(data stored in ACNUC23405 zone)

EMBL: AY445044

ID   AY445044; SV 1; linear; mRNA; STD; VRT; 936 BP.
XX
AC   AY445044;
XX
DT   19-APR-2004 (Rel. 79, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Danio rerio homeodomain protein Hb9 (hb9) mRNA, complete cds.
XX
KW   .
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-936
RX   DOI; 10.1016/j.ydbio.2003.12.026.
RX   PUBMED; 15063174.
RA   Wendik B., Maier E., Meyer D.;
RT   "Zebrafish mnx genes in endocrine and exocrine pancreas formation";
RL   Dev. Biol. 268(2):372-383(2004).
XX
RN   [2]
RP   1-936
RA   Wendik B., Maier E., Meyer D.;
RT   ;
RL   Submitted (22-OCT-2003) to the INSDC.
RL   Developmental Biology, University Freiburg, Hauptstrasse 1, Freiburg 79104,
RL   Germany
XX
DR   MD5; b53a4aa54961cdc3fcfef8d8576954bd.
DR   Ensembl-Gn; ENSDARG00000035984; danio_rerio.
DR   Ensembl-Tr; ENSDART00000052236; danio_rerio.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..936
FT                   /organism="Danio rerio"
FT                   /chromosome="7"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:7955"
FT   gene            1..936
FT                   /gene="hb9"
FT   CDS_pept        1..936
FT                   /codon_start=1
FT                   /gene="hb9"
FT                   /product="homeodomain protein Hb9"
FT                   /db_xref="GOA:Q6SYZ1"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="UniProtKB/TrEMBL:Q6SYZ1"
FT                   /db_xref="ZFIN:ZDB-GENE-040409-1"
FT                   /protein_id="AAS07018.1"
FT                   /translation="MEKSKNFRIDALLAVDPPKVQTSPLALVTSLPTSSISSSSDSVQA
FT                   VELTTNSDALQTESPSPPRISSCGLIPKPGFLNSPHSGMVGLHPQSSTGIPPQALYGHP
FT                   MYTYSAAALGQHPALSYSYPHGSHHHHHPSDPLKLTASSFQLDHWLRVSTAGMMLPKMA
FT                   DFNGQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVK
FT                   IWFQNRRMKWKRSKKAKEQAAQDAEKQKGKGNHDKMDGLEKDYQKVDSGKSNRIRDFRD
FT                   SDDEEGDNYMLNSSDCSSEDERTNDISPQP"
XX
SQ   Sequence 936 BP; 270 A; 272 C; 216 G; 178 T; 0 other;
     atggagaaat ctaaaaactt tcggatcgac gcgcttctgg ctgtcgatcc accaaaagtg        60
     cagacctcgc cgctggcgct ggtcacctcc ctgcccacct catccatatc ctcctcttcc       120
     gacagcgtcc aggcggtgga gctgaccacg aactccgacg cactccagac agagtctcca       180
     tcgccaccca ggatatcgtc ttgcggcttg attcccaaac cgggtttcct gaactctcca       240
     cattcgggca tggtcggact acaccctcag agcagtaccg ggattcctcc tcaggctctc       300
     tacggtcacc caatgtacac gtattcagca gcagcgctcg gtcagcaccc ggcgctctcg       360
     tactcatacc cgcacggttc ccaccatcat caccatccca gcgaccccct caaactcaca       420
     gccagctcct ttcagctcga ccactggctg agggtctcca ccgccggaat gatgctgcct       480
     aaaatggcag atttcaatgg ccaggcgcag tcgaacttac tcggcaagtg cagaagacca       540
     agaactgcat tcacaagcca gcagctcctt gaacttgagc atcagtttaa gctgaataaa       600
     tatctatcca gaccaaaacg ctttgaagtg gccacgtcat tgatgctaac agagacgcag       660
     gtgaaaatct ggtttcagaa caggcgcatg aaatggaagc gcagtaaaaa ggccaaagaa       720
     caagccgctc aagatgccga gaagcaaaag ggaaaaggaa accacgacaa aatggacgga       780
     ctggaaaagg actaccagaa ggtagattca gggaaaagta acagaatacg ggactttagg       840
     gacagtgacg acgaagaagg agataactat atgctgaatt catctgattg ttcctctgag       900
     gatgaacgaa ccaatgacat aagtccacaa ccatga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page