(data stored in ACNUC23405 zone)

EMBL: AY445046

ID   AY445046; SV 1; linear; mRNA; STD; VRT; 1032 BP.
XX
AC   AY445046;
XX
DT   19-APR-2004 (Rel. 79, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Danio rerio homeodomain protein Mnr2b (mnr2b) mRNA, complete cds.
XX
KW   .
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-1032
RX   DOI; 10.1016/j.ydbio.2003.12.026.
RX   PUBMED; 15063174.
RA   Wendik B., Maier E., Meyer D.;
RT   "Zebrafish mnx genes in endocrine and exocrine pancreas formation";
RL   Dev. Biol. 268(2):372-383(2004).
XX
RN   [2]
RP   1-1032
RA   Wendik B., Maier E., Meyer D.;
RT   ;
RL   Submitted (22-OCT-2003) to the INSDC.
RL   Developmental Biology, University Freiburg, Hauptstrasse 1, Freiburg 79104,
RL   Germany
XX
DR   MD5; a1f0d0f448fb5654b053ef9f933c68be.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1032
FT                   /organism="Danio rerio"
FT                   /chromosome="1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:7955"
FT   gene            1..1032
FT                   /gene="mnr2b"
FT   CDS_pept        61..1023
FT                   /codon_start=1
FT                   /gene="mnr2b"
FT                   /product="homeodomain protein Mnr2b"
FT                   /db_xref="GOA:Q6SYY9"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="UniProtKB/TrEMBL:Q6SYY9"
FT                   /db_xref="ZFIN:ZDB-GENE-040415-2"
FT                   /protein_id="AAS07020.1"
FT                   /translation="MEKSKNFRIDALLAEEPHRGSREVSPGLSSDSPTGSPVSCRRGDT
FT                   PSPRGTPGAIHLQPGIIPKPGLLNLPHPGLTSIPGMYTTPMYSISALGGQHPALAYSGF
FT                   TQLTQPYPEQLKAAAMAGSLPLEHWIRAGIMVPRLPDYTSAPQSGLMGKCRRPRTAFTS
FT                   QQLLELENQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSRKAKEQAAQV
FT                   EVERQRGGTKPSGRDSRRAPAAPSVEEQEEEEEEEEEIDEDEEDEEDGQHKFINNSLSV
FT                   SRSTDFLHHTAALYHPDSPFSEDDIEELHGGERKIRAGL"
XX
SQ   Sequence 1032 BP; 281 A; 287 C; 288 G; 176 T; 0 other;
     cgtaaaacgc agctatcagc gcgcattcct gcaactctta acaaaacaaa agtggttgca        60
     atggaaaagt caaagaactt caggatcgac gcccttttag ctgaagaacc acatcgaggg       120
     agccgagaag tttcccctgg actgagcagc gacagcccga ctgggagtcc ggtgtcctgc       180
     aggcgcggtg acaccccgtc cccccgcggg accccaggtg ccatacacct ccaacccggg       240
     atcataccga aaccagggct gctcaatctc cctcacccgg gactcacttc tatcccaggc       300
     atgtacacga cgcccatgta ctccatttca gcattgggag gtcagcaccc tgcactagcg       360
     tactctgggt tcacccagct gacgcagccg tacccggagc agctgaaggc ggcggcgatg       420
     gccggatcat taccgctgga gcattggata cgagctggca tcatggtacc acgactgccc       480
     gattacacct ctgcccctca gtctggtttg atgggtaaat gtcgaaggcc tcggacagca       540
     tttactagtc aacaactact ggagctggaa aaccagttta aacttaataa atacctttcc       600
     agacccaaac gcttcgaagt ggccacatct ctaatgctga ctgagacaca ggtcaagatc       660
     tggttccaga accggcggat gaagtggaag cgcagtcgta aagctaaaga gcaggcagcg       720
     caggtggagg tggagcgaca gcgtggagga accaaaccca gcggacggga cagcagacgc       780
     gctccagcag ctcccagtgt ggaggaacag gaggaagagg aggaggagga agaggagata       840
     gatgaagacg aagaggacga agaggacgga caacacaagt tcatcaacaa cagcctcagc       900
     gtgtcccgat ccacagactt tctgcaccac accgctgcgt tatatcatcc cgacagcccc       960
     ttctcggagg acgacataga ggagctgcat ggaggagaga ggaagatccg ggcagggtta      1020
     tgaagacttg tt                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page