(data stored in ACNUC12215 zone)

EMBL: AY534256

ID   AY534256; SV 1; linear; mRNA; STD; ROD; 2856 BP.
XX
AC   AY534256;
XX
DT   01-FEB-2005 (Rel. 82, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Rattus norvegicus XK-related protein 1 mRNA, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-2856
RA   Huang C.-H., Chen Y.;
RT   "A superfamily of XK-related genes (XRG) widely expressed in vertebrates
RT   and invertebrates";
RL   Unpublished.
XX
RN   [2]
RP   1-2856
RA   Huang C.-H., Chen Y.;
RT   ;
RL   Submitted (27-JAN-2004) to the INSDC.
RL   Biochemistry and Molecular Genetics, New York Blood Center, 310 East 67th
RL   Street, New York, NY 10021, USA
XX
DR   MD5; 4acba7b3dc37fda46af85d5b4eb8035e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2856
FT                   /organism="Rattus norvegicus"
FT                   /chromosome="X"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        100..1437
FT                   /codon_start=1
FT                   /product="XK-related protein 1"
FT                   /note="XRG1"
FT                   /db_xref="GOA:Q5GH61"
FT                   /db_xref="InterPro:IPR018629"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5GH61"
FT                   /protein_id="AAT07105.1"
FT                   /translation="MKFPASVLASVFLFVAETMAALYLSSTYRSAGDRMWQALTLFFSL
FT                   MPCTLVQLTLLFVHRDLSRDRPLVLLMHLLQLGPLYRCCEVFCIYCQSDQNEEPYVSIT
FT                   KKRQMPKDGLSEEVEKEVGQSEGKLFTHRSAFSRASVIQAFLGSAPQLTLQLYITVLEQ
FT                   NITTGRFIMVLSLLSIVYGALRCNILAIKIKYDEYEVKVKPLAYVCIFLWRSFEIATRV
FT                   IVLVLFTSVLKIWVVVVILVNFFSFFLYPWILFWNSGSPFPENIEKALTRVGTTIVLGF
FT                   LTLLYAGINMFCWSAVQLKIDNPELISKSQNWYRLLIYYMMRFVENSVLLLLWFFFKTD
FT                   IYMYVCAPLLILQLLIGYCTSILFMLVFYQFFHPCKKLFSSSVSESFSACLRCVCWSSA
FT                   RRKSTEPVGRIDTDLKACTDQGAQPSTSKLTPEATEIWTAVDLCST"
XX
SQ   Sequence 2856 BP; 739 A; 670 C; 587 G; 860 T; 0 other;
     ggctgggcat gctgggagcc gctctggaaa ccgccactgc cgccgccgcc gccgccacca        60
     cccgccgcca cccgcggtgc gagtccctga ggcgcggaga tgaaattccc ggcctcagtg       120
     ttagcgtccg tgttcctgtt cgtggccgag acaatggccg cgctctacct gagcagcacc       180
     taccgctctg ccggggaccg catgtggcag gcgctgacgc tgttcttctc cttgatgccc       240
     tgcaccctgg tgcagctcac gctcctcttc gtccaccgcg acctcagccg cgatcgccca       300
     ctggtgttgc ttatgcacct gctccagctg gggcccctgt acaggtgttg tgaagtcttt       360
     tgtatctact gtcagtctga ccagaatgaa gaaccttatg tgagcatcac taagaaacga       420
     cagatgccaa aagatggcct ttcagaagag gtcgagaaag aggttggcca gtcagaaggc       480
     aagctgttta cccaccgttc tgcattcagt cgggcatcag tgatacaggc tttcctaggt       540
     tctgccccgc aactgaccct acaactgtat ataactgtct tggaacagaa cattactact       600
     ggaagattca tcatggtctt gtccctgctg tctatcgtct acggtgcctt acgttgcaac       660
     atcttagcca tcaaaatcaa gtatgatgag tacgaggtca aagtcaaacc cctggcctat       720
     gtctgtatct tcctctggag aagctttgag attgccactc gggtcatcgt cctggtcctc       780
     tttacctctg tcctgaagat ctgggtggtg gtggtcatac ttgtcaactt cttcagcttc       840
     ttcttgtacc cgtggatcct tttctggaac agtggctccc cattccctga gaacatagag       900
     aaggccctaa ctagggtagg taccaccatc gtgctcggtt tcctcacttt actctacgcc       960
     ggtatcaaca tgttctgctg gtcagccgta cagctgaaaa tcgacaatcc agaactcatc      1020
     agcaagtccc agaattggta ccggctgctg atttactaca tgatgagatt cgtcgagaac      1080
     tccgtcctcc tgctcctgtg gttttttttt aaaactgaca tatacatgta tgtgtgtgca      1140
     ccgctgttga ttttgcagct gctcattggg tactgcacca gcattctttt catgcttgtg      1200
     ttctatcagt ttttccaccc ttgcaaaaag ctcttttctt ctagtgtttc tgaaagcttt      1260
     agcgcatgtc tcaggtgtgt ctgttggtcc tccgcgagga gaaaatccac tgagccagta      1320
     ggaaggatag acacagactt aaaggcatgc acagatcaag gtgcacagcc ttctaccagt      1380
     aaactaactc ccgaggccac tgagatttgg accgctgtgg acctgtgctc cacttaatgg      1440
     aacctgagga ttcttacaag gaatgaaact tcatacacgt cactagccct gcacagggac      1500
     taaggcacga agttagctgt tcagttccct gttgagctgc taccttttat aaaccccttg      1560
     gctttgaggc agctttgagt gcattaaaga agcctactac cccacagttt gtttcgcatt      1620
     tgactctgtt ctgttcttgc atcctcactg gccatttcat tgattgacac agtatccctg      1680
     aagtttcagt tgagtggtcc tattcaacag gtaaaatgag gagaaatgct tgttttctac      1740
     ctttcaagcc tgttgtctca gaagcgtgat gctttactgc taatgaatat agcttaacat      1800
     aaaagtcccc atgatgcgtg gactaggtta ctagggattt tacaatggtg ttccaattac      1860
     aagttacagg acagctattt aagtttgttt tagcagtatg ttcattttca ccccattaag      1920
     acttttatac acaaccaact gtagccactc tggcatgcaa tgtgcatttt gcttcaaacc      1980
     ctagatttgg ggactttatt tcctaggatc cattgatcca gttacttagg aaagccatgt      2040
     ttcattccac gtgctgaaga aagtagtgat gaggatggat tgttagaaca tcaaaatgac      2100
     agaagcttat acaaatatcc aaatgtttaa agataggaat tggttagaag gtaggctcaa      2160
     ttcacctcat aactcagtct tgtcctataa ttctgcaaaa tttctagtag aattttctaa      2220
     aattaatatt ttaagaaaga aaaaaataaa actaatagtc ttcataccta tctccccctt      2280
     cctcacttgt caggaaagtt ttaaacaagg cttacctcag ttcatttgct gttgtttcta      2340
     gaaagcccta ttgaaatctt ctccctgatg caagtgtata ggacagttta cttttcatga      2400
     ttttaagaaa aagaagtgtt ttcctcacta ccacccttag ttagaaatgt tgaccttaga      2460
     aactttctaa attatagaaa gtaatgaaat gatcagaagt ttttgttcct cataaaatcc      2520
     attttgactt gatttgagtt cattttactg agatcttagt tttgtcctcc acaccatttc      2580
     atctaatgaa taatttttct ctgatctatt tattttaatt taaaatggtt ggatagaata      2640
     ttgtcaatag tctgacgaaa gtgccagcaa ccagtgctac gatttctacc actaaatgta      2700
     gatagatggt aaaatgtcta gaaagaagtg accataaaat ccgcaccaac ttaacatgag      2760
     aattgtacca taatttagta cattttcaaa ggcaacatta tttgtgattc tatgggatag      2820
     aatagatatt taattttctg gccacataaa ttcata                                2856
//

If you have problems or comments...

PBIL Back to PBIL home page