(data stored in ACNUC15260 zone)

EMBL: AY375030

ID   AY375030; SV 1; linear; genomic DNA; STD; MUS; 927 BP.
XX
AC   AY375030;
XX
DT   18-SEP-2003 (Rel. 77, Created)
DT   17-DEC-2003 (Rel. 78, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor 128 (Olfr128) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-927
RX   DOI; 10.1093/hmg/ddg317.
RX   PUBMED; 14506126.
RA   Amadou C., Younger R.M., Sims S., Matthews L.H., Rogers J., Kumanovics A.,
RA   Ziegler A., Beck S., Lindahl K.F.;
RT   "Co-duplication of olfactory receptor and MHC class I genes in the mouse
RT   major histocompatibility complex";
RL   Hum. Mol. Genet. 12(22):3025-3040(2003).
XX
RN   [2]
RP   1-927
RA   Amadou C., Younger R.M., Sims S., Matthews L.H., Rogers J., Kumanovics A.,
RA   Ziegler A., Beck S., Fischer Lindahl K.;
RT   ;
RL   Submitted (26-AUG-2003) to the INSDC.
RL   Howard Hughes Medical Institute and Center for Immunology, Southwestern
RL   Medical Center, University of Texas, 5323 Harry Hines Blvd, Dallas, TX
RL   75390-9050, USA
XX
DR   MD5; 733b25a6066bf662252e5cd93f308fb3.
DR   Ensembl-Gn; ENSMUSG00000059030; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0023689; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023660; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023459; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_CBAJ_G0023434; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023556; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000080231; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216440; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0047693; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0047654; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0047392; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_CBAJ_T0047324; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0047401; mus_musculus_nodshiltj.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..927
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="genomic DNA"
FT                   /note="polymorphisms observed between sequences in strains
FT                   C57BL/6J, 129/SvJ, DBA/2J, and A/J"
FT                   /db_xref="taxon:10090"
FT   gene            1..927
FT                   /gene="Olfr128"
FT   mRNA            <1..>927
FT                   /gene="Olfr128"
FT                   /product="olfactory receptor 128"
FT   CDS_pept        1..927
FT                   /codon_start=1
FT                   /gene="Olfr128"
FT                   /product="olfactory receptor 128"
FT                   /db_xref="GOA:Q7TRJ1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2177511"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRJ1"
FT                   /protein_id="AAQ77056.1"
FT                   /translation="MTPRNMTTMSGFLLMGFSDNHELQILQALLFLLTYLLGSAGNFII
FT                   ITITTLDPQLQSPMYYFLKHLSILDLSSLSVTVPQYVDSSLARSGYISYGQCMLQIFFF
FT                   TGLAWSEVALLTVMSYDRYVAICLPLHYEVIMSPRKCTWAVAAVWLSGGISGTLFTAST
FT                   LSIRFCGHKIIHQFFCDIPQLLKLSCSNDDFGLLKVSTFIAVMGFACFMGIAFSYGQIF
FT                   STVLRMPSAEGRSKVFSTCLPHLFVVSFFLSTGICAYLKPTSDSPTTLDFMLSIFYTVL
FT                   PPTLNPVIYSLRNQSLKRAIKKLLLSE"
XX
SQ   Sequence 927 BP; 219 A; 244 C; 178 G; 286 T; 0 other;
     atgactccaa gaaacatgac aacaatgagt ggattcctcc tcatggggtt ctctgacaac        60
     catgagctgc agatcttaca ggctttgctg tttttgctga catacctatt gggctcagca       120
     gggaacttca tcattatcac catcacaaca ctggacccac agctccagtc tccaatgtat       180
     tactttctga agcacctttc cattctggat ctctcatccc tctctgtcac agtcccccag       240
     tatgttgaca gttccctggc acgaagtggc tacatttcat atgggcagtg catgctgcag       300
     atatttttct tcacaggttt ggcctggagt gaggtggccc ttcttacagt gatgtcttat       360
     gaccgctatg tggccatctg cctcccactg cactatgagg tcataatgag tcccagaaag       420
     tgcacttggg ctgtggcagc tgtgtggcta agtggaggta tctcaggaac attattcaca       480
     gcaagtacac tctctatcag attctgtggg cacaaaatta ttcaccagtt cttctgtgat       540
     atcccgcaat tgctcaagct ctcctgctct aatgatgact ttggactact gaaagtgtct       600
     actttcattg ctgtaatggg atttgcctgc tttatgggga ttgccttctc ctatggccaa       660
     atattctcta cagttctcag gatgccctct gctgaaggcc gatctaaggt cttctccacc       720
     tgcctgcccc atcttttcgt tgtttcattt tttctctcaa caggcatttg tgcctatcta       780
     aagccaacct cagactcacc aactacttta gacttcatgc tctctatctt ttacacagta       840
     ctacccccaa ccctcaaccc tgttatctat agtctgagaa accagtcctt gaaaagagct       900
     ataaagaagt tactgttaag tgaataa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page