains
FT                   C57BL/6J, 129/SvJ, DBA/2J, and A/J"
FT                   /db_xref="taxon:10090"
FT   gene            1..918
FT                   /gene="Olfr99"
FT   mRNA            <1..>918
FT                   /gene="Olfr99"
FT                   /product="olfactory receptor 99"
FT   CDS_pept        1..918
FT                   /codon_start=1
FT                   /gene="Olfr99"
FT                   /product="olfactory receptor 99"
FT                   /db_xref="GOA:Q6UAG5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2177482"
FT                   /db_xref="UniProtKB/TrEMBL:Q6UAG5"
FT                   /protein_id="AAQ77024.1"
FT                   /translation="MNCSQAPTLILLGLSSDAEKWQPLFSIFLVLYLLGLLGNLLLLLA
FT                   IGTDVHLHTPMYFFLSQLSFVDLCFITTTAPKMLEALWTGDGSISFSGCLTQLYFFAVF
FT                   ADMDNLLLAVMAIDRYAAICHPLRYSALMTPFRCGVLVSGSWGVTNCVSLTHTLLLSKL
FT                   YFHTNQEIPHFFCEFGPLLLLSCSDTHLNKILVIILVGILGISAVLCIVSSYGCIFYAV
FT                   AKVPSAQGKRKALSTCSSHLSVVLLFYSTVFATYLKPPSSSRSSEEVVAAVMYSLVTPT
FT                   LNPFIYSLRNKDVKSSLRRILNME"
XX
SQ   Sequence 918 BP; 197 A; 221 C; 187 G; 313 T; 0 other;
     atgaactgca gtcaggctcc tacattaatc ctcttgggac tgtctagtga tgcagagaaa        60
     tggcagcccc tctttagcat cttccttgtt ctatacttgc tgggtctctt agggaacctg       120
     ctacttttgt tagctattgg cactgatgtc cacctccaca cccccatgta tttcttcctc       180
     agtcagctct catttgtgga tctttgcttc atcaccacca cagcccctaa aatgctggag       240
     gctctgtgga ctggagatgg atcaatctca ttctctggat gcctgactca gttgtacttc       300
     tttgctgttt ttgctgacat ggataacctg cttctagcag tcatggctat tgacaggtat       360
     gccgctatct gtcatccact gcgctactca gctctcatga ctccttttag atgtggggtt       420
     ctagtcagtg ggtcatgggg agtaactaat tgtgtgtctc tgacccatac tttgttgctc       480
     tctaagttat atttccatac caatcaagag attcctcatt ttttctgtga atttgggcct       540
     ctcttattgc tttcctgctc agatactcac ctcaataaaa tcctggtgat aattttggtt       600
     ggaattttag gaatcagtgc agttctctgc attgtaagtt cttatggttg tattttttat       660
     gctgtggcta aggttccatc agcacagggg aaaaggaaag cattgtccac atgcagttcc       720
     cacctctctg tagtcctcct tttctacagc acagtctttg ctacctacct gaagccccca       780
     tctagttctc gttcctctga ggaggtggta gctgctgtca tgtattctct cgtaactccc       840
     actctgaatc ccttcattta tagtctgaga aataaggatg ttaagagttc attgaggaga       900
     atcctaaaca tggagtag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page