(data stored in ACNUC23405 zone)

EMBL: AY445045

ID   AY445045; SV 1; linear; mRNA; STD; VRT; 930 BP.
XX
AC   AY445045;
XX
DT   19-APR-2004 (Rel. 79, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Danio rerio homeodomain protein Mnr2a (mnr2a) mRNA, complete cds.
XX
KW   .
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-930
RX   DOI; 10.1016/j.ydbio.2003.12.026.
RX   PUBMED; 15063174.
RA   Wendik B., Maier E., Meyer D.;
RT   "Zebrafish mnx genes in endocrine and exocrine pancreas formation";
RL   Dev. Biol. 268(2):372-383(2004).
XX
RN   [2]
RP   1-930
RA   Wendik B., Maier E., Meyer D.;
RT   ;
RL   Submitted (22-OCT-2003) to the INSDC.
RL   Developmental Biology, University Freiburg, Hauptstrasse 1, Freiburg 79104,
RL   Germany
XX
DR   MD5; 694a36390f94110edb121a3501e9876b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..930
FT                   /organism="Danio rerio"
FT                   /chromosome="9"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:7955"
FT   gene            1..930
FT                   /gene="mnr2a"
FT   CDS_pept        1..930
FT                   /codon_start=1
FT                   /gene="mnr2a"
FT                   /product="homeodomain protein Mnr2a"
FT                   /db_xref="GOA:Q6SYZ0"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="UniProtKB/TrEMBL:Q6SYZ0"
FT                   /db_xref="ZFIN:ZDB-GENE-040415-1"
FT                   /protein_id="AAS07019.1"
FT                   /translation="MDKSKNFRIDALLSESSQQIVRGDSPGLCSEGVDVDICKRTENSL
FT                   PRAFQLQTGVIPKPGMLNISHPGLTSLSQGSMPGMYPSPMYSIKALGAQHPSFAYSGFT
FT                   QPYPDHLKAAAMAGSLPLEHWLRAGLIMPRLADYSGAPQSGLIGKCRRPRTAFTSQQLL
FT                   ELENQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSRKAKEQAAQLETDG
FT                   CKSGKRGNKPKDLSRCSAHDEDEDLDPEEEAEEDEEEFRRSINVGVSLPRHSDFLQHSS
FT                   ALSYSSHGSYSDDDLEEIGADRKIRLGL"
XX
SQ   Sequence 930 BP; 257 A; 242 C; 244 G; 187 T; 0 other;
     atggataagt cgaagaactt tcggatagac gctctgctgt cggaaagctc tcagcagatc        60
     gtgcgcggcg attccccggg actgtgcagt gaaggtgttg atgtcgacat atgcaaacgg       120
     acagaaaact ctcttcctcg cgcttttcag ctccagacag gggtcatacc caaaccgggc       180
     atgctaaata tttctcatcc aggattaacc tcactttctc aagggtctat gccaggaatg       240
     tatccatcgc caatgtactc catcaaggca ctgggagcgc agcatcccag cttcgcgtac       300
     tctggtttca cgcagccgta tccggatcac ctgaaagcgg ctgccatggc cggttcatta       360
     ccgctggagc actggctgcg tgcgggactc ataatgcctc gccttgcaga ctacagcggg       420
     gcacctcagt ctggactgat tggaaagtgc cggagaccac gtacagcctt caccagccag       480
     caactcctgg agctggaaaa tcagttcaaa ctcaacaagt atctatcaag acccaagcgc       540
     tttgaagtgg ccacatctct catgctgact gagacacaag taaagatttg gttccagaac       600
     cggcgaatga aatggaagcg cagccgtaaa gctaaagagc aggctgcgca actggaaaca       660
     gacgggtgta aatccggcaa gagaggaaac aagcccaaag acctgagccg ctgcagtgca       720
     catgacgaag atgaggatct ggacccagag gaggaagccg aagaagacga agaggagttc       780
     agacgatcta ttaatgtagg tgtgagtcta cctcgccatt cagacttcct gcagcacagc       840
     tcagcactga gctacagctc tcatggctct tactctgacg acgatctgga agaaattgga       900
     gcagaccgaa agatcaggct agggttataa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page