(data stored in ACNUC23119 zone)

EMBL: AY605286

ID   AY605286; SV 1; linear; mRNA; STD; VRT; 3424 BP.
XX
AC   AY605286;
XX
DT   10-DEC-2004 (Rel. 82, Created)
DT   10-DEC-2004 (Rel. 82, Last updated, Version 1)
XX
DE   Oryzias latipes strain HNI P protein (OCA2) mRNA, complete cds.
XX
KW   .
XX
OS   Oryzias latipes (Japanese medaka)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata;
OC   Ovalentaria; Atherinomorphae; Beloniformes; Adrianichthyidae; Oryziinae;
OC   Oryzias.
XX
RN   [1]
RP   1-3424
RX   DOI; 10.1534/genetics.104.030494.
RX   PUBMED; 15579703.
RA   Fukamachi S., Asakawa S., Wakamatsu Y., Shimizu N., Mitani H., Shima A.;
RT   "Conserved function of medaka pink-eyed dilution in melanin synthesis and
RT   its divergent transcriptional regulation in gonads among vertebrates";
RL   Genetics 168(3):1519-1527(2004).
XX
RN   [2]
RP   1-3424
RA   Fukamachi S., Asakawa S., Wakamatsu Y., Shimizu N., Mitani H., Shima A.;
RT   ;
RL   Submitted (23-APR-2004) to the INSDC.
RL   Integrated Biosciences, University of Tokyo, Kashiwa-no-ha 5-1-5,
RL   Kashiwa-shi, Chiba-ken 277-8562, Japan
XX
DR   MD5; 57bac9abf63bf3786c1d2fe19a7504dd.
DR   Ensembl-Gn; ENSORLG00020019428; oryzias_latipes_hni.
DR   Ensembl-Tr; ENSORLT00020027089; oryzias_latipes_hni.
DR   EuropePMC; PMC1448775; 15579703.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3424
FT                   /organism="Oryzias latipes"
FT                   /chromosome="LG4"
FT                   /strain="HNI"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:8090"
FT   gene            1..3424
FT                   /gene="OCA2"
FT   CDS_pept        215..2743
FT                   /codon_start=1
FT                   /gene="OCA2"
FT                   /product="P protein"
FT                   /note="pink-eyed dilution; putative transporter"
FT                   /db_xref="GOA:Q5MQ83"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:Q5MQ83"
FT                   /protein_id="AAT58047.1"
FT                   /translation="MYLENKSNLEMEMTQTSASGHQCRSSLRPPEAVAGNFGELRLLQG
FT                   ISENGDTQKLQQSSVLPSGQCVIHTEGFVPVRKEDRHSFSAVNFLRGKTNSANISERSP
FT                   LLRFPQDESITYMTVHEPSFGVDEPWDSSSLDIERRFRLGSEVASLTRSNSSDKTEALE
FT                   NLSLSFRLTSSVKCCLRVCKVATIFAIVVLCSLFFSMYPDRDNPWRMLAVSPSDSFSMN
FT                   VTDFRDNALLKLQVAGPFAGGMIDLSTQEYILIQVEQTEEPGQRRRRTQQVIYNWTVPL
FT                   HAERSLQRVVTKTFEMLSSEPIAITIQAFLQDTEVVPLSMTHQSLYVTMETQVAIAGII
FT                   LCGVYILIIFEIVHRTLAAMLGSLAALAALAVIGNRPSLVTVVEWIDYETLALLFGMMV
FT                   LVAIFSETGFFDYCAVKAYQLSRGRVWPMIIILCLIAAILSAFLDNVTTMMLFTPVTIR
FT                   LCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSNQGLRREGIDFASFTGYMFL
FT                   GICLVLLTSFPFLRLLYWNKKLYNKESIEIVELKHEILVWRQTAQRINPASREETAVKC
FT                   LLMQKVLTLENLLRKMMKTFQRQISQEDKNWEQNIQELQKKHRITDRVLLVKCVSVLVV
FT                   VIFVFFLNSFIPSIHLDLGWIAILGALWLLVLADIQDFEIILHRVEWATLLFFAGLFVL
FT                   MEAIAQLQLIDFIGEQTALLIKAVPEDQRLAIAIILVMWVSALASSLIDNIPFTATMIP
FT                   VLINLSQDSDVNLPVKPLIFALAMGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEF
FT                   FKLGFPMMIMTCMIAMCYLLATHVGLGWNM"
XX
SQ   Sequence 3424 BP; 875 A; 822 C; 798 G; 929 T; 0 other;
     agatccagag aggaaactcc tccacctttc ctgttttgaa cgtcacttca cccaaaaaat        60
     cgaactcatc ccagcatctg taaagttttc cccaactttt ccactgagtt taggaggctt       120
     ctgtgtaatt ttgcatctgg cggttcatct catcatcatc tctagcatcc tcatcaccta       180
     attcagcctg tgttttcttt attcacgaat caacatgtat ctggagaaca aaagcaacct       240
     ggagatggag atgactcaga cttctgcctc aggtcatcag tgcaggagca gcctgaggcc       300
     accggaggcc gtcgcgggga acttcggaga gctacggctg ctgcagggca tctcagagaa       360
     tggagacacc cagaagctcc agcagtcgtc cgtccttccc tccggacagt gtgtcatcca       420
     cacagagggc tttgttcctg ttcgtaagga ggacagacac agcttcagcg ctgttaactt       480
     cctcagagga aaaacaaatt ctgcaaacat ttcagagcga tcacctctgc tgagattccc       540
     tcaggatgaa agcatcacct acatgacggt gcatgaaccc agctttggag tggacgagcc       600
     gtgggacagc agctcgctgg acattgagag acgatttcgg ttgggcagcg aagtggccag       660
     cctgacccgc tccaactcct ctgacaagac tgaagctctg gagaatctca gtctgagctt       720
     caggctcaca agcagcgtca aatgctgcct cagagtttgc aaagttgcaa cgatatttgc       780
     tattgtcgtc ctctgcagcc tgtttttcag catgtatcca gacagagaca acccctggag       840
     gatgttggca gtctcacctt cagacagttt ctcaatgaat gtgacagact ttcgggataa       900
     tgctctgctg aagctgcagg tggcagggcc ctttgcagga gggatgatag accttagcac       960
     ccaggagtac atcttgatcc aagtggagca gactgaggag ccgggacaac ggaggaggag      1020
     aactcaacag gtgatttata actggaccgt tcctttacat gctgaacgga gtctccagag      1080
     ggtggtaact aaaacctttg agatgctcag cagtgaaccc atcgccatca caatccaggc      1140
     cttcctgcag gacactgaag tggtgccgtt gtccatgacc catcaatcgc tctacgtcac      1200
     catggaaacc caggtggcca ttgcaggaat cattctgtgt ggggtctaca ttctgatcat      1260
     ctttgagatt gttcaccgca ccctggctgc aatgttggga tccttagctg ccttagctgc      1320
     tttggccgtt attggtaatc gacccagtct ggttactgtg gtggagtgga tcgactatga      1380
     gactctggct ctcctgtttg gcatgatggt gctggtggct attttttctg aaaccggctt      1440
     ctttgattac tgtgccgtga aggcttacca gttatctcga ggaagagtgt ggccaatgat      1500
     catcatcctc tgtctgatcg cagccattct gtcagcattt ctggacaatg tgaccaccat      1560
     gatgctcttc actcctgtca caataaggtt gtgcgaggtg cttaatctag accccagaca      1620
     tgttctgatt gcagaagtaa tcttcaccaa cattggaggg gccgccacag ctgtcggaga      1680
     tccacccaac gtgattatag tttcaaacca gggcctgcgc agagaaggga tcgactttgc      1740
     cagctttaca ggctacatgt tccttggaat ttgcctcgtt cttttgacct cctttccttt      1800
     tctgcggctg ctctactgga acaaaaaact ttacaacaaa gaatcgattg aaatagttga      1860
     actcaagcac gagatcctgg tttggaggca gacggcccag cgcataaacc ctgccagccg      1920
     agaggaaaca gctgtcaaat gccttctgat gcaaaaagtg ctcactctgg aaaatctgct      1980
     tcggaaaatg atgaagacat ttcaaagaca aatttctcag gaggataaaa attgggagca      2040
     aaacattcag gagctacaaa agaagcacag gataaccgac agggtcctgt tggtgaagtg      2100
     tgtctctgtc cttgttgtgg tgatctttgt gttctttctc aactccttca ttcccagcat      2160
     tcatctggat cttgggtgga ttgccatcct gggtgccctt tggctactgg ttctggccga      2220
     catccaggac tttgagatca tcttgcaccg ggtggagtgg gccacactct tgttttttgc      2280
     cggtctcttt gttttgatgg aggcaatagc tcagctgcag ctcatcgatt tcattggtga      2340
     gcaaacggcg cttctgataa aagcggtgcc agaagaccag cggctggcca ttgcaatcat      2400
     tttagtgatg tgggtctctg ctctggcttc ctctctcatc gacaacattc ccttcactgc      2460
     caccatgatt ccagttctca ttaacctgag tcaggactct gatgtgaacc ttccagtaaa      2520
     acctctcatc tttgctttgg ccatgggagc ctgtcttggg ggaaacggta cgctgatcgg      2580
     agcatcagcc aatgttgttt gtgcaggaat cgctgaacaa cacggatatg gcttttcctt      2640
     tatggagttc ttcaagttgg ggttccccat gatgataatg acatgtatga tcgctatgtg      2700
     ctacctgctg gccactcacg tcggccttgg ctggaacatg tgaaccctgc tgctgctcag      2760
     agccaaagtg tgtgtatggg tgcgtgagcg tgcacgtggc cactgcgaca gcctcagctc      2820
     actgtaacat gctgtgtaac ctgagaaact gatcagatta cagcatgagg cactgtaact      2880
     acatttttat aagcatggag cggcgctccc agtgaagtgt ggaccatcag ggaccagatt      2940
     caaaggagtc ttgaaaaaaa taacttattc cacactggtg ttcatggtgc tacagtcagt      3000
     gattacagcg ataatctctg accccattct tcttcagatt tagatgatct gttcatataa      3060
     aaagcagatt atcttttctt tatctttaga catttaccat ccctttaata ttaaaaaaag      3120
     accaacagaa agggattttt ttaaaacaac taatgtctct agttcttaat tagatccccg      3180
     gttaaaaata agcataaatt aacctgactc aaaaactgac ttactgtagt tagtcatgct      3240
     aagtacagaa ggagtcattc atcatgaaaa cagctgtaaa tgagatgaac agctgtttga      3300
     cattacaaat ttaattctgt tttctgtatc aactctaccc cctgctgaat gtaacattca      3360
     gtcactttca tgaacaataa agactgtcat gtcgctggac tttattgtaa aaaaaaaaaa      3420
     aaaa                                                                   3424
//

If you have problems or comments...

PBIL Back to PBIL home page