(data stored in ACNUC16935 zone)

EMBL: AY394942

ID   AY394942; SV 1; linear; mRNA; STD; VRT; 1116 BP.
XX
AC   AY394942;
XX
DT   14-OCT-2003 (Rel. 77, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Danio rerio clone RK046A2G11 ubiquitin C mRNA, complete cds.
XX
KW   .
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1116
RX   DOI; 10.1073/pnas.0407241101.
RX   PUBMED; 15520368.
RA   Song H.D., Sun X.J., Deng M., Zhang G.W., Zhou Y., Wu X.Y., Sheng Y.,
RA   Chen Y., Ruan Z., Jiang C.L., Fan H.Y., Zon L.I., Kanki J.P., Liu T.X.,
RA   Look A.T., Chen Z.;
RT   "Hematopoietic gene expression profile in zebrafish kidney marrow";
RL   Proc. Natl. Acad. Sci. U.S.A. 101(46):16240-16245(2004).
XX
RN   [2]
RP   1-1116
RA   Song H.D., Wu X.Y., Sun X.J., Zhou Y., Liu T.X., Deng M., Zhang G.W.,
RA   Sheng Y., Chen Y., Ruan Z., Jiang C.L., Fan H.Y., Zon L.I., Kanki J.P.,
RA   Look A.T., Chen Z.;
RT   ;
RL   Submitted (18-SEP-2003) to the INSDC.
RL   State Key Lab for Medical Genomics, Shanghai Institute of Hematology,
RL   Ruijin Hospital Affiliated to Shanghai Second Medical University, 197 Rui
RL   Jin Road II, Shanghai 200025, P. R. China
XX
DR   MD5; 0fd6f7d8f767880c202584d2058c37ac.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1116
FT                   /organism="Danio rerio"
FT                   /mol_type="mRNA"
FT                   /clone="RK046A2G11"
FT                   /tissue_type="kidney marrow"
FT                   /db_xref="taxon:7955"
FT   CDS_pept        1..708
FT                   /codon_start=1
FT                   /product="ubiquitin C"
FT                   /note="zUBC"
FT                   /db_xref="GOA:Q6TLG3"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q6TLG3"
FT                   /db_xref="ZFIN:ZDB-GENE-050411-10"
FT                   /protein_id="AAQ94569.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKPLTGK
FT                   TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
FT                   LRLRGGMQIFVKT"
XX
SQ   Sequence 1116 BP; 343 A; 280 C; 243 G; 250 T; 0 other;
     atgcagatct tcgtcaagac ccttactggt aagaccatca cccttgaggt cgagccaagt        60
     gacaccattg agaatgtcaa ggctaaaatc caggacaaag aaggcattcc ccctgaccag       120
     cagaggttga tctttgctgg caaacagcta gaagatggcc gcaccctgtc cgactacaac       180
     atccagaaag agtccacctt gcatctggtg ttgcgtctca ggggaggcat gcagatcttc       240
     gtaaagacct tgacaggaaa gaccatcacc ctcgaggtag agccaagcga caccattgag       300
     aacgtcaagg ccaaaatcca agacaaagaa ggcattcccc ctgaccagca gaggttgatc       360
     tttgctggca aacagctaga agatggccgc accctgtctg actacaacat ccagaaagag       420
     tccaccttgc atctggtgct gcgtctcagg ggaggcatgc agatcttcgt aaaacccttg       480
     acaggaaaga ccatcaccct cgaggtagag ccaagtgaca ccattgagaa cgtcaaggcc       540
     aaaatccagg acaaagaagg cattccccct gaccagcaga ggttgatctt tgctggtaaa       600
     cagctagaag atggacgcac cctgtccgac tacaacatcc agaaagagtc caccttgcat       660
     ctggtgttgc gtctcagggg aggcatgcag atttttgtta aaacttgaca ggaaagacca       720
     tcaccctcga ggtagagcca agtgacacca ttgagaacgt caaggccaaa atccaagaca       780
     aagaaggcat tccccctgac cagcagaggt tgatctttgc tggtaaacag ctagaagatg       840
     gccgcacctt gtctgattac aacatccaga aagagtctac tttgcacctt gtgctgcgtc       900
     tccgaggagg ctcagattag aaccgacagt cttagggatg gacattaaat tctcagtatc       960
     ccctgcttat gcactcacca ctttttccca ttattttatt catattgtgt tgctaaatcc      1020
     aactacattt gtattaccat gttctttcat tagttttttt tttatctcag ctgtcaaaat      1080
     aaaagcattg aaatacaaaa aaaaaaaaaa aaaaaa                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page