(data stored in ACNUC5340 zone)

EMBL: AY550049

ID   AY550049; SV 1; linear; mRNA; STD; MAM; 499 BP.
XX
AC   AY550049;
XX
DT   16-MAR-2004 (Rel. 79, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Sus scrofa glutaredoxin mRNA, partial cds.
XX
KW   .
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-499
RA   Lee H.Y., Cui X.S., Jeong Y.J., Shin M.L., Hwang K.C., Kim N.H.;
RT   "Identification of Differentially Expressed Genes in Porcine Embryos";
RL   Unpublished.
XX
RN   [2]
RP   1-499
RA   Lee H.Y., Cui X.S., Shin M.L., Jeong Y.J., Hwang K.C., Kim N.H.;
RT   ;
RL   Submitted (17-FEB-2004) to the INSDC.
RL   Department of Animal Science, Chungbuk National University, Gaesin-dong,
RL   Cheongju, Chungbuk 361-763, South Korea
XX
DR   MD5; 90e83a639a7104f8502833f3ffe6973d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..499
FT                   /organism="Sus scrofa"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9823"
FT   CDS_pept        <1..255
FT                   /codon_start=1
FT                   /product="glutaredoxin"
FT                   /note="thioltransferase; TTase"
FT                   /db_xref="GOA:Q6QAS1"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6QAS1"
FT                   /protein_id="AAS55907.1"
FT                   /translation="CPFCRKTQELLSQLPFKEGLLEFVDITATSDTNEIQDYLQQLTGA
FT                   RTVPRVFIGKECIGGCTDLESMHKRGELLTRLQQIGALK"
XX
SQ   Sequence 499 BP; 151 A; 111 C; 121 G; 116 T; 0 other;
     tgccccttct gcagaaagac acaggagctc ctcagccaat tgcccttcaa agaagggctt        60
     ctggaatttg tcgatattac agccaccagt gacaccaacg agattcaaga ttatctgcaa       120
     cagctcacag gagccagaac ggtacctcgg gtctttatcg gtaaagagtg tataggtgga       180
     tgcactgatc tagaaagtat gcacaagaga ggggagctct tgacccgcct gcagcaaatt       240
     ggagctctga aataattaca gcagagcaga cccaagctga tagctccctt gagagctgga       300
     tggcagtgca gataatgaca gcgcttcctg gtggatggat gccgggctac cttcactcag       360
     ctgcaactac tgtttactta aaattctgaa atgtgttaac ccaaataatt ggggggagtg       420
     ggttttgggg gacaaaacca gacttttctt ctgactctgt attaaaagtg gatcaacttg       480
     ccccaaaaaa aaaaaaaaa                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page