(data stored in ACNUC16935 zone)

EMBL: AY684128

ID   AY684128; SV 2; linear; mRNA; STD; PLN; 118 BP.
XX
AC   AY684128;
XX
DT   28-AUG-2004 (Rel. 81, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Vitis vinifera polyubiquitin mRNA, partial cds.
XX
KW   .
XX
OS   Vitis vinifera (wine grape)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; Vitales; Vitaceae; Viteae; Vitis.
XX
RN   [1]
RP   1-118
RA   Carvalho M.B., Caeiro A.S., Price C.B., Teixeira A.R., Ferreira R.B.;
RT   ;
RL   Submitted (12-JUL-2004) to the INSDC.
RL   Plant Biochemistry II, ITQB, Apartado 127, Oeiras 2780-901, Portugal
XX
DR   MD5; efe31230b3e2f6e9ffb5093c29b49553.
XX
CC   On Sep 1, 2004 this sequence version replaced gi:51493589.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..118
FT                   /organism="Vitis vinifera"
FT                   /cultivar="Moscatel"
FT                   /mol_type="mRNA"
FT                   /tissue_type="leaf"
FT                   /note="authority: Vitis vinifera Lineu"
FT                   /db_xref="taxon:29760"
FT   CDS_pept        <1..>118
FT                   /codon_start=1
FT                   /product="polyubiquitin"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q66N71"
FT                   /protein_id="AAU09789.1"
FT                   /translation="IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK"
XX
SQ   Sequence 118 BP; 34 A; 27 C; 29 G; 28 T; 0 other;
     atctttgctg gaaaacagct tgaggatggc cggaccttgg cagattacaa cattcagaaa        60
     gagtccaccc tccacttggt cctccgcctg agaggtggaa tgcaaatatt tgtaaaga         118
//

If you have problems or comments...

PBIL Back to PBIL home page