(data stored in ACNUC23405 zone)

EMBL: AY679104

ID   AY679104; SV 1; linear; genomic DNA; STD; VRT; 5318 BP.
XX
AC   AY679104;
XX
DT   01-AUG-2006 (Rel. 88, Created)
DT   01-AUG-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Danio rerio homeodomain protein 9 gene, partial cds.
XX
KW   .
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-5318
RA   Devos N.I., Meyer D., Wendik B.;
RT   "In vivo observation of pancreatic beta cell migration";
RL   Unpublished.
XX
RN   [2]
RP   1-5318
RA   Devos N.I., Meyer D., Wendik B.;
RT   ;
RL   Submitted (07-JUL-2004) to the INSDC.
RL   CBIG, University of Liege, Allee du 6 Aout, Liege-Sart-Tilman 4000, Belgium
XX
DR   MD5; 8c98678ca322b7d7eeb67b6f4bf2daad.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5318
FT                   /organism="Danio rerio"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:7955"
FT   mRNA            join(3015..3599,4743..4903,5098..>5318)
FT                   /product="homeodomain protein 9"
FT   CDS_pept        join(3101..3599,4743..4903,5098..>5318)
FT                   /codon_start=1
FT                   /product="homeodomain protein 9"
FT                   /note="Hb9"
FT                   /db_xref="GOA:Q0VIL4"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VIL4"
FT                   /db_xref="ZFIN:ZDB-GENE-040409-1"
FT                   /protein_id="AAT90340.1"
FT                   /translation="MEKSKNFRIDALLAVDPPKVQTSPLALVTSLPTSSISSSSDSVQA
FT                   VELTTNSDALQTESPSPPRISSCGLIPKPGFLNSPHSGMVGLHPQSSTGIPPQALYGHP
FT                   MYTYSAAALGQHPALSYSYPHGSHHHHHPSDPLKLTASSFQLDHWLRVSTAGMMLPKMA
FT                   DFNGQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVK
FT                   IWFQNRRMKWKRSKKAKEQAAQDAEKQRGKGNHDKMDGLEKDYQKVDSGKSNRIRDFRD
FT                   SDDEEGDNYMLNS"
XX
SQ   Sequence 5318 BP; 1714 A; 974 C; 1001 G; 1609 T; 20 other;
     gaattcattt aaattagcct ggcatctgga catcgtcaat cacgggctcg tgacaccgag        60
     aggggactcg tgggtcatct cgtttaaagc gcattttaaa ttacaccagc cactgaattg       120
     tgtgtattca tcacattagt gtgtaccagt gtgttcggtt aagtaacacc tggttttcgg       180
     gctggttcat cagtttgttt ggtccagtga atcacttaag agataatcag gcttatcaaa       240
     gcaaactgag gaaaacgctt tcgactacag aaggactttt gtattatgca atgttttcaa       300
     aaaaatatct tcatattcag tgtgggagat aataagaaag gaaaaagcat gaagcactga       360
     atcggtgtcc tttaatgact tttatagttg ggaacaatta gccgttctcc acaaattaaa       420
     ttgataaaaa gattacgaga cccaaatgcg tttaaaagct gtggtacgca cggcccattt       480
     gtgcaattat gatcgaaaat atttattgca ataaaagaga cagtgcaggt cccgttaaat       540
     tggcttttca taatgaacac atttaacatg gataattaat atataaacta tttcgatttg       600
     tcacgatgat atgtgttgca cttaattgtg aaagtaatta ccgagcgaat gaacatcttt       660
     gaggagagtc cctggtttca ggccctcgta tcatcgggtg caataataat tttactctct       720
     cctgatgtga tgaaaaagag ccataaatct ctcagatcgc tgcaggtcca cggcttcata       780
     tttcaccgct gctttaatag aaatattcat gcgatccctt aatgaaatta aaactgagaa       840
     gcggacaaag cggccctagg ctatgtgcag cgtgtaaaga cacaagagca tttgattggg       900
     aaaatgttgc atccttcaaa tatgaggatg ttgttgcact gtaaaccacg taaaacattt       960
     tttttcttac agtccagtat tggccacact tgataattgt tacatttgtt atcaattaca      1020
     cgcgaggctc attgaatgtc atttcagaat tggtcagtgc atgcgtcatt acggcacgct      1080
     gttattctca tcctttcggc cggtgacttg ttgatttccc tcgagcaaat aaacgcatgc      1140
     gaccagtctc tcgagagtgg ttagctgatg aattgaggaa aactaatccg ctttattggt      1200
     agacaggtta agggcaacag agtgtcaata attctctccc tgacctcttt ctccattagc      1260
     ttaaagaggc ttataagagg aacagacccc acaacatgac acccgatcct ccacatcacc      1320
     atctcacatg tagccaacct aggcttggaa aatcatttcg atttataaag ctcaagatcc      1380
     aacatttgcc aaaaattcat gaaaacaggg cacaaatagg gcatcatttt ctcacaaagt      1440
     attatatagg cctaattaga tagatagata gatagataga tagatagata gatagataga      1500
     tagatagata gatagataga tagatagata gatagataga tagatagata gatagataga      1560
     tagatagata gatagataga tagatagata gatagataga tagatagata gatagmcaga      1620
     tagatagata gaaaaaaaac aagattttgc ttgtgattca ttatgcataa taatttgcct      1680
     atgtttatta ataaacatcg tgttaggatt ataaatgtgt tgtgatgaat gtgattaaat      1740
     gtttaaatat ttactgacag ttgttagcct atatttacag atgtaaaaaa tctacgtcta      1800
     attagtatgt gtttcttaaa tctataataa ggaaaggctt attaagttta tctgtacaat      1860
     ttagancaat tttacgaatt tatcctttag agaaaaanaa tgtaataaca ccatatttaa      1920
     atatcctgtt gagaaattat taaatcaaat ttttacattc taagagcaag gttaaatatt      1980
     gagtgaaagg ttgaattgtt tttaagacag ttgttttatt tttttaagca tattgtggtg      2040
     ggtgagtttt caaagattta cacatttcaa acaatttatt aaaacaatat ttgttgcata      2100
     aaacactgat tggtcagttt taccccgact ttaacttatt tatttaatta gctatattct      2160
     tattgttcat tgttattaaa cttttgccta cctaatgctc tctaacaaat aaggaataac      2220
     gtgaatsttt ccdccgcgca aaatgttcat cgtaatgtaa aagatccgtt tgmcstttaa      2280
     aatggttnct cttctcataa agatagtdat tcttttaaga actgtcctct agaaggttct      2340
     ttagggaaac aaaaaatata cgtgtacatc aatgtgaaaa tcaaatagtt ttttttatta      2400
     ttgcaggctg ttcagataaa aaatacaatt gaataaaaaa gtatggacat taaatagcaa      2460
     aatgacaaat gcgtgtatag actatgttat tttgttaatt catttgatga aataaaaaaa      2520
     aattatacaa atgaaaaaat gtcatgcctc tacatctatg cgaataaaaa gcatggctgt      2580
     tttttttttt tttttttttg gtcaaacaaa ctatttcgcc aaaataatat tttcgagtta      2640
     acatgcttta tcaatcttcg tttatattaa gattataggt cagtgtttaa ataatgaaat      2700
     cttgataact ttataaatgt ttcatgtttc aaagttgcat gttaataatt gcccttagac      2760
     tctacaaatc tggaattatt cataaattaa gtagatgtaa aatctatgtg tgcatgttgt      2820
     gtttcccact taaaaagctt tcattttatg ggagaacata cttatgacaa ctcttgaact      2880
     tctacaagca caccgtgaac actggaatca ctgtccaatc ggaaatgcac aaggatgacg      2940
     tgaatgacca atccactccc tctcgggcag cagttgacaa gtggacttct ggcttgcaca      3000
     ccttggccaa gatcataact ttacgaagag gagcggtgac actcctgaca gccttttaaa      3060
     gttacgaacg aggcgttaat ctgtttgtga ggtgggccag atggagaaat ctaaaaactt      3120
     tcggatcgac gcgcttctgg ctgtcgatcc accaaaagtg cagacctcgc cgctggcgct      3180
     ggtcacctcc ctgcccacct catccatatc ctcctcttcc gacagcgtcc aggcggtgga      3240
     gctgaccacg aactccgacg cactccagac agagtctcca tcgccaccca ggatatcgtc      3300
     ttgcggcttg attcccaaac cgggtttcct gaactctcca cattcgggca tggtcggact      3360
     acaccctcag agcagtaccg ggattcctcc tcaggctctc tacggtcacc caatgtacac      3420
     gtattcagca gcagcgctcg gtcagcaccc ggcgctctcg tactcatacc cgcacggttc      3480
     ccaccatcat caccatccca gcgaccccct caaactcaca gccagctcct ttcagctcga      3540
     ccactggctg agggtctcca ccgccggaat gatgctgcct aaaatggcag atttcaatgg      3600
     tgagtaccaa ttgactttca ttaataatat ttgtttttgt tattattaat aataataata      3660
     atattagtag tagtatattg acatttttat acgctacaag tttccatttt atttgtgctt      3720
     aaaaagtgta tttttgaaca ctaattttga acaattaaca tttaacaatt ggcctactga      3780
     tttatgctgc tgtatcatga tgtaaataaa aataatcata ttagatttga gcccctaaac      3840
     cataaatact gcactgggcc tgttcagtca gatctagcaa gcgcgtgcag agtcagtaaa      3900
     gctgttctct gactgagact gaacgagcac tctctttcaa agaggggcta aaatggacag      3960
     ataatggaca gagggaaagt ggcggacgag tgtgaaaacc acagcctgcc aactgtgtac      4020
     actgcagaca cagtctctct gttccgctgc tcgtctgcag attttctcaa agctctccca      4080
     aacaaatcag atagggtgga aatgttacca gatgtactga caatgccgtg gcacatagag      4140
     ggtatgtgtg attgggaata ggtcctttaa gactaaagat tttaacattt cttgccgtgc      4200
     cattatgttt ctttaaattc tttgtgagtg tagtgtaaaa tccacagtgg ttcagcaatg      4260
     tactgttaca cggctgctag gcctatacat aaataaattg ataaaaaacg cagcctgcat      4320
     gcatttacac tgtttgtgcc attctcmaga aaatattcct atatnacatt tcgatatact      4380
     gdggtdattc accgaatata tdaatttttt tcagatcaaa tgtcctcttc ctgtttttat      4440
     ttttgctagg tttaatctag tgctagacgt tgcatagcta taatttgctt ctgaatttac      4500
     attcgtttac cgaaagaact ggtaagaact gtacaataaa aaaaaatccc tgaacttaaa      4560
     atgttgtaaa atatatcaat tttggttcta aatagaattt gcggatggat tccctaaaac      4620
     attaataaat aattttaaaa aaattatttc ttatagaggt atggaagtct caatttgcta      4680
     aactggctaa agtgttgtcc tgtgtaaaat gtgcagtttt gtttttaaaa ttctccatgc      4740
     aggccaggcg cagtcgaact tactcggcaa gtgcagaaga ccaagaactg cattcacaag      4800
     ccagcagctc cttgaacttg agcatcagtt taagctgaat aaatatctat ccagaccaaa      4860
     acgctttgaa gtggccacgt cattgatgct aacagagacg caggtaaacy tttcttttaa      4920
     cgcatcgcct gaccagtcta ttttgtctaa tttgttcaaa acaagccsca tattttctac      4980
     aataaaaaaa agcttcaaaa tgaaccrtga cagattaaca aaggycgart aatgccagtt      5040
     tcaattaatt gtgaattaat aaacgcaatg tgcgtaatgt tttttataaa antacaggtg      5100
     aaaatctggt ttcagaacag gcgcatgaaa tggaagcgca gtaaaaaggc caaagaacaa      5160
     gccgctcaag atgccgagaa gcaaagggga aaaggaaacc acgacaaaat ggacggactg      5220
     gaaaaggact accagaaggt agattcaggg aaaagtaaca gaatacggga ctttagggac      5280
     agtgacgacg aagaaggaga taactatatg ctgaattc                              5318
//

If you have problems or comments...

PBIL Back to PBIL home page