(data stored in ACNUC16935 zone)

EMBL: AY485340

ID   AY485340; SV 2; linear; mRNA; STD; INV; 277 BP.
XX
AC   AY485340;
XX
DT   03-JAN-2004 (Rel. 78, Created)
DT   19-DEC-2016 (Rel. 131, Last updated, Version 3)
XX
DE   Schistosoma mansoni ubiquitin mRNA, partial cds.
XX
KW   .
XX
OS   Schistosoma mansoni
OC   Eukaryota; Metazoa; Platyhelminthes; Trematoda; Digenea; Strigeidida;
OC   Schistosomatoidea; Schistosomatidae; Schistosoma.
XX
RN   [1]
RP   1-277
RA   Gnanasekar M., Ramaswamy K.;
RT   "Cloning and characterization of ubiquitin homolog from Schistosoma
RT   mansoni";
RL   Unpublished.
XX
RN   [2]
RP   1-277
RA   Gnanasekar M., Ramaswamy K.;
RT   ;
RL   Submitted (21-NOV-2003) to the INSDC.
RL   Biomedical Sciences, University of Illinois, 1601 Parkview Avenue,
RL   Rockford, IL 61107, USA
XX
RN   [3]
RC   Sequence update by database staff to remove vector contamination
RP   1-277
RA   Gnanasekar M., Ramaswamy K.;
RT   ;
RL   Submitted (16-DEC-2016) to the INSDC.
RL   Biomedical Sciences, University of Illinois, 1601 Parkview Avenue,
RL   Rockford, IL 61107, USA
XX
DR   MD5; 17080e604df352bea9a6c6b6856fa3c1.
XX
CC   On Dec 16, 2016 this sequence version replaced gi:40365360.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..277
FT                   /organism="Schistosoma mansoni"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:6183"
FT   CDS_pept        1..>277
FT                   /codon_start=1
FT                   /product="ubiquitin"
FT                   /note="Ubq"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q6RYS0"
FT                   /protein_id="AAR85354.2"
FT                   /translation="MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE"
XX
SQ   Sequence 277 BP; 96 A; 78 C; 49 G; 54 T; 0 other;
     atgcaaatct tcgtcaagac cctcaccgga aaaacaatta cactcgaagt cgaagcatcc        60
     gacacaattg aaaacgtgaa agccaagatc caagacaagg aaggtatccc tcctgatcaa       120
     caacgattga tcttcgccgg caaacaactc gaagacggtc gaacactctc ggactacaac       180
     atccaaaaag aatcaactct tcacttggtt cttcgtctcc gtggtggcat gcaaatcttc       240
     gtcaaaacac tcaccggaaa gacaatcact ctcgaag                                277
//

If you have problems or comments...

PBIL Back to PBIL home page