(data stored in ACNUC10043 zone)

EMBL: AY596290

ID   AY596290; SV 1; circular; genomic DNA; STD; PRO; 33303 BP.
XX
AC   AY596290;
XX
PR   Project:PRJNA105;
XX
DT   03-NOV-2004 (Rel. 81, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Haloarcula marismortui ATCC 43049 plasmid pNG100, complete sequence.
XX
KW   .
XX
OS   Haloarcula marismortui ATCC 43049
OC   Archaea; Euryarchaeota; Stenosarchaea group; Halobacteria; Halobacteriales;
OC   Haloarculaceae; Haloarcula.
OG   Plasmid pNG100
XX
RN   [1]
RC   Erratum:[Genome Res. 2004 Dec;14(12):2510]
RP   1-33303
RX   DOI; 10.1101/gr.2700304.
RX   PUBMED; 15520287.
RA   Baliga N.S., Bonneau R., Facciotti M.T., Pan M., Glusman G., Deutsch E.W.,
RA   Shannon P., Chiu Y., Weng R.S., Gan R.R., Hung P., Date S.V., Marcotte E.,
RA   Hood L., Ng W.V.;
RT   "Genome sequence of Haloarcula marismortui: a halophilic archaeon from the
RT   Dead Sea";
RL   Genome Res. 14(11):2221-2234(2004).
XX
RN   [2]
RP   1-33303
RA   Baliga N.S., Bonneau R., Facciotti M.T., Pan M., Glusman G., Deutsch E.W.,
RA   Shannon P., Chiu Y., Weng R.S., Kan J.R., Hung P., Date S., Marcotte E.,
RA   Hood L., Ng W.V.;
RT   ;
RL   Submitted (09-APR-2004) to the INSDC.
RL   Institute for Systems Biology, 1441 N 34th Street, Seattle, WA 98103, USA
XX
DR   MD5; a04c49d8ee613540cbdd0098f16648f8.
DR   BioSample; SAMN02603385.
DR   EuropePMC; PMC3404096; 22848480.
DR   EuropePMC; PMC3783009; 24003073.
DR   EuropePMC; PMC534676.
DR   StrainInfo; 112059; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..33303
FT                   /organism="Haloarcula marismortui ATCC 43049"
FT                   /plasmid="pNG100"
FT                   /strain="ATCC 43049"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:272569"
FT   gene            complement(167..817)
FT                   /locus_tag="pNG1001"
FT   CDS_pept        complement(167..817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1001"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1001"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44259"
FT                   /db_xref="GOA:Q5V859"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V859"
FT                   /protein_id="AAV44259.1"
FT                   /translation="MSKDDSSEDDEQNPHLHLSEKYDRMVESQLSALSNVDTNAWRAAR
FT                   LIGIILGVLLTGLSLIAQGENPAVTFSPAVLMFFALGVISLLVSLVFAAVSILNVEVGY
FT                   GPGTHLTDGLTEGDVSPEAYPGIVSKNLAKNIEKNNRVLSVKADKLRYTYNFLIVGLIS
FT                   FSSAVGILIISPSRALTIIGGLSSGAIMTGITYYILGKKYDIDSEGVDSVGQE"
FT   gene            complement(824..1456)
FT                   /locus_tag="pNG1002"
FT   CDS_pept        complement(824..1456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1002"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1002"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44260"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V858"
FT                   /protein_id="AAV44260.1"
FT                   /translation="MSLVGENFRDKSLPTHARMSPRVSTDGELASIQISISDFDRHKAT
FT                   GVLCNKQPPSLYLACHMWDRVFYDQLNDSQQIEWRREDPDQTLTFEIEAGSLADKLNDS
FT                   YIPNGSVNSAWVNDTLDYLCVVETAEKLTDSRYRIQFRNLSEKRREYKDVVVRGGEFSD
FT                   LAMLFAGWHCENEVELERGDLDKLTEPTESVGATDSEDYTQPTIGEF"
FT   gene            complement(1960..2172)
FT                   /locus_tag="pNG1003"
FT   CDS_pept        complement(1960..2172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1003"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1003"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V863"
FT                   /protein_id="AAV44261.1"
FT                   /translation="MHASILDYEDGTNADVFLTSDRRVSIVPGFNASRKSLSRICDRIN
FT                   QGFLEGEVIEGQNRSKDPEEYFVKG"
FT   gene            complement(3779..4057)
FT                   /locus_tag="pNG1004"
FT   CDS_pept        complement(3779..4057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1004"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1004"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44262"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V862"
FT                   /protein_id="AAV44262.1"
FT                   /translation="MDQFEEEIFEWGEANYGDRIDSSELKFVDTQSDDEDTERVPPEVE
FT                   AGLEPEYDCPDCDYYKTGVTTGPQSFLEHLQEAHDYDQSEAHSILNG"
FT   gene            complement(4121..4849)
FT                   /locus_tag="pNG1005"
FT   CDS_pept        complement(4121..4849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1005"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1005"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44263"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V861"
FT                   /protein_id="AAV44263.1"
FT                   /translation="MIQETLPRAVNNLAEAWEGAGLDIRDYLLAGSVRDAIKLELSEQG
FT                   GFHWTVCTDKERILGAAGEHLSRIHNVRVKARQHNLELAKEQTRLILRVNQNIREYIAL
FT                   CEKLGVDWSDDIHDLMRTRPGPAPTKTTTDEFDIHLCTELPPVQEAVDIVHSSLEEIRC
FT                   YCGDNLANYLQEQFDDDQQDKAIKYIEELIIIVVYIGPVGRSEAETPEWAFHLKGRALQ
FT                   HAHEKFGLARVANDDRYLFI"
FT   gene            5143..5688
FT                   /locus_tag="pNG1006"
FT   CDS_pept        5143..5688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1006"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1006"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44264"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V860"
FT                   /protein_id="AAV44264.1"
FT                   /translation="MTESQTNPEDDSDDGDATVQLGARVDKDLAELVKGLVKHKHAKIR
FT                   GPLGRSYEKALEYYIGVHLFQHPDDLEVIAEASDIEDKERAVERLREAIDNVGPDLTGV
FT                   KQALEDPQREQVHHTEQPAGRGLSVPQAETQSMVLSEQKEWEQSSVRRSVLGEDMSMED
FT                   ETLDRIAERVAEKLENRD"
FT   gene            6009..6350
FT                   /locus_tag="pNG1007"
FT   CDS_pept        6009..6350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1007"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1007"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44265"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V867"
FT                   /protein_id="AAV44265.1"
FT                   /translation="MEQPNQATDGDEEREQASESDKSSRNRPPLFEIDIVAFGHKIQFV
FT                   PNVHSVLAFSAIFVAAALIYSEVISHGEATPLLFAEVAHFAGWVYLELPETLVIEAIEK
FT                   EEEAERYGI"
FT   gene            complement(7033..7386)
FT                   /locus_tag="pNG1008"
FT   CDS_pept        complement(7033..7386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1008"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1008"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44266"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V866"
FT                   /protein_id="AAV44266.1"
FT                   /translation="MAPTDDTAELTEQDVLKAFNYETTVEAPMLTVAEIADALAKHFDI
FT                   EVGNEIIRCRLREMESDELVASEGTEDSTVEWTALVAPRLSDEVLADAEAAEGEFERGE
FT                   TVSLEELTDDPKD"
FT   gene            complement(7660..8523)
FT                   /locus_tag="pNG1009"
FT   CDS_pept        complement(7660..8523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1009"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1009"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44267"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V865"
FT                   /protein_id="AAV44267.1"
FT                   /translation="MSYEDWAGGIRCSECGREYTGIECPICRQADPTEREVVTEHGNGR
FT                   GDQQPPENGTVSADSGVYDIDKIEHERHTDAEKVNPEVVDPSDYVTRAVSGVVFNKRHA
FT                   WKAENRADEDNPPSLFVVTTADSEFNWIEIPLWDDAEGAMEDISIGDPIQAEGKLSKDN
FT                   GVHNIHVHSQDSIDILTEPPEVKFDSMAIDQITSTTPKVDLEGTVERVGEIKDIQLDDE
FT                   KVKLREIHVSDLNNDQIQVALWRTNAYEKVAPGDEIIIAGGLAKPHNEKVVVRVGWSGH
FT                   IGYRSS"
FT   gene            9116..9487
FT                   /locus_tag="pNG1011"
FT   CDS_pept        9116..9487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1011"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1011"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44268"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V864"
FT                   /protein_id="AAV44268.1"
FT                   /translation="MQPAYDDTHGHAAQTVLDNTAQITVRHVDGTLASSRIDEGEGSCA
FT                   LLCNDLDAAFLITDDLRALPELQTAVDAQVAISPIVLKALVTRQVLDRQTALEKLDQLA
FT                   EQRSWLGQPIYRRAQKLFE"
FT   gene            10248..10985
FT                   /locus_tag="pNG1012"
FT   CDS_pept        10248..10985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1012"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1012"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44269"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V872"
FT                   /protein_id="AAV44269.1"
FT                   /translation="MAESAEPELSIEDIEFLTIVRDVSDNPDEYDGTELGEAPATVTVI
FT                   TDNTSLSKSQVKYRLNSESDAGNSRGFTEDQLGYIESYGASMTEKGWGPRSCEITEKGR
FT                   EAVDGVTENSTLSLSTSEGGSPAGGSTERIEELAEDIERLDNQLAAMGTRLTEATEAIE
FT                   EFNEAEFGAVDDEIAHKLEAALNAMITYNNIFEYVLGADVRPFHPDEDGKIDAEMVAEG
FT                   REQIVAAINATSESDAAEVLRRK"
FT   gene            complement(11066..11311)
FT                   /locus_tag="pNG1013"
FT   CDS_pept        complement(11066..11311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1013"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1013"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44270"
FT                   /db_xref="GOA:Q5V871"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V871"
FT                   /protein_id="AAV44270.1"
FT                   /translation="MFFAVLSLLVALVAGSFIILQRFGEFTAVRWSAIVGVNCVVALQT
FT                   LSGGTLLKTVVTPDVFVLVLVVAGYAVVQLMQGDPV"
FT   gene            complement(11311..11520)
FT                   /locus_tag="pNG1014"
FT   CDS_pept        complement(11311..11520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1014"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1014"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44271"
FT                   /db_xref="GOA:Q5V870"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V870"
FT                   /protein_id="AAV44271.1"
FT                   /translation="MNVVPEGSWVDEARGHPRKLFGLVVGLALLATGNWVLLWPGIVLS
FT                   GLAVGQLVTYWGDETDASVDRRAV"
FT   gene            complement(11675..12016)
FT                   /locus_tag="pNG1015"
FT   CDS_pept        complement(11675..12016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1015"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1015"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44273"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V869"
FT                   /protein_id="AAV44273.1"
FT                   /translation="MTADSDASDQPDWAAYQNLTPTAQTCLLLVANYDGDAWGGLIAQA
FT                   AQEGLDVSDRHVRRSLADLESAGLVESSEATQRRETYSVTDDGREVLSGMRDSLAQTLE
FT                   MVDNREGSA"
FT   gene            11849..12424
FT                   /locus_tag="pNG1016"
FT   CDS_pept        11849..12424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1016"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1016"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44272"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V868"
FT                   /protein_id="AAV44272.1"
FT                   /translation="MAVTHVKTLLCGLCDQATPGVAVVIRDQQQARLCRWREVLIRRPV
FT                   RLVAGIAVGCHRLTAVVSVVCVGTASDRSPSNSHSRSIALIGSHCSTVIASTQQPPSTD
FT                   MTTATSARSVARIAPTPDASGTTNIARPARASERTSLAISSHLQQRSGGSPLPFLFLIR
FT                   ARTQRTFWSTQADWCRSARQPGRRRRLS"
FT   gene            complement(12472..14019)
FT                   /locus_tag="pNG1017"
FT   CDS_pept        complement(12472..14019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1017"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1017"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44274"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V875"
FT                   /protein_id="AAV44274.1"
FT                   /translation="MSQNLPKSEQDGFTEKTIQGAQIIHGADPHGKWPTDAEEIRNRFD
FT                   IPAFDPEAFYPREGAALSGVYPDFLVHIENSADGPSTVNSPGASLTMVEAPKGSGKSTA
FT                   ADQFATYQMEHNDERIVRNGRQKSSDWRRLADWTTLWLPSGVEVDGRWMETVDRDDPDP
FT                   DELCRDVRYYSDVHELVARLQDHPKGTYNVVFPDPYFRGCVEALSTADATVQQPEFIPK
FT                   NEPNPTPASHWWFGFLAARTFDGVRVDGDGERNWMTAHIDEFGMLAPESAPGGESGHWT
FT                   HQCVQIMADIAKEMRSAGLSLVGYGHHEEDVHNHWLKEFDFWVELSNHDRGNRTTKAEA
FT                   PKPFRDIEQDQDLLSKRPKGFGLCYTANRFSEFQFSDLGYPHDTPEFQLRLGIPEAVDV
FT                   PTSDDGGMIVEDLQVATDDEGQPTILKEYRAADGAVHELRVLAPGRGIIDISGEKPEPL
FT                   EVLSSPYPDAEFPENPIKTTQTHYDIMFKPDANAEIVAARIPRRTGPGTTTEVEADE"
FT   gene            14550..14936
FT                   /locus_tag="pNG1018"
FT   CDS_pept        14550..14936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1018"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1018"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44275"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V874"
FT                   /protein_id="AAV44275.1"
FT                   /translation="MANSVMLGRSVVQRGSVSLYLSIDQGWQQAAGLDVDDTCRLEIEE
FT                   VGDASLTVALFIDKDYGTVADPPGQFDIEPVDIQTDLQWCLPADMRHEFGISEEFTYSA
FT                   EYHGDGEIHYELTSPTVRDERLLA"
FT   gene            15086..15238
FT                   /locus_tag="pNG1019"
FT   CDS_pept        15086..15238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1019"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1019"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44276"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V873"
FT                   /protein_id="AAV44276.1"
FT                   /translation="MSDDTQRLGRCPDCGERITTPWLLVEYEKDDGTEGIWAECPTCED
FT                   VVAPE"
FT   gene            complement(16169..17194)
FT                   /gene="tnp"
FT                   /locus_tag="pNG1020"
FT   CDS_pept        complement(16169..17194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="pNG1020"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1020"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44277"
FT                   /db_xref="GOA:Q5V879"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V879"
FT                   /protein_id="AAV44277.1"
FT                   /translation="MDRLPPAYDATPGDGALEAAIEERLVDIDSGRYRTNVASVLRKFA
FT                   TWARDQHGISSPEDIDDDLCRQYARDLARADDRDDISPETARRYFAYVRSFLTWAVYEG
FT                   LIPTNPAKTNHAEGPLPTDETETDQQYWTTRDRDAICATATARVDKAGESDDIDRTAAY
FT                   RDQALVFLLAYSGARSAELVAVSDDEERNGLRWRHVNLEAGTMQVFGKNRTRESAPILD
FT                   DALRPLRRWKQLREPDENEAVFPRLDNAAKALDPTPSITTQSARNILADLCEWSEYEFE
FT                   DPLKPHGARRGLGREIYRENPQLAQDVLRHKSIETTHEGYAQEAAKRTRDEANEIISDT
FT                   E"
FT   gene            17537..18466
FT                   /locus_tag="pNG1021"
FT   CDS_pept        17537..18466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1021"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1021"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44278"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V878"
FT                   /protein_id="AAV44278.1"
FT                   /translation="MTDAFTEALDETEGAQAAYGKQLGFVEQRTPFAAESLPDTSIAVN
FT                   VNQDLLKEVASHIINRAGHVSVIDKRGAGKTHFRELVYDALRDGPRSEEFAIARIKEVE
FT                   SITTRRFYTRLLDELQRYEYLDIPESYPHATDEVRSVVEDVAGQLENQNRCGIIQVDQL
FT                   EDAARRKSTFEQLLAGLQSVGDLGESEPVFLLFLFGTPTAGDRIDELRETLSSRLVAKH
FT                   RSLERFEFAETDELISRWLAWARDEEFTEGYPADPFSAGAIRKVVDRSDGTPRDVRQQC
FT                   YHGFRGGAEQYADTGKVRITEETFESYV"
FT   gene            18488..18793
FT                   /locus_tag="pNG1022"
FT   CDS_pept        18488..18793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1022"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1022"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44279"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V877"
FT                   /protein_id="AAV44279.1"
FT                   /translation="MGDNAFGDALDDAAEEQTADETDSSDATERFIKAMGGDGTKSKTI
FT                   GFAVSPEMKYFYDELRASNDVDVDPGDEFRDQLERLANRHPEVADKARRKLKIDTE"
FT   gene            complement(18955..19170)
FT                   /locus_tag="pNG1023"
FT   CDS_pept        complement(18955..19170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1023"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1023"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44280"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V876"
FT                   /protein_id="AAV44280.1"
FT                   /translation="MSNIARQILKILEAQGNEMASVMYVLDQLEQAEIEFSMAEFDDAV
FT                   EQLRKDGVVRVKNSAAPRNNWQLQRQ"
FT   gene            19669..20877
FT                   /gene="cdc6q"
FT                   /locus_tag="pNG1024"
FT   CDS_pept        19669..20877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdc6q"
FT                   /locus_tag="pNG1024"
FT                   /product="cell division control protein 6 homolog 6"
FT                   /note="CDC6 homolog 6"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1024"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44281"
FT                   /db_xref="GOA:Q5V883"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5V883"
FT                   /protein_id="AAV44281.1"
FT                   /translation="MDSDDESEAVHSVFNTVSQEGGKIFEQREILQIDYVPSENRIVGR
FT                   DEQIEKVAGEIGPIVVGQPPNSIIIYGKTGCGKSLVAKHVSKIAREEAENRGVKLATGY
FT                   VNCQQAKGNSDALSKYGRAINPPESGVKFPTRGISENEYFERVWSVLNEFYDAAIIVLD
FT                   EVDKLNNDDLLMALSRAGEDGSVDVPIGVIAVSNKINYRDKMSERTKSSFGHNEFIFEP
FT                   YDADQIREILQNRTDAFADGVLDDGVIPRAAALSAKEHGDARKAMRLLRYAGDQANKEN
FT                   AERVKESHLTDARASAEVDRLLELISGLPPHSKHVLLALANLTKNHPDREWFRTVRVRE
FT                   IYLEVCDRSGADPLSAERTRQLLNELCFLEVAGSRRGTGEGKGHYSQYTLLWDADIVLT
FT                   LGN"
FT   gene            21035..21781
FT                   /locus_tag="pNG1025"
FT   CDS_pept        21035..21781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1025"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1025"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44282"
FT                   /db_xref="InterPro:IPR041025"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V882"
FT                   /protein_id="AAV44282.1"
FT                   /translation="MSYSDEELLTHIRELAAELGETPSVNQMSAAEGRPSGSTYRHRFD
FT                   SWSDAVEQAGVEPTDQSGPYTKTELLEHIRALATELGRPPTLEDLNADDDRPSFKPYRR
FT                   VFDTWNAALTAAGFDPNHAMSHTEPEGYSDAELLTHIQELAEELGRPPTQDEMHQADDR
FT                   PSESTYKRRFESWTSAIEEAGFDSGRKTSSYSEAELLDLLRDLATELGETPSVQQLNAA
FT                   EDYPSRAVYRNRFGSWSAALEAANLE"
FT   gene            22035..23426
FT                   /gene="flaA2"
FT                   /locus_tag="pNG1026"
FT   CDS_pept        22035..23426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaA2"
FT                   /locus_tag="pNG1026"
FT                   /product="flagellin A protein"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1026"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44283"
FT                   /db_xref="GOA:Q5V881"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V881"
FT                   /protein_id="AAV44283.1"
FT                   /translation="MFEKIANENERGQVGIGTLIVFIAMVLVAAIAAGVLINTAGFLQS
FT                   SAEQTGQESSDQVTNQIQVASKVGIVGGQGASDTIAIQSPSGNQFAIESGSTVTATEVT
FT                   DNNDDGYILVDSPQGNELAVDGGDQIRLTRESGSQVEITNEDTGVSITSSKLDLKDASG
FT                   SDTLKFVRTYEDPVNGQLQLQSVTIDNTGTADSTDDGVSATLSTGENTEKYIPLTDGSS
FT                   KAIIGNGETVTVTSDSDSGSTLSAGAETLSVDPGDEVLFEVTGDSEVTITNQESGSSIS
FT                   YNPLDGSNYLSGTAGSGSTLKLSVSDDGSATSLDVTSGLTGLTTGDFATGPGNEIQLVN
FT                   EDYNAGGGGVGTLNIVAIKGSGADQINMEETTITTIGPDGTNTLTYSDDGATEDQTFAV
FT                   ESIQDDDDSLPVMTDSDRFRVVIDPGTLETGETMTLEVTTESGATTEIRISVPNTLAGE
FT                   SAVQV"
FT   gene            complement(23766..24896)
FT                   /locus_tag="pNG1027"
FT   CDS_pept        complement(23766..24896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1027"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1027"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44284"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V880"
FT                   /protein_id="AAV44284.1"
FT                   /translation="MRDTSKLDWMVPADEWEQFRRHIESRFGVAEGYLGREAELAMEQY
FT                   IDADGYARVETLVDRLVSAAGRSPDHASEKIKSDLSSQEPTRIGIRVGTPLKEEFCAYV
FT                   DEHTDYNYGVALARALNVYRDGGRSRRVEDKLDRVVDDAESMLGELNDDSDKSLSSVQR
FT                   KTIAICHDVGESFTDEVLNESIHNIAAEGPKASDPTLEKYRDLVIDRLDYERHPHNEEL
FT                   WISRDQAEEIAPDETPAECRRSVELLDTDEMKRRLIYTVGRRAMATSSKDVTLPERELR
FT                   EAVFDDEISRPTMHDVMQAAAEHFGIGTGKPDRQQVLRLNLTELEIDHPDMAQTIRHFA
FT                   NADGDSRLADSGETTLGSYGGGQQPSAMTDGGTVAD"
FT   gene            complement(25470..25748)
FT                   /locus_tag="pNG1030"
FT   CDS_pept        complement(25470..25748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1030"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1030"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44285"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V887"
FT                   /protein_id="AAV44285.1"
FT                   /translation="MSRASQGAPATRRARADDTADVGTPVKVDRLEGGSLLGIVRERYT
FT                   YEEYDAPPRVLVESSETMVNVATDRVSIARGSNADVVRSLVEEDTNV"
FT   gene            complement(25741..25881)
FT                   /locus_tag="pNG1028"
FT   CDS_pept        complement(25741..25881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1028"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1028"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44286"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V886"
FT                   /protein_id="AAV44286.1"
FT                   /translation="MASEPNATVDRVIEIADLVADDADADAEAVLLDALGRVRKRGGTD
FT                   E"
FT   gene            complement(25871..26083)
FT                   /locus_tag="pNG1029"
FT   CDS_pept        complement(25871..26083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1029"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1029"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44287"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V885"
FT                   /protein_id="AAV44287.1"
FT                   /translation="MTRLELVEKPDTPESFTKTIEHYGAAIPREGELVTWDTDHYRVTE
FT                   VQHRIQLGTVVVHLRPRDQEGDDGE"
FT   gene            complement(26080..26586)
FT                   /locus_tag="pNG1032"
FT   CDS_pept        complement(26080..26586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1032"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1032"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44288"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V884"
FT                   /protein_id="AAV44288.1"
FT                   /translation="MAAILYQCPRCTRQMAEPETTDPRLCPCHRVVVGPDGDTERRFEA
FT                   VGTVAETPNGWELLGNAAEILQQGFGVRYENGHRYRLKEGGLFQDFDTDDVPVPGEIHA
FT                   VEATPHGPRYTVRPDTEWWSPEWDVDDDVPEDHVWHWEIVEVTERTRASARLADIQSEY
FT                   GGGQP"
FT   gene            complement(26587..27087)
FT                   /locus_tag="pNG1033"
FT   CDS_pept        complement(26587..27087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1033"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1033"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44289"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V891"
FT                   /protein_id="AAV44289.1"
FT                   /translation="MQSEQPATGTELCWDHEDCPRDDCDGGLQQQDRFNVLCLACEGVW
FT                   TYVKTSTAHLLQTADCETVATKPIAMSDGGQSPGDARIGADVPTAIRHGGATRPVQKLD
FT                   REGNLTVYRGHAVAFECQDCGNVQWFATGRFRFIADCQECGLGSCFEFDFELARSATRG
FT                   GEP"
FT   gene            complement(27077..27205)
FT                   /locus_tag="pNG1034"
FT   CDS_pept        complement(27077..27205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1034"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1034"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44290"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V890"
FT                   /protein_id="AAV44290.1"
FT                   /translation="MSTDHGTHDGGCVADADIEQRLARLERIVLDEGDDQEGDDAE"
FT   gene            complement(27202..27519)
FT                   /locus_tag="pNG1035"
FT   CDS_pept        complement(27202..27519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1035"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1035"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V889"
FT                   /protein_id="AAV44291.1"
FT                   /translation="MTPTDDEFYVMPKSQWNDGKVHHPAPEATREDPTPLCDAGTDDVE
FT                   VFRVADETDRERYGLCSVCAAKANDEPDPRGNHDESGRSPADVLRENGFELPEDSTGGS
FT                   A"
FT   gene            complement(27746..29482)
FT                   /locus_tag="pNG1039"
FT   CDS_pept        complement(27746..29482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1039"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1039"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44292"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V888"
FT                   /protein_id="AAV44292.1"
FT                   /translation="MSNSYASRQKDRGIAVSLRPSPRRVDAQPAWASAGASARPARALG
FT                   ALPAERPRSLATRHQASKRRVPSGPAASSRLRRSARSPAALGRHAERADGSRPYSARSY
FT                   SCIPPPSKIVDDGAADVRADGPAAFVLRVLAPPYECFIWRVGEFDLLGAGVASDDGHSE
FT                   FIRVPVVGRAFAVDAQEQRAALREQFAGGTFLWIRFGRADRFTSRRSRLTHGSRRNRRA
FT                   CRVVTTVGNSCSRRHEIAQRRVCSCPNGCVSATIKLLSRRNDWVTEDEYQRPRPQGHRL
FT                   RVASGRNEYQRTVCHCQAGCRTSWTLVLEGPAADESVSRLWRYSKISAREWAVHLLARR
FT                   LVQFGIGDLTPPVVSQPPRSGRPELSRFNEAYLFELLHPSINSLSAKINAVCDFSGSER
FT                   RFVGQSKHAKEFFVTDLLLRAWLVASHQYVSCLRVHTYRKCLPIIAPTQVLCPTGVTYP
FT                   DMRDSPGQIDSTKMDHRSRNSAGPVAHGIMTETTRPQNDTAQDRQECRLQTAKRLLTEA
FT                   DTDAAVIEDCQTVLSRPGYDRSHSQARVDACAARLALAQADTTKRTREARQVLVAVSGG
FT                   SQ"
FT   gene            30098..32686
FT                   /locus_tag="pNG1040"
FT   CDS_pept        30098..32686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1040"
FT                   /product="putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1040"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44293"
FT                   /db_xref="GOA:Q5V893"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V893"
FT                   /protein_id="AAV44293.1"
FT                   /translation="MAFSDDDLRTYQQQAVRAIAEADEDYKSLILPTGAGKTRVGLAYA
FT                   SNILDKKDSVAYITQTNAHVGQVLSESDAIGVDAVHIPGRSAESQGDGGSGDREIDIQD
FT                   YNIGFKVGVFSYAGYFLGSEVPTADTLIIDDAHAFTSEHVTHSAVILHRDDWGRQYDRL
FT                   IDLIKDENPILESEIESLQQPIHRGGGTVLVPPPDTTEVEQAITSSVESMSEADGWEPY
FT                   LLQKRLNASPDFVNWPCVITANTISWRPFILPFQSFGRSPNRDIEESELVAMTSIRDPE
FT                   EFLQTRLGTPELVTKIEPPEPVDEMGSRVVVPYRDQYDRNPPSEGQINTINRWADRFGS
FT                   VLVSVASHNSAQEVMKRLHKKDINPIEYESEISVQELQEQEEPRALVLVNKPSGIDISS
FT                   SICPVAIHLDLPHSTSGHEVVAGDIEESGAVAEASLAVRLSQLLGRLNRSDEDRSIHLL
FT                   LADGLPLRRGTAFVKSLDPAVLTDLLIGRRGIAQEYELPTETGLLDDAEAFLNGDDSLR
FT                   SSYITDPEQLRKLFLGSDVEGFSPGTIQQVEANLFAARGNFTRAAKQFERFSQNAEEQG
FT                   YPDHSSFYDFQSIVYGSADTGSTSGTLNRSTDAIVDAALDRNPQSGALVAALRQIQSSE
FT                   ETDTQQARIEMRVKQQKRQAFYCFTRWYDEADGNVPDRDHYTSVDPWKEYWRSRFAKAE
FT                   HSELTSAYSEAFELLGTDTPQREKQDNDLRIRWETENGEEFILAVEIKGWNPDTVDSEP
FT                   DLKSDNIRQARTNARKIDADAALLASSRSGRTRDVPGSAETYGVHCLNGDASVAFADMM
FT                   AEQCAILATVEQNQIDRNQVPLCARRIQKLLESDGRILDGQEIRALIDLE"
FT   gene            33122..33286
FT                   /locus_tag="pNG1041"
FT   CDS_pept        33122..33286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="pNG1041"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:pNG1041"
FT                   /db_xref="EnsemblGenomes-Tr:AAV44294"
FT                   /db_xref="UniProtKB/TrEMBL:Q5V892"
FT                   /protein_id="AAV44294.1"
FT                   /translation="MRWTKEGLEAILQLRLVKYADPEHYQSFLDELLQRSTKTAMSCDL
FT                   SIESTRGKL"
XX
SQ   Sequence 33303 BP; 7487 A; 8825 C; 9243 G; 7748 T; 0 other;
     ccaattcctt gatgccgaac tatgtgacac cgtagccgcc cgaactgagg cacttcgaga        60
     actggcactg gctgggctga cggtgcagcc acgcccttgc aggccgagca acaacacatc       120
     gtagcgacgg actgggcgag ctagcatcga aagaggcgac aatggactac tcttgaccaa       180
     cggaatctac accttcgcta tcgatgtcgt acttttttcc gagaatatag taggtaatcc       240
     ctgtcattat tgcccctgag ctgagacccc cgattatagt aagcgctctg cttggcgaga       300
     tgattagaat cccgacggct gaagaaaacg aaataaggcc aactatgagg aagttgtagg       360
     tataccggag tttgtccgct ttcacagaca ggacgcggtt gtttttctcg atgttctttg       420
     ccaagttctt cgatacgatg ccagggtatg cctcagggct gacatccccc tcggtcaacc       480
     catccgtaag gtgggttcct gggccgtatc caacctctac attgaggata ctgaccgcag       540
     cgaataccaa cgagacaagc aacgaaatca cgccgagagc gaagaacatc aatacggctg       600
     gcgaaaacgt tactgctgga ttctcgcctt gagcaataag cgagagtccg gttagaagga       660
     ccccgagtat aatcccgatc aggcgagcag ctcgccacgc gttcgtatcg acgttagaaa       720
     gcgcactcag ttggctttca accattcggt cgtacttttc tgacaagtgc aggtgcggat       780
     tctgttcgtc gtcctcggaa gaatcatcct tcgacatagc cgttcagaat tccccgatcg       840
     tgggttgtgt ataatcttct gaatctgtgg cacccaccga ctcggtgggc tcggtcagtt       900
     tatccagatc gccccgctca agctcgactt cgttctcgca gtgccagccc gcgaacaaca       960
     ttgctaggtc agaaaattcg ccaccacgga caacgacatc tttgtactct cgccgctttt      1020
     cactaagatt gcggaactga attctgtacc gggagtccgt gagcttctca gccgtctcga      1080
     cgacacagag gtagtccagt gtatcattga cccaggctga attgactgag ccgttgggaa      1140
     tgtaggagtc gttgagtttg tctgccaggg agcccgcctc aatttcgaag gtgagtgtct      1200
     ggtctggatc ttcacgccgc cattcgattt gctgactatc gttgagctga tcgtagaaca      1260
     ctcgatccca catgtggcag gcaagataga gacttggtgg ctgtttattg cagagtacgc      1320
     cggttgcttt gtgccgatca aagtccgata tcgagatctg gatactagct aactctccat      1380
     ctgtagacac acgaggactc atcctggcgt gggtgggcag tgacttgtcc cggaaattct      1440
     ctccgaccag cgacatccgc tcaaatttgt atttcggtgt cgtgtcttgg tcgatgagac      1500
     tgaactccag tgggatgaca ttgggggctt ggaggaaccc gtcgtcaaaa gaatccagat      1560
     ggacacgtgc agcttgtgcc tgttcgctgg caatgagcag gcagacatcg acggtctccg      1620
     gcgagatccc gtcgtacgca acatcgcccg tgtcaacggc agtgagcggg actaaccgtt      1680
     cccgaaaatc ctgagcatca ctgtcgatct cttggatcac atcagcgacg atggcatact      1740
     ctgatgtgag cgacgaaata aacgttggcg ctcgttcggc gccagtgtca gtcgtgatgg      1800
     gatcgggaaa ccactgaaaa tcaaacgcgc tggcaacgct gatatcgctg agaaactgtt      1860
     cccaagcggc tacgatatca acaacttcgt cgtaggcacg aaactctgcg aaggcctgct      1920
     caacacagcg ctcgtactgg ttttgtccac tcacgccggt caccctttga cgaagtactc      1980
     ctctgggtcc ttactgcgat tttgcccttc aatgacttcc ccctcaagga acccttggtt      2040
     gattcgatcg cagatccgag acagagactt tcgtgacgca ttgaagccag gaacgatgct      2100
     cacacgccgg tccgaggtga gaaacacatc cgcgttcgta ccgtcttcat agtccagaat      2160
     cgatgcgtgc atatacggat tcttgtgata gaccgtaatc gaagaccgtt tgagcccctc      2220
     caaggcgttt atcagccgga tgttttcctc acgccctttg atcgctcctt cttcgtaggt      2280
     aatttcgatc gtctcagcct ctcgggtacc atattcacgg gccttgtcgt tgaataactc      2340
     tcccttctta gagagaagtg tagccaaact ggggaggatc tttttgaaat agatgctctg      2400
     gttaccgctc acgtagcgag aggccccttt tcgggagagc tggccactga atttgtgtct      2460
     ggactgccgg agctcgaact ctatcttgtc gacgtaggag ttctgctggc tgacttcttc      2520
     gagattaaac agctcgaaat accggctgtt atcgaagtat ttgacctcag tgtcaccaac      2580
     aggtgacttg gtgactcctt tcgtcacata gagattcccg ttgatgtcgt cactcagctt      2640
     gttcaggagc tgctgaagtt catcagtcga aaggaacgag gttgagacag atggcgggag      2700
     tccttggata tatcgccgga cagcttgatt gaagaactca cggtcagaga cggcaaaggc      2760
     agtgtatgcg tctgtgtctt cgtgactgaa gacatagacc gtaccagaga ggaatttgta      2820
     gccgtcctca ttgtagtcct caccagaacc ctgaatccgc cgtgtaagac taagttttag      2880
     gaattctccc ctgtcgtcga tatcaacaga gaatccggtc ggactgttac tggcgaaaac      2940
     cgcttttggc ttctcttcag cgatgaacgt aagcgaccgg accgggttat cctcctgctc      3000
     gattgcctca ttggcccagg caaacagcgt atctaaggag tcgaggtcgg tgaattggta      3060
     caggtttgta tcttccacgg tcagttcctc atgtgaatca gtgtgatttg caggttatct      3120
     ggctcgtatt agttttttgc ctttcaggtg catataatgt gtacctgcgt atcaaattgg      3180
     ggatagcgta gtaaatgtat cactcagtca acagaaacac catactctct ttgagtagtc      3240
     aatttcagtt tcgggcaagc ttcggtatgc ttggtggccg gaagcacgga taaaaacaga      3300
     accgatactg actctacact gttcagcaag tgcccgcttg tgcgcctgtt gctggtgatt      3360
     gtttaggcgg cctgtcgtcg agtccctcct tgggctgcat gagagactat ccgaggccag      3420
     taagcatcag cagcgcgaaa acccccggat tcctttcggc accattctat gattcctgaa      3480
     gagttggcga agttgcgatc cgaagtcgct tggcagatgc tgacttgttc accttcagaa      3540
     gtaaatcgtg agacaaacca ctctgataga ctcggtccgc ccatctcatc gagtgaagaa      3600
     cgtggtcgtc ccccgcttat cgcgtctgaa gcgatatact tctatggcag tgctgattat      3660
     ctcacaaatc tgtacggcca cttctaaatc gatcgtctgg atgctttcgt tcatccatat      3720
     ataacgtact gacaaataat tcgagcggga gaagagctcg tagagccctg gctggttgtt      3780
     agccgttcag gatgctgtgt gcttccgact gatcgtagtc gtgtgcttcc tgaagatgct      3840
     caaggaaaga ctgaggcccc gtcgttaccc ctgtcttgta gtagtcgcag tctgggcagt      3900
     cgtattcggg ttcgaggcca gcttccacct ccggtggaac tcgctcggtg tcctcatcat      3960
     ctgattgcgt gtcgacgaac ttcagttcac tcgagtcaat tcggtcgccg taatttgcct      4020
     caccccactc gaatatttct tcttcgaatt gatccatcgc ctcatcagaa gtgtttgaga      4080
     cgttttcaga gtagaagcgg acccactcag aatcctctca ttagatgaat agatatcggt      4140
     catcgttggc tacccgagca aggccgaatt tctcgtgtgc gtgttggaga gcacgaccct      4200
     tgagatgaaa tgcccactct ggagtttcag cttctgacct gccaacaggg ccgatgtata      4260
     caacaattat gattagctct tcaatatatt tgattgcctt gtcctgttgg tcatcatcaa      4320
     attgctcctg gaggtagttg gcaagattat caccgcaata acagcgaatc tcttcgagac      4380
     tagaatgaac gatatcaaca gcttcctgga caggtgggag ttcagtacac agatgaatat      4440
     caaattcgtc ggtagtcgtt ttcgtagggg ccgggccagg ccgtgtccgc atcagatcat      4500
     gaatatcgtc ggaccagtct acacctaatt tttcgcagag tgctatgtat tcgcggatgt      4560
     tttgattcac acgaagaatg agccttgtct gttccttcgc cagctccaaa ttgtgttggc      4620
     gggctttcac ccgcacgttg tgaatccggg ataggtgctc tccggcagca cccagtattc      4680
     tctctttgtc cgtacaaaca gtccagtgaa acccgccctg ttcactgagt tccaacttaa      4740
     ttgcgtcacg aacggagccc gctaaaaggt agtctctgat gtccaggcca gctccctccc      4800
     aagcttccgc gaggttgttc actgccctcg ggagcgtttc ttggatcatc cctttgtgcc      4860
     attgtactat cgaataataa atttactgcc gcggtcttaa tattccagag aggtgggact      4920
     ggtttactaa tatcacgaga taacgcatat ttggggtgcc taaaagtatt tcttgataaa      4980
     cttggaactg aagttcaatc tcttaagcag tcataacggc cactgtttct caaatatgag      5040
     acggctcgtg acgtttttag ttaactttta agatgatgta gttagataag acgtgtgcag      5100
     gtacacattc gggtgtcaac tacccgcccg agggtatcac taatgacgga aagccaaaca      5160
     aatccggagg atgactccga tgacggtgac gcaacggtac agctaggcgc acgtgttgac      5220
     aaagatctgg ccgagttggt gaagggcctt gtcaagcaca agcatgccaa gatcagaggg      5280
     ccattgggta ggagctacga aaaggcgtta gaatactaca tcggtgtcca cctttttcag      5340
     catcctgatg acctagaggt gattgccgag gcgtctgata tcgaagacaa ggaaagagcg      5400
     gtcgaacgtc tgcgggaagc cattgataat gtcggtcctg atctcactgg cgtgaaacaa      5460
     gcactagaag atccgcaacg agagcaagtg catcatacgg agcagccagc tggccgtgga      5520
     ttatcagttc cgcaggctga gacacaaagt atggtactct ctgaacagaa ggagtgggag      5580
     cagtcgtcgg tacggcgttc tgtcctcggc gaggatatgt caatggagga tgaaaccttg      5640
     gatcgtatcg ctgaaagagt cgctgaaaag ttagagaaca gagactaact gctgcgggaa      5700
     gcccactggt ttctctcttg tccctgttcc catctagtct ctgacttcgg cgggggtgct      5760
     gctatatcag aaaagctgta gagatagatt acagaacagt agtgataaat acacaggacg      5820
     aagtaaaaac gccggtagag cagctcaggg agcctgaatg ctctctaaga ctattgttgc      5880
     aactcgtttt ctaataatat tacttctata ttagtgtata aaccagtcta tttttatcat      5940
     tacagcattt agtgtgtcat gtggcagtag atgatgtcgg ccaggcggca gaaataggtg      6000
     aatcccacat ggaacaaccg aaccaagcaa ccgatggtga cgaagaaaga gaacaggcat      6060
     ctgaatcaga taagagtagc aggaaccgtc ctcctctgtt cgagattgat attgtagcat      6120
     tcggtcataa aattcagttc gtaccgaatg tccattctgt gcttgcgttc tcagcaatct      6180
     tcgtcgctgc cgcgctgatc tactctgaag tgattagcca cggtgaagca acgccgctac      6240
     ttttcgctga ggtggcccat tttgctggat gggtgtacct cgaactaccc gaaacgctcg      6300
     tcattgaggc tatagagaaa gaggaagaag ccgaacgata cggtatctga taggaaacac      6360
     atggtttgac attagctgaa gatgaattgt ttcttactga ggaagaaggg cgctatttta      6420
     ttagttgttc tggatttcgg gccaattttt gcacgtcgat caaactgagt aaccaaatca      6480
     ctgatctcac ctcactctac accccccacg ccgccactcc catccgttac gctccgtgcc      6540
     catttgtacg cactcccgga tatcgggtgt gatcaagcta taccagaacc tgttcggtcg      6600
     ctacgacggg tgccgccagc tgccgatccc gaaccgtgac cgcgtagcct cgctcgacga      6660
     gtacctgctc gcacgtcgtc ggtgatcgcc cgggtggcac acccgaccat acccggtacc      6720
     cccggctgaa ttgagactgt ccgaggccgg taagcatcag cagcgcgaaa accgccggat      6780
     tcctttcggc accattctat gactcctgaa gagttggcga agttgcgatc cgaagtcgct      6840
     tggcagatgc tgacttgttc cccttcaaaa gtaaaccgtg aaacaaacca caccagtaga      6900
     gtcgttcgtc tcacctcatc gagtgacgaa cgtggtcgtc cttccactta tcgcgtatgg      6960
     agcgatatac ttctatggac gacgaataat tctgtagctc cctctgcgac accagccgga      7020
     acccctcaga attcagtcct tcgggtcgtc ggtaagctct tcgagcgaca ccgtttcgcc      7080
     acgttcgaat tcgccctcgg ctgcttcggc gtcggccagc acctcgtcgg agagtcgcgg      7140
     tgcgacaagt gcggtccact cgaccgtgga gtcctcggtg ccttcgcttg cgaccagttc      7200
     gtcgctctcc atctcccgca agcgacaccg aataatctcg ttgccgacct cgatgtcgaa      7260
     atgcttggcc agcgcgtcgg cgatctcggc gacggtcagc atcggtgcct ctacggtagt      7320
     ctcgtagttg aacgctttca gcacgtcttg ctcggtcagc tctgctgtat cgtctgtcgg      7380
     cgccatgagc tacttttctc cagcagcggt cacttcggct tcgatatgca tctagtgccc      7440
     actcgtacgc attcctgaac gttggctcac cacaccagaa agcgcttggt tgctctggag      7500
     ggtaagccag tcgctgatgg agtactgcat cggccatgat caggatactc tacagggata      7560
     cacgttgtcg ggtgatgttc catcaaacga caggtaccct tcggagatac ggtatcctta      7620
     tcggtctatt tgcgggacaa cgatgcgtcg aaaagatttc tatgaagacc gatagccaat      7680
     atgccctgac caaccgaccc gaacaacgac cttctcattg tgtggcttgg ccagtccgcc      7740
     ggcgattata atttcatcac ccggagcgac cttctcgtag gcattggtgc gccagagggc      7800
     aacctgaatc tggtcattat taagatcact cacgtgaatt tcgcgtaatt taaccttttc      7860
     atcgtccagc tgaatatcct taatttcacc aactcgctcc actgtcccct ccaaatctac      7920
     tttgggcgtt gttgaagtaa tttgatcaat cgccatcgaa tcaaatttca cttcaggcgg      7980
     ttccgtgaga atatcaatcg agtcttgtga gtggacgtgt atattgtgga caccattatc      8040
     tttagacagt ttaccctcag cttggatcgg atcgccaatt gaaatgtctt ccattgcccc      8100
     ctcagcgtcg tcccacaatg gaatttcaat ccagttaaat tctgaatcgg ccgtcgtgac      8160
     tacaaacaaa cttggcggat tatcttcgtc agcccggttt tcagctttcc atgcatggcg      8220
     cttgttgaat acaacgccag aaacagcgcg tgtaacgtaa tcagagggat cgacaacctc      8280
     tggattaacc ttctcagcgt cggtatgtcg ctcatgctct attttatcga tatcataaac      8340
     tccagagtct gccgacactg ttccgttctc aggaggttgt tggtcacctc taccatttcc      8400
     atgttctgtg acaacttctc tttcagttgg atcggcttgc ctacagattg gacactctat      8460
     accagtatat tctctcccac attctgagca ccgtatgcca ccagcccaat cttcatacga      8520
     catgtctggg agattaatcg attttagtat aaaaaattag ttcaatccat ttgtcaagta      8580
     gattatttat accgagaatc gcgggtgaaa gccgaagact gtaagcgcat cctcactgtc      8640
     cactttgctg caagtgtggc aaaaccaacc cggcgattct attctattcc gtacagaatc      8700
     gcaagaaatc tctccaccaa caatgtacta cacatgagta tatctagtaa accaatccgc      8760
     tttgtcgacg gtatccggcc cgaatgcctc ccaacgagag tgattgccga tagaacgatc      8820
     cctcatgaag cagtgaaaca atctatcgat actcgattca gcggaacggc ggcttatgga      8880
     ctttgagtga cgtgctgaaa gaggtcctcg gacggcaaga cgccgaatcc gtccgggcgt      8940
     ccaagactct tcttgaccag ggcgacgaga tggccgacga tctcgcgcaa ctgtgagcac      9000
     tgcatgactg tcgcggatac acctgcactc atctcactcg cgtcggtcga cctgcttgat      9060
     acgttgctca ccgaattcga ggtcgctacc acggagacag ttatcgacga actcgatgca      9120
     accagcctac gacgataccc acggccatgc cgcacagact gtcctcgaca atacagcgca      9180
     aatcactgtc agacacgtcg acggcacgct tgcctcatct cggattgacg agggcgaagg      9240
     gagttgtgcg cttctgtgca acgacctcga cgcagcgttc ctgattactg atgatctccg      9300
     cgcgctgccc gagctccaga ccgcagtcga cgcacaggtc gcgatttcgc ccatcgtgct      9360
     caaagcactg gtaacccggc aggtactcga tagacagacg gctctggaga aacttgacca      9420
     gctcgccgaa cagcggtcct ggcttggaca gccgatctat cggcgggcac agaaactatt      9480
     tgaatgatac tggttccgga tttgtaacgg aaaggaaccg ccggacgtca acacacatgc      9540
     gctgtggtcg tacatactta ccaggcttgt ctcgctctgg gtaccgcctg ttccgtcacc      9600
     tagacaggct agcctatcga agcgatgacg cctgcgtgtc cccatgacgg cgtccttctt      9660
     cgagacggag tggcctgacg tgttcatcgc gccctcgatg ttcagcgtgc tctccacgtg      9720
     gctcgatgtc ccttgtacgc aagatgtgga cttcgattcg tgtatcgtca cgtgggctca      9780
     atgcacatga ctgtgtgcga gtgtgggact cgtcgacggc gctctcgata taccctatat      9840
     atcagatttt ctgtatagtt caacacccct ctacgcgggt agtcggcgta cgggcttcgc      9900
     tgcgagctcg tggtcactcg tcccccttgt gacctcactt tcttcgctac ctcatggggg      9960
     gtgtgcccac tattaattgc ggtacggtgc tgaatatggt tatgatatcc taagattagg     10020
     acacttatta ggacagggtg tgtgataatt aggacagtat ttaggacagg ggtagggtaa     10080
     ttttacagca ggtgttagga cagggtatta taatattatg acagtgttag gacaggggtg     10140
     tggtaggatt aggacaagta ttaggacagg gtgggatagc gttagggtat cctattagga     10200
     cagggtaaaa tataataccc taagattata acagggggag taagaagatg gctgagagtg     10260
     cagagcccga gttaagcatc gaagatatcg agtttctaac tatcgtcaga gatgtctctg     10320
     acaacccgga cgagtatgac ggaacggagc ttggagaagc gcctgccacg gtgactgtta     10380
     tcacggacaa cacatcgcta tcgaagtccc aggtgaagta tcgactcaac tcagagagtg     10440
     atgctggtaa ctctcgtggg ttcactgaag accaactggg ctacatcgag agctacggtg     10500
     catcgatgac tgagaagggg tggggtccac ggtcgtgcga gatcactgag aaggggcgag     10560
     aagcagttga tggggttacg gaaaattcca ccctatcgtt gtccacatcg gaggggggta     10620
     gtccagctgg ggggtcgacg gaacgtatcg aggaactagc ggaggatatt gagcgactgg     10680
     acaaccagtt ggctgcgatg ggtacgcggt tgactgaggc gactgaagca attgaggaat     10740
     tcaacgaagc cgagtttggt gcggttgatg acgaaatagc acacaaatta gaggcagctc     10800
     tgaacgcgat gattacgtac aacaatatct tcgagtacgt gcttggtgct gatgtacggc     10860
     cattccaccc ggacgaagat ggaaagatcg atgctgagat ggtagcagaa ggacgtgagc     10920
     aaatcgttgc agcgataaac gcgacatcag aatcggacgc agcggaggta ctcagacgga     10980
     agtgaataga gttacccagt actgagagcg ccgtccagtc tgaacaagac aacgacttct     11040
     agggatatcc cgaccacctt cttactcaga cagggtctcc ctgcatgagc tggacaaccg     11100
     cgtagccggc gacgaccagc acaagcacga aaacgtcggg ggtaaccacc gtcttcagca     11160
     gggttccgcc gctgagtgtc tgcagtgcca caacgcaatt gaccccgaca attgcgctcc     11220
     atcggacagc agtgaactca ccgaaccgct gcagtatgat gaacgacccg gccacgagag     11280
     ccaccagtag cgacagaaca gcgaagaaca tcagactgcc ctccggtcga cgctggcgtc     11340
     ggtctcatcg ccccagtagg taaccagctg cccgacagcg aggcctgaca gaacgatgcc     11400
     cggccacagc aacacccaat tgccggtcgc gagcaacgcc aacccaacga caagcccgaa     11460
     gagcttccgc gggtggccgc gagcctcgtc aacccacgac ccctctggaa cgacattcat     11520
     ccgtcgccct ccctgccgtc ggtactaggg tacctgacaa ccgagttcca taccaccccg     11580
     ccgcttgttt cctcataacg gaggtatagc ttggtaagac aagtcccgaa catcacacat     11640
     ggaatggcca ccaacagcag cgcagtccga gatatcatgc gctaccctcc cgattatcga     11700
     ccatctctag ggtctgcgca agactgtcgc gcatcccgct caagacctcg cgcccgtcgt     11760
     cggtgaccga atacgtctcc cgtcgctggg ttgcctccga agactcaacc aaccccgccg     11820
     actccagatc tgcaagcgag cgccggacat ggcggtcact cacgtcaaga ccctcctgtg     11880
     cggcctgtgc gatcaggcca ccccaggcgt cgccgtcgta attcgcgacc aacagcaggc     11940
     acgtctgtgc cgttggcgtg aggttctgat acgccgccca gtccggctgg tcgctggcat     12000
     cgctgtcggc tgtcatcggc tcaccgccgt tgtgagcgtg gtctgtgttg gtactgccag     12060
     tgaccgctcg ccatcgaaca gccacagtcg ctcgatagca ctgattggga gccactgttc     12120
     gacggtgatc gcctcgaccc agcagccacc aagcaccgac atgacgaccg cgaccagtgc     12180
     tcgcagtgtc gcccggatcg cgccgacgcc agatgcgagt ggcaccacca atattgcccg     12240
     cccagcgcga gccagtgagc gcacatcact ggccatcagt tcccacctcc aacagcgttc     12300
     aggggggtcc ccccttccgt tcctgttcct gatacgcgcg cgtacccagc ggacattttg     12360
     gtccactcag gccgattggt gccgctcggc ccgccagccg ggtcgccgtc gacggctgtc     12420
     atgaacgtaa aagggcgttc ggtgtcggtc tccaccagtc gcttcgctgg gtcactcatc     12480
     ggcctcgacc tccgtcgtcg tgccgggccc agttcgtctc ggaatgcgtg ccgcaacgat     12540
     ctctgcgttc gcgtctggct tgaacatgat atcgtagtgg gtctgtgtcg ttttgatcgg     12600
     gttctcgggg aactcggcgt cgggatacgg gctcgatagc acctccagtg gctcgggttt     12660
     ctcaccggag atgtcgataa tcccgcgacc aggcgcgagc acgcgcagtt cgtgcacggc     12720
     gccgtcggct gcgcggtact ccttgaggat ggtcggctgg ccctcatcgt cagtcgccac     12780
     ctggaggtcc tctacgatca taccgccatc atcgctcgtc gggacatcaa cggcttccgg     12840
     gatcccgagc cggagctgga actcaggcgt atcgtgtggg tagcccagat ctgagaactg     12900
     aaactccgaa aaccggttgg ccgtgtagca cagtccaaac ccctttggcc gcttcgagag     12960
     gaggtcttgg tcttgctcga tatcgcggaa tggcttcggt gcttcagcct tggtcgtccg     13020
     gttgccacga tcgtggttcg aaagttcgac ccagaagtcg aactccttga gccagtgatt     13080
     gtggacgtcc tcttcgtgat ggccgtagcc gaccagcgat agtccggccg accgcatctc     13140
     cttcgcgatg tcggccatga tctggacaca ctggtgagtc cagtggccgg actcgccacc     13200
     cggcgctgac tccggggcca gcatcccgaa ctcgtcaata tgggcggtca tccagttacg     13260
     ctcgccatcg ccgtcgacgc gaactccgtc gaaggtccgt gctgcaagga agccaaacca     13320
     ccagtgtgag gctggcgtgg ggtttggctc gttcttgggg atgaactccg gctgttggac     13380
     cgtcgcatct gccgtcgaca gtgcttcaac acagccccgg aagtacgggt ccgggaacac     13440
     gacgttgtag gtacctttcg gatggtcctg cagtcgtgca accagttcgt ggacatccga     13500
     gtaataccgt acgtctcggc agagttcgtc gggatctgga tcgtcgcggt cgacggtttc     13560
     catccagcgg ccgtcaacct cgacgccgct ggggagccac agcgttgtcc agtcagctag     13620
     ccgccgccag tcagagctct tctggcggcc gttcctgacg atgcgctcgt cgttgtgttc     13680
     catctggtac gtggcaaact ggtcggcagc tgtggatttg cctgagccct tcggcgcttc     13740
     gaccatcgtc agtgatgcac ccggtgagtt caccgtcgac gggccatcgg cggagttctc     13800
     gatatgcacg agaaagtccg ggtatacgcc tgacagtgcc gcgccctcgc gtgggtagaa     13860
     cgcttccggg tcgaacgccg ggatatcgaa ccggtttcga atttcctcag cgtcggtcgg     13920
     ccactttccg tgcgggtccg cgccgtggat gatctgtgcg ccctgtatcg tcttctctgt     13980
     aaacccgtcc tgttcggatt tcgggaggtt ctgagacata cgttgtttac tccagttagg     14040
     tggtcaattc cgtctctgtg cgttgtcgcc gaagccagcg ttgcgagggt gctcatcgtg     14100
     agagccaata ctgtcgtgac cgcccgtctc gtcggctccg gtagcgccac cggccaatcc     14160
     gtggccagcc gcttcgagcg cgttcacggc tcagtctggc tgcctgtagc tgcagaaaga     14220
     acaccactac gctcgtcgga tgcactgagt ctacacctcg tgccgccctc acacaggtca     14280
     atgccagtct cggccaccgc ctccggtcag ttgctcctgt taactggaat ggatgctctc     14340
     gtgtgagtag ggcgccacag tcagactgcg gtcatcctac gaacacgaaa ccggtggcag     14400
     accacggaca aatatggctg gattggtaca gtcttctgtc actctctgta tggtcctgaa     14460
     gcagtctggt aagagattgt aagagtgaga cactggactg tagtgaacag cgccgatgcc     14520
     cttttctcag ccactgctaa tccgtgggta tggccaattc agtaatgcta gggcgaagcg     14580
     tggtccagcg aggaagtgtc agcctgtatc tgagtattga ccagggctgg cagcaggccg     14640
     ccggcttgga cgtcgacgat acatgccgac tggagatcga ggaggttggt gacgcgtcgc     14700
     tgacggtggc gctattcatc gataaagact acgggacagt ggcagaccca ccggggcagt     14760
     tcgacatcga gccagtggac atccagaccg atcttcagtg gtgtctgccc gccgatatgc     14820
     gccacgagtt cggcatctcc gaggagttca catacagtgc cgagtaccac ggcgacggcg     14880
     agatccacta cgagctcacg tcgccgaccg ttcgcgacga gcgactgctt gcctgaactg     14940
     gagtggcggt tgcagtaggt gtacccgtga cggcggggca cgtttctgtt gagtggcctg     15000
     agacagtggc taaacgctta tatccgagga taggcaattt ttgggtggaa ggaacactgt     15060
     cacacgctcc ttccatcccc tttccatgtc tgatgacacg cagcgtctcg gccggtgccc     15120
     agactgtggc gagcgtatca caactccgtg gctgctggtt gaatacgaga aagacgatgg     15180
     cacggagggc atctgggcgg agtgtccgac gtgtgaagac gtcgttgcgc cggagtagtt     15240
     ctgaactcct agacctgcgt tcttctgtct gaaaggatcc gagaagcgac taaccaacat     15300
     tcggaacggt ctgtacgctg gtgttggtta gtcccagagt gtcagatttc gagaggatct     15360
     ggaagccgaa acaacaattg tagccgttga tagtagcgta ctggcgtcca taccgacggt     15420
     tgactgggta taatagggcc cgtcacggct acctgcgtgc ggtgtcaacg caggcccgga     15480
     gtatcgcgct caccgctgcg gtgttagaac cattcagtat actcaccaca gtggctacac     15540
     tcggcacggg tacgccactc gtccccgtgc tcgtgattag tcggtgcaac cttgactacc     15600
     cgaatgtcga tggagccaca ctgtggacat tgccccggaa tttccgcatt ggccacgctg     15660
     aaccattacc tccatgaatt gctcagtcgt gaataggtaa tgatagttac gctgcagaaa     15720
     agtgcattaa gtctgaaata aagtggtaag tatagaggtt catgacagtc actatcgatt     15780
     actgtgggta ttgggttttt cagagagtgt gaaatggcta cgctgtaacc tgtgtatctc     15840
     tcatccgaag cgacgagcaa gttcgtaagc gacggtagca ggaacagtga ttgtgagaat     15900
     cacgaatgcg agttcatcga cagtcggacc ggactgcgtg agcgaactgt agagtatcaa     15960
     agcgccggta gcaagcaccc cgacaacagt tgatacgtat tctgggcctg tccactgact     16020
     cggagggtct tcaggggggg atgtgatgaa gctgtgtttg tgtggcgtat aacgttgttg     16080
     cagtctccct gtcggtacga atctctgcgt acgtggacta ctgtactggc tgttacggcc     16140
     agaaatagag ttgctgtatc tataacagct attctgtgtc tgagataatc tcgttcgcct     16200
     cgtcacgagt ccgtttcgcg gcctcctgag cgtagccttc gtgggttgtc tcgatggatt     16260
     tgtgccggag cacgtcctgt gccagttgcg ggttctcgcg atagatctcc cgtcccaatc     16320
     cacggcgagc accgtgtggc ttcagcgggt cttcgaactc gtactcagac cactcacaca     16380
     ggtctgccaa gatgttccgg gccgactgcg tggtgatcga cggcgtggga tcaagcgctt     16440
     tcgcagcgtt gtcgagtctg gggaacacgg cctcattctc gtcgggttct cgaagctgct     16500
     tccagcgccg aagcgggcga agtgcatcgt cgaggatcgg cgcagactct cgggtacggt     16560
     tcttgccgaa cacctgcatt gtgccggctt cgaggttgac gtgtcgccac cgcagaccat     16620
     tccgttcttc atcatcagag acagcaacca gttccgcgct gcgggctcct gagtacgcga     16680
     gcaagaagac gagtgcttgg tcgcggtagg ccgccgtgcg gtcgatgtcg tcgctctcgc     16740
     cggccttgtc gacgcgagcc gtcgcggtag cgcagatagc gtcgcggtcg cgtgtcgtcc     16800
     agtactgctg gtctgtttca gtctcatcgg tcgggagcgg cccttcggcg tggttggtct     16860
     tggccggatt cgtcggaatc aggccctcgt agacagccca tgtgagaaac gagcggacat     16920
     acgcgaagta gcggcgggcg gtctccggtg agatgtcgtc ccggtcgtca gctcgagcaa     16980
     ggtcgcgagc atactgtcgg cagagatcgt cgtcgatgtc ttcaggactg gagataccgt     17040
     gctggtcccg agcccacgtt gcgaactttc gcagcacgct cgcgacgttt gttcggtagc     17100
     gtccagagtc gatatctacc agccgttcct cgatggctgc ttcgagggcg ccatccccgg     17160
     gagtagcgtc gtatgctggc ggaagccgat ccatgcttcc cgtacagcgg cctcccgcct     17220
     aaaactgctg gtgcttaata aactaataca aacctatcta caaaaccaga atatccccgt     17280
     ttcaggcact ctatagtgca gttattggct tcaccggttt tggtaaagga tatactgcta     17340
     tacggaattt tgtatatttt ttcgaatagg atttggttct agacagcgtc aggcagtata     17400
     gattagacat ttgaaagatt agttaatatt cggagacggc tctactaaga tgcggaactc     17460
     gttcagcacc gttagacagg tgtgcgacag taagagttaa tcttaagact aagactaatg     17520
     ttaaaccact tgtaaaatga ccgatgcgtt cactgaggcg cttgacgaaa cggagggtgc     17580
     gcaagccgcc tacgggaaac aactcgggtt tgttgaacag cgaactccgt tcgctgcgga     17640
     gtcgttacct gacacaagta tcgccgttaa cgtcaatcaa gacttactca aggaagtagc     17700
     cagccacatt atcaatcggg caggccacgt ctcggtaatt gacaaacgtg gagctggcaa     17760
     aacccatttt cgagaacttg tctacgacgc gcttcgggac gggcctcgaa gcgaggaatt     17820
     cgccatcgcg agaatcaaag aagtcgagtc aatcacaacg cgacgtttct acactcgact     17880
     cttggacgaa ctccaacgtt acgaatatct cgatatccca gagtcgtacc cgcacgcgac     17940
     agacgaagtc cgatccgtcg tcgaagatgt tgccggccag ttggaaaatc aaaatcgctg     18000
     tggcatcatc caagtggatc agctcgaaga tgccgctcgt cgaaagagca cgttcgagca     18060
     gctgctggca ggcttacaga gtgtcggtga ccttggtgag tctgaaccag tgttcttgct     18120
     gttcctattt ggaacgccta ccgctggaga tcgtatcgat gagcttcggg aaacgctgtc     18180
     ctccagacta gtcgcgaaac atcggtcgct ggagcgcttt gagttcgcag agactgacga     18240
     actgatcagc cggtggctag cctgggctcg ggacgaagag ttcactgagg gctatccagc     18300
     tgacccattc agtgccggtg cgattcggaa agtcgtagac cgatccgacg gcacaccccg     18360
     agatgtccga cagcaatgct accacggctt tcgtggtgga gcagagcagt atgccgatac     18420
     cggaaaggtc cgcatcaccg aagagacgtt cgaaagctac gtttaatatt aagactaagg     18480
     ttaactcatg ggagacaatg catttggcga cgcacttgac gacgctgcag aggaacagac     18540
     agcagatgag acagacagca gtgacgcgac agagaggttc atcaaggcga tgggtggcga     18600
     cggcacgaaa tcgaaaacaa tcggcttcgc tgttagtccc gaaatgaagt acttctacga     18660
     cgagcttcgt gcaagcaatg atgttgatgt cgatccgggt gacgaattcc gcgaccagtt     18720
     ggagcgactg gctaaccggc atccagaagt tgccgataag gcccgtcgga agctcaaaat     18780
     agatacagag taattcttaa tattaagatt agtattaagg ataagacaat acagaaaata     18840
     aacagccgta acgagcagtt ttgtcgccgc cttctgacct tacagcggaa gcagtggtct     18900
     gtgctggaca gggcagtagc cctttgatat atcgcgctga ctgttgtctg gcgcctactg     18960
     ccgttggagc tgccagttat ttcgaggtgc tgcgctgttc ttgacacgta caacaccatc     19020
     tttgcggagt tgttcaaccg cgtcatcgaa ctccgccatt gagaattcaa tctctgcttg     19080
     ttctagctgg tcaagtacgt acatcactga tgccatttcg tttccttggg cttccaatat     19140
     cttgagaatc tgccgtgcta tgttagacat aagtgaatag caatcagagg gtagtagctg     19200
     ttcgcatata tgtggtttat atcgatgatg cagagctttg tagtgaggat agggtacata     19260
     tctgctttcg aatagtttgg acaagacaca cacaccaaat tttgagtaag aagatagaag     19320
     actgcgggct atgaggccac attacggcac ctcggtagct gttcttattc caaactaggt     19380
     gtgtctctct agtctagtta ttctagtatg tagtgtagca tatgtgtaca gtcctactag     19440
     atggactgaa acagtcttag acgtgtcctc ccctgtcaca ctttatctgt ttcttactcc     19500
     aaactaggtg tgtgtgtcat acagttcctt actcaaaatc tggtgtgact gggccaagtt     19560
     ttgtgtaagg cagaaggctg cttgttagac gccagagtgt cgcttagagg gctattactc     19620
     ataacccggt ccgaaagctt atttcgtgtc tactgttgtc ttttgataat ggatagtgac     19680
     gatgaatcgg aagccgttca tagcgtcttt aataccgtca gtcaggaagg aggaaaaatt     19740
     tttgagcagc gagagatcct ccagattgac tatgtcccca gcgagaatcg gattgtcggt     19800
     cgcgacgagc aaattgagaa ggttgctgga gagattggac caattgttgt tggtcagcca     19860
     ccgaactcta tcatcatcta cggaaaaaca gggtgtggta aatccctcgt cgcaaaacac     19920
     gtctctaaga ttgcacgaga agaggctgaa aatcgaggcg tgaaacttgc tactggatat     19980
     gtcaactgcc agcaggcaaa gggtaactct gacgctctaa gtaagtacgg gcgcgctatc     20040
     aatccgccag aaagtggggt aaaattccca acccgaggaa tttctgaaaa tgagtatttt     20100
     gagcgagtct ggtcagtgct caacgagttt tatgatgctg caatcattgt tctggatgaa     20160
     gttgacaaac tcaacaacga tgatctgctg atggcgcttt ctcgagcagg agaggacgga     20220
     agcgttgatg tcccgatcgg agtgattgcg gtatcgaata aaatcaatta tcgggacaaa     20280
     atgagcgaac gaacaaagag ttcgttcggg cacaatgagt tcatatttga accatacgat     20340
     gcagatcaga ttcgagagat tttgcaaaac cggactgatg ccttcgcaga tggagttctt     20400
     gatgacggtg taattcctcg tgctgcggca ctgagcgcta aggaacacgg ggacgcgcga     20460
     aaggccatgc gtcttcttcg gtatgctggc gatcaggcaa acaaagagaa tgctgagcga     20520
     gtgaaagagt cacaccttac tgatgcacgc gcttcagcag aggttgaccg acttcttgaa     20580
     ctcatatcag gactgccacc ccatagcaag cacgtcttac tcgcgctcgc gaacctcact     20640
     aagaatcacc ctgaccgaga atggttccgg actgtgcgag tccgtgaaat atatcttgaa     20700
     gtgtgcgacc ggagcggggc cgaccctctt tcggctgagc gaacccgaca attactcaac     20760
     gaactctgct tcttagaagt cgcagggagt cggcgaggga ctggtgaggg caaaggacac     20820
     tacagccaat atactctcct gtgggacgca gatatcgttc ttaccctcgg taactgacac     20880
     atgtcactgt ggcgaaaaca gaactaatga cctgcccacc tgattcagcg agggagtccc     20940
     gccgttcgcc gaggtaggtg atcaactcgc aatggacact ccaacctcgg tttttgcatc     21000
     ggattcatag tagaccggta cccgaggtat ctatatgagc tacagtgatg aggaactcct     21060
     gacccacatc cgagagctgg cagcagaact cggtgaaaca ccctcagtga atcaaatgag     21120
     tgccgcagag ggacgcccaa gcgggagtac ataccggcac cggtttgact catggagtga     21180
     cgccgtcgag caggcggggg tagaaccaac cgaccaatca ggtccataca ccaagacaga     21240
     actgttagaa catatccggg cgcttgcaac cgagctaggt cggccaccga cattggaaga     21300
     tctgaatgcg gatgacgatc gcccgagttt caagccatac cgtcgggtat tcgacacgtg     21360
     gaatgccgcg cttaccgccg ccgggtttga cccaaatcac gctatgtcac acacggagcc     21420
     agaggggtac tctgacgccg aattgctcac acatattcaa gaattagccg aagagttagg     21480
     gcgaccgccg acgcaagatg aaatgcatca ggccgatgac cggcccagcg aaagtacgta     21540
     taagcgacga ttcgagtcct ggaccagcgc aattgaggag gcgggttttg actcgggtcg     21600
     aaaaactagc tcatactctg aagccgaatt actggatctg cttcgggact tagctaccga     21660
     acttggtgaa acgccgtcag tgcagcagtt gaatgctgcc gaggactatc cgagccgagc     21720
     agtgtacagg aatcgattcg gttcgtggag cgcggcgttg gaggccgcta atttggagtg     21780
     agtaccagat aatctggtta tcatagttga aaacgcttta ttctcaaatt ctgagctaaa     21840
     ctctcgcccc aagatagtag aatcgattaa cccgaaaccg gacgaattaa ctcgtggtgg     21900
     ccggaccaga tacgagcgga gaatagcagc ttgtgagtct gaaaccctcg ttatcatgct     21960
     cgataacttg acccggagta ctatatacaa gtatgatttt cttcctatag gggcagatta     22020
     ccccacaaca catcatgttc gagaaaatcg ctaacgagaa cgaacgcggg caggtcggga     22080
     ttggcaccct catcgtgttc atcgcgatgg tgctagtcgc ggccattgcc gcgggcgtgc     22140
     tcatcaacac ggccgggttc ctgcagtcca gtgcagaaca gaccggtcag gaatcgagtg     22200
     atcaagtaac aaaccagatt caggtcgcat caaaagtcgg gatcgtgggc ggtcagggtg     22260
     catctgatac cattgcgatc cagtctccgt ccggaaatca gtttgcgata gaatctgggt     22320
     ctacggtcac cgcaactgaa gtcaccgata ataacgatga cggatacatt ttagttgatt     22380
     ctccgcaagg taacgaactt gcagtagatg gtggagacca aatcagattg acgagagaaa     22440
     gtggctcaca ggtcgagatt actaatgagg acactggcgt ctcaatcact agctctaagc     22500
     tagacctgaa agacgctagt ggaagtgata cgctaaaatt cgttcggaca tatgaagatc     22560
     cagttaatgg tcaactgcaa ctgcagtccg tgactataga caatactggt actgcagata     22620
     gcaccgacga tggggtctca gcaacccttt cgactggtga aaatactgaa aaatacattc     22680
     cacttaccga tggaagtagt aaagcgatca tcgggaacgg agaaacagtc acggtgacct     22740
     ctgacagcga tagcggttca actcttagtg ctggggctga aaccctgagt gttgaccctg     22800
     gagacgaggt gttgtttgaa gtcaccggtg acagcgaggt taccattaca aatcaagaaa     22860
     gtgggagttc catttcctac aatcccttgg atggcagtaa ctacctcagt ggtactgctg     22920
     gatctggcag caccctgaag ctctcggtaa gcgacgacgg gtctgctacc agccttgacg     22980
     ttacctccgg acttactggt cttacgaccg gagatttcgc aaccgggcct ggtaacgaga     23040
     ttcagctggt caatgaggat tacaacgccg gcggtggtgg cgttggtacg ctcaatattg     23100
     tcgcgatcaa aggttccggt gccgaccaaa ttaacatgga agagaccacg atcacgacaa     23160
     tcggtccgga tggcaccaat acgctaacct acagcgatga cggtgccacc gaggaccaga     23220
     ccttcgctgt cgaatcaatt caggatgacg acgactcact gccagtgatg actgactcgg     23280
     atcgattccg agtcgttatt gacccaggga cactcgaaac cggcgaaacg atgactctcg     23340
     aagtcacgac ggagtccggt gcaaccaccg agattcggat cagcgttccg aataccctgg     23400
     ctggcgagtc cgccgttcag gtataacact tcgggctacc gattcgactt tttgttttct     23460
     ggttttattt ttcgcgtact gttgtagcag ttgttcttag tcagtcatgt gttctgctat     23520
     ctcatctctc accagtggca tgactccgca ggggtgaatg ttgacgtgct ttcaattcgc     23580
     gctgtaccta ctctcgactt tgaccgcttt cactgctgtc ggtgattttg atattgtttc     23640
     cagtagtgtc cgtaatatga ctggttcttt cgaccttctg gtgctcgtag aacgacaggg     23700
     ctggggctaa cagccgggca gatggcgtgt ccgctggcgt gctgagagcg gttcagtgtg     23760
     gatagtcagt ccgcgacagt ccctccatca gtcatcgccg acggctgctg gccgccacca     23820
     taggagccca gcgtcgtctc gccgctgtca gcaagcctcg agtcgccgtc ggcgttcgcg     23880
     aagtgtcgaa tcgtctgtgc catgtcgggg tggtcgattt cgagttcggt cagattcagg     23940
     cgcagcacct gttgtctgtc tggtttgcca gtcccgattc cgaagtgctc ggcggctgct     24000
     tgcatcacgt catgcatcgt tggtctcgaa atctcatcgt cgaacaccgc ttcccgaagt     24060
     tctcgctcgg ggagcgtcac gtcctttgag gacgtcgcca ttgcgcggcg gccgacagtg     24120
     tagatgagac ggcgcttcat ctcatcagta tccagcagtt cgaccgagcg gcggcactca     24180
     gcgggcgttt cgtcaggggc gatctcttcg gcctggtcgc gagagatcca cagctcctcg     24240
     ttgtgcgggt ggcgttcgta gtcgaggcgg tcgatcacga ggtcgcggta cttctccagc     24300
     gttgggtcgg atgccttcgg tccctcggcg gcgatgttgt ggatgctctc gttcaggacc     24360
     tcgtcagtga acgactcgcc gacatcgtgg cagatggcga tcgtcttgcg ctggacgctg     24420
     ctgagactct tatcagagtc gtcattgagc tcgcccagca tggattcggc gtcgtcgacg     24480
     acacggtcga gcttgtcttc cacccggcga gatcggccgc catcgcgata gacgttcaat     24540
     gcgcgtgcga gggcgacacc atagttgtag tccgtgtgct cgtcgacata tgcgcagaac     24600
     tcctctttga gtggcgtccc gacacggatg ccgatgcggg tcggttcctg agacgacaga     24660
     tcagatttta ttttttcgct ggcgtggtcc ggagagcggc cggcggctga gacgaggcgg     24720
     tcgacgagcg tctcaacgcg agcatagccg tccgcgtcaa tatattgctc catcgcgagt     24780
     tcggcttcac ggcccagata gccctcagca accccgaatc gggattcgat gtggcgacgg     24840
     aactgctccc actcgtctgc gggaaccatc cagtccagct tggaggtgtc ccgcatcagg     24900
     attgcacctc ccgaagggcg gacccgcacc cacacaccat ctcggtgtgt gcgggggggt     24960
     tcacacccac accacacaca ccttcttggt gtgtgggtgg ggtgggggtg cagaccccca     25020
     ccccgcctgc ggttgcgtct gccgacggac cgcagtgcgg gtagacggcc tgacggccgc     25080
     cttcgggggt ccaggggacc cccgggggac actccagtcc tccgcacagc gaaaaaataa     25140
     aattctgcgt ggggtggtcg ttcgtggacg gtgctgaccg catgtctcta tgcgtacgct     25200
     ctcgttcgtg atgctccata tcctgtgtag tgagcaccct ccgcctctcg acggcggcag     25260
     atatggctaa ggatacctgc tgctggtggg taacgcttaa gccattctgc cgagaagaac     25320
     cggtacagaa agtgggttcg ttcccagcga ttcccgttgg cgcgggttcg agctgggaac     25380
     gccggtccgt tctcaggcaa gttgtgttct cgtagtgtct tctctgtcct gcgacttgca     25440
     catgcggcga cttaaaaccg ctaggagcgt cagacattgg tatcctcctc gacaagactg     25500
     cgaacgacat cggcgtttga cccgcgagcg atactgacac ggtcagtagc gacattgacc     25560
     atcgtctcgg acgattcgac aagcacccgc ggcggggcgt cgtactcctc gtaggtgtag     25620
     cgctcgcgaa cgatcccaag caacgagcca ccctccagcc ggtcaacctt cacaggcgtg     25680
     ccgacgtcgg cggtgtcgtc agcgcgcgcc cgacgcgtgg ccggtgcgcc ctggctggct     25740
     ctactcatct gtcccccccc gcttgcgcac tcgcccgagc gcatcgagca gcactgcttc     25800
     ggcgtcggcg tctgcgtcgt cggcaacgag atcggcgatc tcgatgacac ggtcgacagt     25860
     ggcgttgggc tcactcgcca tcgtcgccct cttggtcgcg tggtcgaagg tgaacgacga     25920
     cagtacccaa ctggatacgg tgctggacct ctgtcacgcg gtagtggtcc gtgtcccagg     25980
     taacgagctc gccctcgcgg ggaatcgcag caccgtagtg ctcgattgtc ttggtgaagc     26040
     tctccggcgt gtcgggtttc tcgacgagtt cgaggcgggt catggctgcc ctccgccgta     26100
     ctcagactgg atgtcagcga gtcgtgcgga cgcccgggtc cgttcggtca cctcgacgat     26160
     ttcccagtgc cagacgtgat cctcgggcac gtcgtcgtcg acgtcccact ccggggacca     26220
     ccactccgtg tcgggtcgaa ccgtgtatcg cggcccatgg ggcgttgcct cgacagcgtg     26280
     gatttcaccg ggaacgggca cgtcgtcggt gtcgaagtct tggaagagcc cgccctcttt     26340
     gagccggtat cgatgcccgt tctcgtagcg aacgccgaag ccctgctgga ggatttcggc     26400
     tgcgttcccg agtaactccc agccgttggg agtctcggcg acggtgccga cagcctcgaa     26460
     gcggcgctcg gtatctccgt cagggccgac gacgactcgg tggcacggac agagtcgcgg     26520
     gtccgtcgtt tctggctctg ccatctggcg cgtgcagcgc gggcactggt agaggatggc     26580
     ggccatctac ggctcacctc cccgcgtcgc cgaccgagcg agttcgaagt cgaactcgaa     26640
     gcagctgccc agcccacact cctgacagtc cgcgatgaat cggaaccggc cggtggcgaa     26700
     ccactggacg ttgccacagt cctggcactc gaaggcgacg gcgtggccgc gatagacggt     26760
     gaggttcccc tctcggtcga gcttctgcac cggtctggtc gcgccaccgt ggcggatcgc     26820
     cgtcggcacg tcggcgccga tgcgggcgtc gcccggtgac tgcccgccgt cggacatggc     26880
     gatgggcttc gtcgcgacgg tctcgcagtc agctgtctga agcaggtgcg ccgtcgatgt     26940
     cttcacatag gtccagacgc cctcgcaagc cagacacagc acgttgaacc ggtcttgttg     27000
     ctggagtccg ccgtcacagt cgtcccgagg gcagtcttcg tggtcccagc acagctccgt     27060
     gccggtcgct ggctgctcac tctgcatcgt cgccctcctg gtcgtcgcct tcgtcgagga     27120
     cgattcgttc aagccgggcc agccgttgct cgatatcggc gtccgcgaca cacccgccgt     27180
     cgtgggtgcc gtggtcggtg ctcatgctga ccctcccgtg gagtcttcgg gcagctcaaa     27240
     gccgttctcg cggaggacat cagctggcga gcggcccgac tcatcatgat tcccgcgtgg     27300
     gtcgggctcg tcgttggctt tggctgcaca gacactgcag aggccatagc gctcgcggtc     27360
     ggtctcatcg gcgacacgga acacttcgac gtcgtcggtg ccggcatcac acagtggcgt     27420
     cggatcctct cgggtagcct cgggggctgg gtggtggact ttgccgtcgt tccactggga     27480
     tttgggcatg acgtagaact cgtcgtcggt gggcgtcatc tgacacctcc gttgtggcag     27540
     tgatgcgggc agacagtgtt gtcgacccgg aggccgcggg cgtggccgta ctcggtgccg     27600
     tcactgactg tgacccggcg tcggcactcg gtacacagcg cttcgttgcg agcgcgtgtg     27660
     atcgagactg tggagggctc gggtggctgg gcgaccagat gcgggtggcc ctgcaggtag     27720
     gccgggcggt ttgggcggtg cgtgctcatt gtgagcctcc gctgacggcg accagcacct     27780
     gtctggcttc gcgcgtgcgt ttggtggtgt cagcttgggc tagggcgagt cgggctgcgc     27840
     aggcgtctac tcgtgcttgg ctgtggctgc ggtcgtagcc gggccgggaa aggacggtct     27900
     ggcagtcctc gatgacagcg gcgtcggtgt cggcttcggt gaggagtcgt ttcgcggttt     27960
     ggaggcgaca ctcctgtcgg tcctgtgcgg tatcgttttg tggtctggtt gtctcagtca     28020
     taatgccgtg cgcgaccggg ccagcggagt tacggctccg gtggtccatt ttcgtcgaat     28080
     ctatctgacc cggtgagtcg cgcatatctg gatacgtgac gcccgttgga cataatactt     28140
     gcgtaggtgc aatgattggt agacactttc tataagtatg taccctcaga catgaaacat     28200
     attgatggct ggcgacaagc caggccctga gcaagaggtc agtgacgaag aactccttcg     28260
     cgtgcttgct ttggcctaca aaccggcgct cggaaccact gaaatcgcag actgcgttga     28320
     tcttagcaga caggctattg atcgacggat gaagcagctc gaagagatac gcctcgttga     28380
     atctggaaag ttcgggtcga ccagagcgtg gtggttgact gacgacggga ggcgtcaggt     28440
     ctccgattcc gaattgaacg agccgtcgag ccagtaaatg tacggcccat tcccgagctg     28500
     agatctttga atatcgccag agcctgctaa ctgactcatc cgctgccgga ccctccaaga     28560
     cgagagtcca acttgttctg caacctgctt ggcagtggca aacggttcgt tggtactcat     28620
     tacggcctga agcaactcgg agtcggtgac cttggggtcg gggcctttgg tactcatctt     28680
     ctgttaccca atcattgcgc ctagacaata gttttattgt tgcggagacg caaccgtttg     28740
     gacaggaaca gacgcgccgc tgggcgattt cgtgtcttcg agaacacgag ttgcctaccg     28800
     tggtcacaac acggcaggcg cgtcggttcc gtcgagaacc atgagtaagt ctgcttcgcc     28860
     gactagtaaa tctgtcggca cgaccgaacc gaatccacag gaacgtaccg cccgcgaact     28920
     gctcacgcaa ggccgcccgc tgttcttggg cgtcgacggc gaaggcgcgg cccactactg     28980
     ggactcgtat gaattcgctg tggccgtcgt cgctcgcgac acccgcaccg agaaggtcaa     29040
     actcgccgac acgccatatg aaacactcgt agggtggtgc gagtacacgc aggacgaacg     29100
     cggctgggcc gtcggcccgc acgtcggcgg caccatcgtc gacgatcttg ctcggaggcg     29160
     gaatgcatga gtaagaccgt gcgctgtacg gtcgagaacc gtcagcgcgt tcggcgtgcc     29220
     gcccgagcgc tgcgggagac cgcgccgacc gccgtagtcg agacgacgcc gccggtccgc     29280
     tcggaacacg acgcttggac gcttgatgcc gtgttgcgag agaccgaggg cgttccgccg     29340
     gaagtgctcc gagagctcgc gctggccggg ctgacgctcc agccgacgcc cacgcaggct     29400
     gagcatcaac acgtcgtggc gacggcctga gcgagacagc gatacctcta tctttttgac     29460
     gacttgcgta gctatttgac atgggttgcg atggtttccg agacgactcc tgacagctcg     29520
     cgaccccgcg ccggggcctg gtgaggcagg tcccacgacg gcgcgagtat gtatctgtgg     29580
     ctgatgggtg actggtatgt aaacccccct tgtacttccg ggaggtggcg agtagtacga     29640
     gaataagcgt ctttgactgg tcttgccctt gaagatcgag atgggtccgc tatgtcgttc     29700
     gggcgcttga gtggctgtca gggcgatact ctggcggcga gtgatagggg gtaataaagg     29760
     tggcttgtac ttccgggggt ggtagctcgc taaccaacac ttggtggtga tggcggtcca     29820
     gtgttggtta gtcagagggg tggtgtagga cagttcaaca gggtgctgat tgcagaacta     29880
     ttgatggcga attggctggt cagtaggctt gcctattgac aatggaatgt tctatcagtc     29940
     tacatgggtc taatagcact gtaagatgca gagtatgggt tttgattaaa cgcttctgtt     30000
     ggtatcggtt agtagctatc cctgcatccg aaaatgtaag aaatgaactt gataactgca     30060
     gtacaagctt tatcaatttc gtttagaatt aattgacatg gcattcagcg acgacgatct     30120
     tcggacttat caacagcaag cagtcagagc tattgcggaa gctgatgaag actacaagtc     30180
     gcttattctc ccaacagggg caggaaaaac gagagttgga cttgcgtatg cttctaatat     30240
     tctggataaa aaggactctg ttgcgtacat tacccagacc aatgctcacg tcggacaggt     30300
     actctcggag tctgatgcaa tcggtgttga tgctgttcac atccccggta gatcagccga     30360
     atctcagggt gatggaggga gcggggatcg cgaaatcgac atccaagatt ataatattgg     30420
     gttcaaggtt ggagtgtttt cttacgcggg atatttctta ggtagtgaag ttccaactgc     30480
     tgacactctt attattgacg acgcacatgc ctttacaagc gaacatgtca cgcattctgc     30540
     tgtcatcctc caccgtgacg actgggggag gcagtatgac cgactgattg atttaataaa     30600
     agatgaaaat ccgattctgg agtctgaaat tgaatctctt caacaaccga tccatcgagg     30660
     aggtggtact gttttagtgc caccacccga cactaccgaa gttgagcaag caattacgtc     30720
     gagcgtagaa tcaatgtcgg aagcggacgg gtgggagccg tatcttctcc aaaaacgact     30780
     caacgcctct ccagactttg tgaattggcc ttgtgtcatc actgccaata caatctcttg     30840
     gagacctttc atcctgccct tccaatcgtt cggtcgtagc cccaacagag atattgaaga     30900
     atccgaactt gttgcaatga cctctatcag agacccggaa gagtttctac agacaagact     30960
     tggaactccc gaattagtta ctaaaatcga accccccgaa ccagtcgatg agatgggctc     31020
     tagggttgtt gttccgtata gagatcagta tgatcgcaat cctccgtcgg agggccaaat     31080
     taacaccatc aaccggtggg cagaccgatt cggttcggtc ctcgtctctg ttgcgtccca     31140
     caattcagct caagaggtaa tgaagcgcct ccacaaaaaa gacataaatc ctatagaata     31200
     cgaatccgaa attagtgtac aggagcttca ggaacaagag gaacctcggg cacttgtact     31260
     agttaacaaa ccttctggga ttgatatttc ctcttcaatc tgtcctgttg ctatccatct     31320
     ggacctgcct cattcaacat ctggtcacga agttgtggcc ggggatattg aggagtcggg     31380
     ggccgtggct gaagcaagct tggccgtgcg cctgtcccaa cttttaggac gattaaatag     31440
     atctgatgaa gatcggagta tacacctcct cctcgccgat ggcctcccac tgagacgagg     31500
     tactgctttt gttaaatctt tagatcctgc tgtcttaact gaccttctga tcggccgtcg     31560
     gggtattgca caggagtacg aactgccgac tgaaacagga ctacttgacg acgcagaggc     31620
     gtttctcaat ggagatgatt ctctccgaag tagttatata acggatcctg aacagcttcg     31680
     aaagttgttt cttggtagtg atgtggaggg attctctcca ggaaccattc agcaggttga     31740
     agctaatcta ttcgctgcac gtgggaactt tactagggct gccaagcaat ttgaaaggtt     31800
     ctctcagaat gcggaggaac aggggtaccc agatcattca tcattttatg atttccagtc     31860
     tatcgtatat ggttccgcag atactggatc aactagcggc acactcaacc gtagtacaga     31920
     cgcgattgtt gatgcagctc ttgatcgtaa cccccaaagt ggggctttag ttgctgccct     31980
     ccgacaaata caatccagtg aagagactga tacacaacaa gcccgtattg agatgcgggt     32040
     aaaacagcag aagcggcaag ccttctactg tttcacacga tggtacgacg aggcggatgg     32100
     gaatgttccc gatagagatc attataccag tgtagaccca tggaaagagt actggcgcag     32160
     tagatttgcg aaagcagagc actcagaatt gacctcggca tattcggaag cgtttgagtt     32220
     actcggaaca gataccccac aacgagagaa gcaagataac gatcttcgaa ttcgatggga     32280
     gacagaaaat ggggaagagt ttattttggc ggtcgaaatc aaaggctgga acccggacac     32340
     ggtcgacagt gaaccggatc tgaagtcaga taacatcaga caggcacgca cgaatgcccg     32400
     caaaatcgat gctgatgcgg ccttgttagc gtcatcacgc tcaggtcgta ctcgtgacgt     32460
     tccaggatca gcagaaacat acggtgtcca ctgtctcaac ggtgacgcat ctgtcgcgtt     32520
     tgctgacatg atggcagaac agtgtgcaat actcgccacg gtagagcaaa accaaatcga     32580
     ccgaaatcag gttccgttat gcgcaagaag gatccagaaa cttctggaga gcgacgggag     32640
     aatacttgac ggacaggaaa ttagggcact catagatctg gagtgaaagt agcccaataa     32700
     agcatatatc aactggaact aggtagaatc atagaaacat cgtgcactgt ggctaacaga     32760
     acttgtcgaa ctcctctcat cagtgtggct atgatctctt tgaataggca cttcccggcc     32820
     tcgtaatggt tggcgtattg tctggggccg tagtgtatcg ttgttcctct gtctgcccaa     32880
     cccactggcc agtccttgac taatttgtgc tcagtatctg gcaagcgaag atttggggag     32940
     gtctctcctt ggtgtgatac tgccttgacc tgtactgact ggacaacgac ttgtctgaga     33000
     agtcgttagt acagatatcg attgggggtc ggctttggag actcaaatac gacggtcagt     33060
     aaatgcgctc actgctcaga aaattctggg cgaagtcagc aagcggtgca agcaccagtg     33120
     gatgcgctgg acaaaggaag gattagaggc gatactccag cttcggctgg tgaagtacgc     33180
     tgatccagag cactaccaat cgttcctcga cgaactgctc cagcgatcga ccaaaacagc     33240
     aatgagctgt gacctctcaa ttgagagcac cagaggcaaa ctctagaccg ctttgcgacg     33300
     cga                                                                   33303
//

If you have problems or comments...

PBIL Back to PBIL home page