(data stored in ACNUC14238 zone)

EMBL: AY558145

ID   AY558145; SV 1; linear; genomic DNA; STD; FUN; 591 BP.
XX
AC   AY558145;
XX
DT   16-MAR-2004 (Rel. 79, Created)
DT   01-MAY-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Saccharomyces cerevisiae clone FLH110940.01X YCL076W gene, complete cds.
XX
KW   Yeast ORF Project.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-591
RX   DOI; 10.1101/gr.6037607.
RX   PUBMED; 17322287.
RA   Hu Y., Rolfs A., Bhullar B., Murthy T.V., Zhu C., Berger M.F.,
RA   Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J.,
RA   Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J.,
RA   Simpson A., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.;
RT   "Approaching a complete repository of sequence-verified protein-encoding
RT   clones for Saccharomyces cerevisiae";
RL   Genome Res. 17(4):536-543(2007).
XX
RN   [2]
RP   1-591
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   "Creation of the YFLEX clone resource: cloning of Saccharomyces cerevisiae
RT   ORFs in the Gateway recombinational cloning system";
RL   Unpublished.
XX
RN   [3]
RP   1-591
RA   Marsischky G., Rolfs A., Richardson A., Kane M., Baqui M., Taycher E.,
RA   Hu Y., Vannberg F., Weger J., Kramer J., Moreira D., Kelley F., Zuo D.,
RA   Raphael J., Hogle C., Jepson D., Williamson J., Camargo A., Gonzaga L.,
RA   Vasconcelos A.T., Simpson A., Kolodner R., Harlow E., LaBaer J.;
RT   ;
RL   Submitted (17-FEB-2004) to the INSDC.
RL   Biological Chemistry and Molecular Pharmacology, Harvard Institute of
RL   Proteomics, 320 Charles St., Cambridge, MA 02141, USA
XX
DR   MD5; d5f419e1132f46ed5ea2df2a07db3589.
XX
CC   This clone is part of a collection of Saccharomyces cerevisiae
CC   full-length ORF clones generated by the Harvard Institute of
CC   Proteomics. Each CDS has been cloned with its native stop-codon.
CC   The CDS has been directionally cloned using the Gateway cloning
CC   system into the donor vectors pDONR 201 or pDONR 221. Additional
CC   sequences in the clone:  'TCCAGCTGACCACC' after the attL1 site and
CC   before the 'ATG' (from Research Genetics primers used to amplify
CC   the ORFs, including a Kozak consensus sequence);
CC   'ATCCCCGGGAATTGCCATG' after the stop codon and before the attL2
CC   site (from the Research Genetics primers used to amplify the ORFs).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..591
FT                   /organism="Saccharomyces cerevisiae"
FT                   /lab_host="Escherichia coli DH5alpha T1 resistant"
FT                   /mol_type="genomic DNA"
FT                   /clone="FLH110940.01X"
FT                   /db_xref="taxon:4932"
FT   mRNA            <1..>591
FT                   /product="YCL076W"
FT   CDS_pept        1..591
FT                   /codon_start=1
FT                   /product="YCL076W"
FT                   /db_xref="GOA:P25602"
FT                   /db_xref="InterPro:IPR035179"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25602"
FT                   /protein_id="AAS56471.1"
FT                   /translation="MNEFVHTGDIQSMKRDYNLSANDESFVKTVFNSFLVKLYKKTIVG
FT                   EAACEMNWICDDSLGRVSAYDIFSHFEENYNEVTIGSRLTLIEDLPNISSKPVDEIASF
FT                   LKTLFTMLEDNSEEQDKKKRRDTNIALLLMTFLPELKESFHEKFGDSKALQLSQVIRFC
FT                   KLNASSNSSSSVSDALVAQDRRNYQKKGNKGCI"
XX
SQ   Sequence 591 BP; 205 A; 111 C; 114 G; 161 T; 0 other;
     atgaacgaat tcgttcatac cggagatatc caatcaatga aaagggatta caatctcagc        60
     gcgaatgatg aaagctttgt caaaaccgta tttaacagtt tcctggtaaa gctctacaag       120
     aaaactatcg tgggtgaagc tgcatgtgaa atgaactgga tatgtgatga ttcgcttgga       180
     agggtctctg cttatgatat tttctcgcac ttcgaagaaa actataatga agtcactatt       240
     ggatccaggc ttactcttat agaggaccta ccaaatatat cctccaagcc tgtagatgaa       300
     attgcttcct ttttgaaaac tctattcacg atgcttgaag acaatagcga agaacaggac       360
     aaaaaaaaaa gacgcgacac caatatcgcg ttgttattaa tgaccttctt acccgagtta       420
     aaagaatcat tccacgagaa attcggtgac tctaaggctc ttcagctatc acaagtcatt       480
     agattctgta aattaaatgc gtcatcgaat tcatcatctt cggtctcaga tgcattggtt       540
     gcacaagaca gaagaaacta tcaaaagaaa ggaaataagg gatgtatata a                591
//

If you have problems or comments...

PBIL Back to PBIL home page