(data stored in ACNUC23119 zone)

EMBL: AY605288

ID   AY605288; SV 1; linear; mRNA; STD; VRT; 3042 BP.
XX
AC   AY605288;
XX
DT   10-DEC-2004 (Rel. 82, Created)
DT   10-DEC-2004 (Rel. 82, Last updated, Version 1)
XX
DE   Oryzias latipes strain HNI P protein (OCA2) mRNA, complete cds.
XX
KW   .
XX
OS   Oryzias latipes (Japanese medaka)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata;
OC   Ovalentaria; Atherinomorphae; Beloniformes; Adrianichthyidae; Oryziinae;
OC   Oryzias.
XX
RN   [1]
RP   1-3042
RX   DOI; 10.1534/genetics.104.030494.
RX   PUBMED; 15579703.
RA   Fukamachi S., Asakawa S., Wakamatsu Y., Shimizu N., Mitani H., Shima A.;
RT   "Conserved function of medaka pink-eyed dilution in melanin synthesis and
RT   its divergent transcriptional regulation in gonads among vertebrates";
RL   Genetics 168(3):1519-1527(2004).
XX
RN   [2]
RP   1-3042
RA   Fukamachi S., Asakawa S., Wakamatsu Y., Shimizu N., Mitani H., Shima A.;
RT   ;
RL   Submitted (23-APR-2004) to the INSDC.
RL   Integrated Biosciences, University of Tokyo, Kashiwa-no-ha 5-1-5,
RL   Kashiwa-shi, Chiba-ken 277-8562, Japan
XX
DR   MD5; 9a4486c9a5c209a963da6aba011e30a4.
DR   Ensembl-Gn; ENSORLG00020019428; oryzias_latipes_hni.
DR   Ensembl-Tr; ENSORLT00020027081; oryzias_latipes_hni.
DR   EuropePMC; PMC1448775; 15579703.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3042
FT                   /organism="Oryzias latipes"
FT                   /strain="HNI"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:8090"
FT   gene            1..3042
FT                   /gene="OCA2"
FT   CDS_pept        181..2361
FT                   /codon_start=1
FT                   /gene="OCA2"
FT                   /product="P protein"
FT                   /note="pink-eyed dilution; putative transporter; oocyte
FT                   specific isoform"
FT                   /db_xref="GOA:Q5MQ81"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:Q5MQ81"
FT                   /protein_id="AAT58049.1"
FT                   /translation="MTVHEPSFGVDEPWDSSSLDIERRFRLGSEVASLTRSNSSDKTEA
FT                   LENLSLSFRLTSSVKCCLRVCKVATIFAIVVLCSLFFSMYPDRDNPWRMLAVSPSDSFS
FT                   MNVTDFRDNALLKLQVAGPFAGGMIDLSTQEYILIQVEQTEEPGQRRRRTQQVIYNWTV
FT                   PLHAERSLQRVVTKTFEMLSSEPIAITIQAFLQDTEVVPLSMTHQSLYVTMETQVAIAG
FT                   IILCGVYILIIFEIVHRTLAAMLGSLAALAALAVIGNRPSLVTVVEWIDYETLALLFGM
FT                   MVLVAIFSETGFFDYCAVKAYQLSRGRVWPMIIILCLIAAILSAFLDNVTTMMLFTPVT
FT                   IRLCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSNQGLRREGIDFASFTGYM
FT                   FLGICLVLLTSFPFLRLLYWNKKLYNKESIEIVELKHEILVWRQTAQRINPASREETAV
FT                   KCLLMQKVLTLENLLRKMMKTFQRQISQEDKNWEQNIQELQKKHRITDRVLLVKCVSVL
FT                   VVVIFVFFLNSFIPSIHLDLGWIAILGALWLLVLADIQDFEIILHRVEWATLLFFAGLF
FT                   VLMEAIAQLQLIDFIGEQTALLIKAVPEDQRLAIAIILVMWVSALASSLIDNIPFTATM
FT                   IPVLINLSQDSDVNLPVKPLIFALAMGACLGGNGTLIGASANVVCAGIAEQHGYGFSFM
FT                   EFFKLGFPMMIMTCMIAMCYLLATHVGLGWNM"
XX
SQ   Sequence 3042 BP; 782 A; 708 C; 719 G; 833 T; 0 other;
     atgtaatgtg gttagaactc tagagatggt ctgctggtga ccagggggga gacagagctc        60
     tgacttctga cagtacacag cttcagcgct gttaacttcc tcagaggaaa aacaaattct       120
     gcaaacattt cagagcgatc acctctgctg agattccctc aggatgaaag catcacctac       180
     atgacggtgc atgaacccag ctttggagtg gacgagccgt gggacagcag ctcgctggac       240
     attgagagac gatttcggtt gggcagcgaa gtggccagcc tgacccgctc caactcctct       300
     gacaagactg aagctctgga gaatctcagt ctgagcttca ggctcacaag cagcgtcaaa       360
     tgctgcctca gagtttgcaa agttgcaacg atatttgcta ttgtcgtcct ctgcagcctg       420
     tttttcagca tgtatccaga cagagacaac ccctggagga tgttggcagt ctcaccttca       480
     gacagtttct caatgaatgt gacagacttt cgggataatg ctctgctgaa gctgcaggtg       540
     gcagggccct ttgcaggagg gatgatagac cttagcaccc aggagtacat cttgatccaa       600
     gtggagcaga ctgaggagcc gggacaacgg aggaggagaa ctcaacaggt gatttataac       660
     tggaccgttc ctttacatgc tgaacggagt ctccagaggg tggtaactaa aacctttgag       720
     atgctcagca gtgaacccat cgccatcaca atccaggcct tcctgcagga cactgaagtg       780
     gtgccgttgt ccatgaccca tcaatcgctc tacgtcacca tggaaaccca ggtggccatt       840
     gcaggaatca ttctgtgtgg ggtctacatt ctgatcatct ttgagattgt tcaccgcacc       900
     ctggctgcaa tgttgggatc cttagctgcc ttagctgctt tggccgttat tggtaatcga       960
     cccagtctgg ttactgtggt ggagtggatc gactatgaga ctctggctct cctgtttggc      1020
     atgatggtgc tggtggctat tttttctgaa accggcttct ttgattactg tgccgtgaag      1080
     gcttaccagt tatctcgagg aagagtgtgg ccaatgatca tcatcctctg tctgatcgca      1140
     gccattctgt cagcatttct ggacaatgtg accaccatga tgctcttcac tcctgtcaca      1200
     ataaggttgt gcgaggtgct taatctagac cccagacatg ttctgattgc agaagtaatc      1260
     ttcaccaaca ttggaggggc cgccacagct gtcggagatc cacccaacgt gattatagtt      1320
     tcaaaccagg gcctgcgcag agaagggatc gactttgcca gctttacagg ctacatgttc      1380
     cttggaattt gcctcgttct tttgacctcc tttccttttc tgcggctgct ctactggaac      1440
     aaaaaacttt acaacaaaga atcgattgaa atagttgaac tcaagcacga gatcctggtt      1500
     tggaggcaga cggcccagcg cataaaccct gccagccgag aggaaacagc tgtcaaatgc      1560
     cttctgatgc aaaaagtgct cactctggaa aatctgcttc ggaaaatgat gaagacattt      1620
     caaagacaaa tttctcagga ggataaaaat tgggagcaaa acattcagga gctacaaaag      1680
     aagcacagga taaccgacag ggtcctgttg gtgaagtgtg tctctgtcct tgttgtggtg      1740
     atctttgtgt tctttctcaa ctccttcatt cccagcattc atctggatct tgggtggatt      1800
     gccatcctgg gtgccctttg gctactggtt ctggccgaca tccaggactt tgagatcatc      1860
     ttgcaccggg tggagtgggc cacactcttg ttttttgccg gtctctttgt tttgatggag      1920
     gcaatagctc agctgcagct catcgatttc attggtgagc aaacggcgct tctgataaaa      1980
     gcggtgccag aagaccagcg gctggccatt gcaatcattt tagtgatgtg ggtctctgct      2040
     ctggcttcct ctctcatcga caacattccc ttcactgcca ccatgattcc agttctcatt      2100
     aacctgagtc aggactctga tgtgaacctt ccagtaaaac ctctcatctt tgctttggcc      2160
     atgggagcct gtcttggggg aaacggtacg ctgatcggag catcagccaa tgttgtttgt      2220
     gcaggaatcg ctgaacaaca cggatatggc ttttccttta tggagttctt caagttgggg      2280
     ttccccatga tgataatgac atgtatgatc gctatgtgct acctgctggc cactcacgtc      2340
     ggccttggct ggaacatgtg aaccctgctg ctgctcagag ccaaagtgtg tgtatgggtg      2400
     cgtgagcgtg cacgtggcca ctgcgacagc ctcagctcac tgtaacatgc tgtgtaacct      2460
     gagaaactga tcagattaca gcatgaggca ctgtaactac atttttataa gcatggagcg      2520
     gcgctcccag tgaagtgtgg accatcaggg accagattca aaggagtctt gaaaaaaata      2580
     acttattcca cactggtgtt catggtgcta cagtcagtga ttacagcgat aatctctgac      2640
     cccattcttc ttcagattta gatgatctgt tcatataaaa agcagattat cttttcttta      2700
     tctttagaca tttaccatcc ctttaatatt aaaaaaagac caacagaaag ggattttttt      2760
     aaaacaacta atgtctctag ttcttaatta gatccccggt taaaaataag cataaattaa      2820
     cctgactcaa aaactgactt actgtagtta gtcatgctaa gtacagaagg agtcattcat      2880
     catgaaaaca gctgtaaatg agatgaacag ctgtttgaca ttacaaattt aattctgttt      2940
     tctgtatcaa ctctaccccc tgctgaatgt aacattcagt cactttcatg aacaataaag      3000
     actgtcatgt cgctggactt tattgtaaaa aaaaaaaaaa aa                         3042
//

If you have problems or comments...

PBIL Back to PBIL home page