(data stored in ACNUC23119 zone)

EMBL: AY605287

ID   AY605287; SV 1; linear; mRNA; STD; VRT; 3372 BP.
XX
AC   AY605287;
XX
DT   10-DEC-2004 (Rel. 82, Created)
DT   10-DEC-2004 (Rel. 82, Last updated, Version 1)
XX
DE   Oryzias latipes strain Hd-rR P protein (OCA2) mRNA, complete cds.
XX
KW   .
XX
OS   Oryzias latipes (Japanese medaka)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata;
OC   Ovalentaria; Atherinomorphae; Beloniformes; Adrianichthyidae; Oryziinae;
OC   Oryzias.
XX
RN   [1]
RP   1-3372
RX   DOI; 10.1534/genetics.104.030494.
RX   PUBMED; 15579703.
RA   Fukamachi S., Asakawa S., Wakamatsu Y., Shimizu N., Mitani H., Shima A.;
RT   "Conserved function of medaka pink-eyed dilution in melanin synthesis and
RT   its divergent transcriptional regulation in gonads among vertebrates";
RL   Genetics 168(3):1519-1527(2004).
XX
RN   [2]
RP   1-3372
RA   Fukamachi S., Asakawa S., Wakamatsu Y., Shimizu N., Mitani H., Shima A.;
RT   ;
RL   Submitted (23-APR-2004) to the INSDC.
RL   Integrated Biosciences, University of Tokyo, Kashiwa-no-ha 5-1-5,
RL   Kashiwa-shi, Chiba-ken 277-8562, Japan
XX
DR   MD5; 4c00c20ef19bfed07f5127eb58f22e91.
DR   Ensembl-Gn; ENSORLG00000015893; oryzias_latipes.
DR   Ensembl-Tr; ENSORLT00000019904; oryzias_latipes.
DR   EuropePMC; PMC1448775; 15579703.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3372
FT                   /organism="Oryzias latipes"
FT                   /chromosome="LG4"
FT                   /strain="Hd-rR"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:8090"
FT   gene            1..3372
FT                   /gene="OCA2"
FT   CDS_pept        193..2721
FT                   /codon_start=1
FT                   /gene="OCA2"
FT                   /product="P protein"
FT                   /note="pink-eyed dilution; putative transporter"
FT                   /db_xref="GOA:Q5MQ82"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:Q5MQ82"
FT                   /protein_id="AAT58048.1"
FT                   /translation="MYLENKSNLEMEMTQTSASGHQCRSSLRPPEAVAGNFGELRLLQG
FT                   ISENGDTQKLQQSSVLPSGQCVIHTEGFVPVRKEDRHSFSTVNFLRGKTNSANISERSP
FT                   LLRFPQDESITYMTVHEPSFGVDEPWDSSSLDIERRFRLGSEVASLTRSNSSDKTEAVE
FT                   NLSLSFRLTSSVKCCLRVCKVATIFAIVVLCSLFFSMYPDRDNPWRMLAVSPSDSFSMN
FT                   VTDFRDNALLKLQVAGPFAGGMIDLSTQEYILIQVEQTEEPGQRRRRTQQVIYNWTVPL
FT                   HAERSLQRVVTKTFEMLSSDPIAITIQAFLQDTEVVPLSMTHQSLYVTMETQVAIAGII
FT                   LCGVYILIIFEIVHRTLAAMLGSLAALAALAVIGNRPSLVTVVEWIDYETLALLFGMMV
FT                   LVAIFSETGFFDYCAVKAYQLSRGRVWPMIIILCLIAAILSAFLDNVTTMMLFTPVTIR
FT                   LCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSNQGLRREGIDFASFTGYMFL
FT                   GICLVLLTSFPFLRLLYWNKKLYNKESIEIVELKHEILVWRQTAQRINPASREETAVKC
FT                   LLMQKVLTLENLLRKMMKTFQRQISQEDKNWEQNIQELQKKHRITDRVLLVKCVSVLVV
FT                   VIFVFFLNSFIPSIHLDLGWIAILGALWLLVLADIQDFEIILHRVEWATLLFFAGLFVL
FT                   MEAIAQLQLIDFIGEQTALLIKAVPEDQRLAIAIILVMWVSALASSLIDNIPFTATMIP
FT                   VLINLSQDSDVNLPVKPLIFALAMGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEF
FT                   FKLGFPMMIMTCMIAMCYLLATHVGLGWNM"
XX
SQ   Sequence 3372 BP; 851 A; 817 C; 793 G; 911 T; 0 other;
     acctttcctg ttttgaactt cacttcaccc aaaaaaatcg aactcatccc agcatctgta        60
     aagttttccc caacttttcc actgagtttt ggaggcttct gtgtaatttt gcatctggtg       120
     gttcatctca tcatcatctc cagcatcctc atcacctaat tcagcctgtg ttttctttat       180
     tcacgaatca acatgtatct ggagaacaaa agcaacctgg agatggagat gactcagact       240
     tctgcctcag gtcatcagtg caggagcagc ctgaggccac cggaggccgt cgcggggaac       300
     ttcggagagc tacggctgct gcagggcatc tcagagaatg gagacaccca gaagctccag       360
     cagtcgtccg tccttccctc cggacagtgt gtcatccaca cagagggctt tgttcctgtt       420
     cgtaaggagg acagacacag cttcagcact gttaacttcc tcagaggaaa aacaaattct       480
     gcaaacattt cagagcgatc acctctgctg agattccctc aggatgaaag catcacatac       540
     atgacggtgc atgaacccag ctttggagtg gacgagccgt gggacagcag ctcgctggac       600
     attgagagac gatttcggct gggcagcgaa gtggccagcc tgacccgctc caactcctct       660
     gacaagactg aagctgtgga gaatctcagt ctgagcttca ggctcacaag cagcgtcaaa       720
     tgctgcctca gagtttgcaa agttgcaacg atatttgcta ttgtcgtcct ctgcagcctg       780
     tttttcagca tgtatccaga ccgagacaac ccctggagga tgttggcagt ctcaccgtca       840
     gacagtttct cgatgaatgt gacagacttt cgggataatg ctctgctgaa gctgcaggtg       900
     gcagggccct ttgcaggagg gatgatagac cttagcaccc aggagtacat cttgatccaa       960
     gtggagcaga ctgaggagcc gggacaacgg aggaggagaa ctcaacaggt gatttataac      1020
     tggaccgttc ctttacatgc tgaacggagt ctccagaggg tggtaactaa aacctttgag      1080
     atgctcagca gtgaccccat cgccatcaca atccaggcct tcctgcagga cactgaagtg      1140
     gtgccgttgt ccatgaccca tcaatcgctc tacgtcacca tggaaaccca ggtggccatt      1200
     gcaggaatca ttctgtgtgg ggtctacatt ctcatcatct ttgagattgt tcaccgcacc      1260
     ctggctgcaa tgttgggatc cttagctgcc ttagctgctt tggccgttat tggtaatcga      1320
     cccagtctgg ttactgtggt ggagtggatc gactacgaga ctctggctct cctgtttggc      1380
     atgatggtgc tggtggccat tttttctgaa accggcttct ttgattactg tgccgtgaag      1440
     gcttaccagt tgtctcgagg aagagtgtgg ccaatgatca tcatcctctg tctgatcgca      1500
     gccattctgt cagcatttct ggacaatgtg accaccatga tgctcttcac tccagtcaca      1560
     ataaggttgt gcgaggtgct taatctagac cccagacatg ttctgattgc agaagtaatc      1620
     ttcaccaaca ttggaggggc cgccacagct gtcggagatc cacccaacgt gattatagtt      1680
     tcaaaccagg gcctgcgcag agaagggatc gactttgcca gctttacagg ctacatgttc      1740
     cttggaattt gcctcgttct tttgacctcc tttccttttc tgcggctgct ctactggaac      1800
     aaaaaacttt acaacaaaga atcgattgaa atagttgaac tcaagcacga gatcctggtt      1860
     tggaggcaga cggcccagcg catcaaccct gccagccgag aggaaacagc tgtcaaatgc      1920
     cttctgatgc aaaaagtgct cactctggaa aatctgcttc ggaaaatgat gaagacattt      1980
     caaagacaaa tttctcagga ggataaaaat tgggagcaaa acattcagga gctacaaaag      2040
     aagcacagga taaccgacag ggtcctgttg gtgaagtgtg tctccgtcct tgttgtggtg      2100
     atatttgtgt tctttctcaa ctccttcatt cccagcattc atctggatct tgggtggatt      2160
     gccatcctgg gtgccctttg gcttctggtt ctggccgaca tccaggactt tgagatcatc      2220
     ttgcaccggg tggaatgggc cacactcttg ttttttgccg gtctctttgt tttgatggag      2280
     gcaatagctc agctgcagct catcgatttc attggtgagc aaacggcgct tctgataaaa      2340
     gcggtgccag aagaccagcg gcttgccatt gcaatcattt tagtgatgtg ggtctctgct      2400
     ctggcttcct ctctcatcga caacattccc ttcactgcca ccatgattcc agttctcatt      2460
     aacctgagtc aggactctga tgtgaacctt ccagtaaaac ctctcatctt tgccttggcc      2520
     atgggagcct gtcttggggg aaacggtacg ctgatcggag catcagccaa tgttgtttgt      2580
     gcaggaatcg ctgaacaaca cggatatggc ttttccttta tggagttctt caagttgggg      2640
     ttccccatga tgataatgac atgtatgatc gccatgtgct acctgctggc cactcacgtc      2700
     ggccttggct ggaacatgtg aacccagctg ctgctcagag ccaaagtgtg tgtgtgtgtg      2760
     tgtatgggtg cgtgagcgtg cacgtggcca atgcaacagc ctcagctcac tgtaacatgc      2820
     tgtgtaacct gagaaactga tcagattaca gcatgaggca ctgtaactac atttttataa      2880
     gcatggagcg gcgctcccag tgaagtgtgg accatcaggg accagatgca aaggagtctt      2940
     gacaaaaatg actaattcca cactggtgtt catggtgcta cagtcagtga ttacagcgat      3000
     aatctctgac cccattctta ttcagactta gaggatctgt tcatacgaaa agcagattat      3060
     cttttcttta tcttcacaca tttagaatcc ctttaatatt aaaaaaagac caacagaaag      3120
     ggatttttta aaacaactaa tgtctgtatt tcttaattag atccccggtt aaaaataagc      3180
     ataaattaaa cttgactcat aaactgactt actctagtta gtcatgctaa gtacagaagg      3240
     agtcattcat catgaaaaca gctgtaaatg agatgaacag ctgtttgaca ttacaaattt      3300
     aaatctgttt tctgtattaa ctctaccccc tgctgaatgt aacattcagt cactttcatg      3360
     aacaataaag ac                                                          3372
//

If you have problems or comments...

PBIL Back to PBIL home page