(data stored in ACNUC12215 zone)

EMBL: AY534249

ID   AY534249; SV 1; linear; mRNA; STD; MUS; 2898 BP.
XX
AC   AY534249;
XX
DT   01-FEB-2005 (Rel. 82, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus XK-related protein 2 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2898
RA   Huang C.-H., Chen Y.;
RT   "A superfamily of XK-related genes (XRG) widely expressed in vertebrates
RT   and invertebrates";
RL   Unpublished.
XX
RN   [2]
RP   1-2898
RA   Huang C.-H., Chen Y.;
RT   ;
RL   Submitted (27-JAN-2004) to the INSDC.
RL   Biochemistry and Molecular Genetics, New York Blood Center, 310 East 67th
RL   Street, New York, NY 10021, USA
XX
DR   MD5; 5bcf631fbfbfb8190694a1fb957b1c6a.
DR   Ensembl-Gn; ENSMUSG00000031258; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0036062; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0036044; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035963; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0036035; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035739; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036557; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0035026; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0035716; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035869; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0035811; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035962; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035839; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036586; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034718; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0035163; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000033611; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0097357; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0097448; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0097383; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0097375; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096923; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097878; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0097517; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0096844; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0097052; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0096884; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0097079; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096801; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0098238; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096908; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095884; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2898
FT                   /organism="Mus musculus"
FT                   /chromosome="X"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        19..1368
FT                   /codon_start=1
FT                   /product="XK-related protein 2"
FT                   /note="XRG2"
FT                   /db_xref="GOA:Q5GH68"
FT                   /db_xref="InterPro:IPR018629"
FT                   /db_xref="MGI:MGI:3584011"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5GH68"
FT                   /protein_id="AAT07098.1"
FT                   /translation="MDRVYEIPEEPNVVPISSLEEDVIRGPNPRFTFPFSILFSTFLYC
FT                   GEAASALYMVRIYRKNNETFWMTYTFSFFMFSSIMVQLTLIFVHRDLAKDRPLSLFMHL
FT                   ILLGPVIRCLEAMIKYLTLWKKEGQEEPYVSLTRKKMLIAGQEVLIEWEVGHSIRTLAM
FT                   HRNAYKRMSQIQAFLGSVPQLTYQLYVSLISAEVPLGRAVLMAFSLISVTYGATLCNML
FT                   AIQIKYDDYKIRLGPLEVLCITVWRTLEITSRLVILVLFSATLKLKAVPFLVLNFLIIL
FT                   FEPWVKFWRSGAQMPNNIEKNFSRVGTLVVLISVTILYAGINFSCWSAMQLKLADRDLV
FT                   DKGQNWGHMGLHYSVRLVENVIMVLVFKYFGVKVLLNYCHSLIAVQLIIAYLISIGVML
FT                   LFFQYLHPLRSLFTNNVVDYLHCICCRRPRPERVENSETSCEADTTQSIV"
FT   repeat_region   1565..1865
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="ccctaacccta"
XX
SQ   Sequence 2898 BP; 733 A; 719 C; 616 G; 830 T; 0 other;
     agtaagagag tctcaacaat ggacagagtt tatgaaattc ctgaggagcc aaatgtggtt        60
     cccatttcat ctctggaaga agatgtcatc cgggggccta acccacgctt taccttcccg       120
     tttagtatcc tcttctccac ctttttgtac tgtggggagg ctgcgtctgc tttgtacatg       180
     gttagaattt accgaaagaa taatgaaacc ttctggatga catacacatt ttcctttttc       240
     atgttttcat ctatcatggt tcagttgacc ctcatttttg tccacagaga cctggccaaa       300
     gatagaccac tatcattatt tatgcatcta atcctcttgg gacctgttat cagatgtttg       360
     gaggccatga ttaaatacct tacactgtgg aagaaagagg ggcaggagga gccatatgtc       420
     agcctcaccc gaaagaagat gctaatagct ggccaggagg tgctgataga atgggaggtg       480
     ggccactcca tccggaccct ggctatgcat cgcaatgcct acaaacgtat gtcacagatt       540
     caagccttcc tgggctcagt gccccagctg acctatcagc tatatgtgag tctgatctca       600
     gcagaagtcc ccctgggtag agctgtgtta atggcttttt ccctgatatc tgtcacctac       660
     ggggctaccc tgtgcaatat gttggctatc cagatcaagt atgatgacta caagattaga       720
     ctggggccac tggaagtcct ttgtatcacc gtctggagga cattggagat cacttcccgc       780
     ctcgtgattc tggtgctctt ctcggccacc ttgaagttga aggctgtgcc cttcttagtg       840
     ctcaacttct tgatcatcct ctttgagccc tgggtcaagt tctggaggag tggtgcccaa       900
     atgccaaaca atattgagaa aaacttcagc cgagttggca ctctggtggt actgatttcg       960
     gtcaccattc tctatgctgg catcaacttc tcttgctggt cagccatgca gttgaagttg      1020
     gcagacagag accttgttga caaaggtcag aactggggac atatgggact gcactatagt      1080
     gtgaggctgg tagagaatgt gatcatggtc ttggttttta agtacttcgg agtcaaagtg      1140
     ttactgaatt attgtcattc cttgattgca gtgcagctta ttattgctta tctgatttcc      1200
     attggggtca tgcttctctt cttccagtac ttgcaccccc tgcgctcact cttcaccaat      1260
     aacgtagtag actacctcca ttgtatctgc tgccgcagac cccgtccgga aagggttgag      1320
     aactcagaga catcctgtga agctgacaca acacaaagta ttgtctgatt ttttttttct      1380
     tctgtacatt ataggatggg tctgggttaa cacaagcaac tgtgaaattg aaggagttgg      1440
     tgagatccct gtgtgtgagt actcacagga tcatttgctt gacacttcta gtaaacctat      1500
     tgaaagaaag agtgacctgc aaagaggttt tacttcttta ggattgactg ctaggtttgg      1560
     ataccagcac taaccctaac cctagcccta gccctagccc taaccctaac cctagcccta      1620
     accctaaccc taaccctagc cctaacccta gccctaaccc taaccctagc cctaacccta      1680
     gccctaacgc taaccctagc cctagcccta accctagccc taacgctaac cctagcccta      1740
     gccctaaccc tagctctaat gctaacccta gccctaacgc taaccctagc cctagcccta      1800
     gccctaaccc taaccctaac cctaacccta accctaaccc taaccctaac cctaaccctg      1860
     gaataacctc tatgtccttc actcaggctc tgaatttcca gctttgctca tttgcttaag      1920
     gtattgctga gcttccctgg gctaatctaa actctgccag aactcaactg tactgatcag      1980
     ggaatgtgat ggcttactaa gaatgagcgc cttccagaaa gtagtctgac tgttgtactt      2040
     tttgttttgt tttgatttag gtttttattt gagacagggt ttctctgtgt agccctggct      2100
     gtcctggaac tcactttgta gaccaggctg gcctcaaact cagaaatcca ccttcctctt      2160
     cctcccaagt gctgagatta aaggcatgcg ccaccaccgc ctggctggct gttgtacttt      2220
     taactgtgag agtggctggg atatttgtat tctaatgagg aactgtggct aagaagaagg      2280
     ctccattatt gaagaaagct actccccaaa tgagttaata ccccatgagt attttactgg      2340
     gggtcattca gcaaagactt ctcctttaag aaatccttca taggcactct ctttggacgg      2400
     cgtacagaat aagattcctt cctataggga atgaggcggg atctcatgac tctcggactg      2460
     ggctcaacgt cactatgtag ctaagaacta cgtggcctga tctttctgcc tttaccttct      2520
     gtgtgctgga attgcagatg cgtaccactg catttggttt atataatgct gaggactgaa      2580
     cccagggcta ggcaagcact atttatacag tactaggccc tggaactggg gtcaggtaaa      2640
     cactctacca actgagacat ccttggcccc cagaatgcct cttaaggacc tgtgtaggcc      2700
     tccagcctca ttgagagaaa tgtttgaatg aaatttcggg tgccccatta gaggaattcc      2760
     ctccaattca gcttttctgt ctctgccttt tgttacttga tgtaaacctc agagaagcta      2820
     aactgtaatt tgaagtgttt actgatatgt gaaataaatg aagatttctt tgtgaaaaaa      2880
     aaaaaaaaaa aaaaaaaa                                                    2898
//

If you have problems or comments...

PBIL Back to PBIL home page