(data stored in ACNUC12215 zone)

EMBL: AY699712

ID   AY699712; SV 1; linear; mRNA; STD; VRT; 2097 BP.
XX
AC   AY699712;
XX
DT   01-AUG-2005 (Rel. 84, Created)
DT   01-AUG-2005 (Rel. 84, Last updated, Version 1)
XX
DE   Gallus gallus XK-related protein 1 (XRG1) mRNA, complete cds.
XX
KW   .
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-2097
RA   Huang C.-H., Chen Y.;
RT   "A superfamily of XK-related genes (XRG) widely expressed in vertebrates
RT   and invertebrates";
RL   Unpublished.
XX
RN   [2]
RP   1-2097
RA   Huang C.-H., Chen Y.;
RT   ;
RL   Submitted (27-JUL-2004) to the INSDC.
RL   Biochemistry and Molecular Genetics, New York Blood Center, 310 East 67th
RL   Street, New York, NY 10021, USA
XX
DR   MD5; 75f3936dc34bfa80ed3be148a937fd52.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2097
FT                   /organism="Gallus gallus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9031"
FT   gene            1..2097
FT                   /gene="XRG1"
FT   CDS_pept        70..1401
FT                   /codon_start=1
FT                   /gene="XRG1"
FT                   /product="XK-related protein 1"
FT                   /note="similar to Homo sapiens XK-related gene 1"
FT                   /db_xref="GOA:Q49M61"
FT                   /db_xref="InterPro:IPR018629"
FT                   /db_xref="UniProtKB/TrEMBL:Q49M61"
FT                   /protein_id="AAU94447.1"
FT                   /translation="MKFPGSVLISLVLFVAETATALCLSGAYRAAGDRMWQWLTMLFAL
FT                   LPCALVQLSLVFIHRDVSRDRPLVLLLHLLQLGPLVRCVEVFYIYFHAGRVEEPYVSIT
FT                   KKRQMPKDGYSEEVEKEVGQAEGKLCTHRSAFSRASVIQAFLGSAPQLTLQLYICVLQQ
FT                   EITAARSIFMVLSLLSIVYGALRCNILAIKIKYDDYDVSVKPAAYLCIFMWRSFEIATR
FT                   VTVLVLFSSVLQIWTLPVVLVNFFGFFFYPWILFWQSKSPFPENIEKALSRVGTTIVLC
FT                   LLTFLYAGINMFCWSAVQVKLNDPDLINKSQNWYRLTVYYMLRFIENAFLLLMWYIYRT
FT                   DIYLYVCAPLLVLQLLIAYCMAILFMLVFYQFCHPCKKLFSSSITEGLLSSFTFCFVCK
FT                   SPKSSTLTDKADLKSSENADESQSSNKTIDSPNGNPHQSVSSNA"
XX
SQ   Sequence 2097 BP; 498 A; 492 C; 497 G; 610 T; 0 other;
     agcgggcgcc gccggcactc ggctgggcgc gccgggccgc ggcgcgtgag gcggctgcgg        60
     cgggcggcga tgaaattccc gggctccgtc ctcatctccc tcgtcctctt cgtggccgag       120
     acggcgaccg cgttgtgcct gagcggcgcg taccgggcgg cgggcgaccg catgtggcag       180
     tggctgacga tgctcttcgc cctgctgccc tgcgctctgg tccagctcag cttggtcttc       240
     atccaccgcg acgtgagccg cgaccgaccg ctggtgctgc tgctgcacct gctgcaattg       300
     ggaccgctag tcaggtgtgt ggaagtcttc tacatttact tccatgccgg cagagttgaa       360
     gagccctatg tcagcatcac aaagaagaga cagatgccca aggatgggta ctcagaagaa       420
     gttgagaagg aagtgggcca ggctgaaggc aagctgtgta cccacaggtc tgcgttcagc       480
     agggcctctg tgatccaggc attccttggc tcagcgccgc agctcacact ccagctctac       540
     atctgcgtcc tgcagcagga gatcacggct gccagaagta tttttatggt cctttctctt       600
     ctttcaattg tatacggcgc cttacgctgc aacatcttgg ctattaagat taagtacgat       660
     gattatgacg tcagtgtgaa accagctgcc tacctctgca tattcatgtg gagaagcttc       720
     gagattgcta cacgcgttac agtgttggtc cttttcagct cagtccttca gatctggact       780
     ctccctgttg tgctagtgaa tttctttggt tttttctttt acccatggat tctcttctgg       840
     caaagcaagt ccccatttcc tgagaacata gagaaggcat tgagcagggt cggcactacc       900
     attgtcttgt gccttcttac cttcttgtat gcaggcatta atatgttctg ctggtcggca       960
     gtacaggtga agctcaatga tcctgactta attaacaaat cccaaaattg gtaccgattg      1020
     actgtgtatt atatgctgag attcatcgag aatgcattcc tcctgctgat gtggtacatc      1080
     tatagaactg atatctactt atatgtctgt gccccattgt tggtcttgca gctcctgata      1140
     gcttactgta tggctatcct cttcatgttg gtgttctacc aattctgcca cccatgcaag      1200
     aaactgttct catccagcat taccgaaggt ttgttgtcct ctttcacgtt ctgctttgtt      1260
     tgcaagtctc ccaaatcctc caccctgaca gacaaggcgg atttgaaatc atctgaaaat      1320
     gctgacgaat cacagagcag taacaagaca atagattctc caaatgggaa tcctcatcaa      1380
     agtgtttctt ccaatgctta gttcaactgg aagcaagcct gtgcctttgg aacgtggcac      1440
     atcagctcct gggaatgttg ggcttcatgg atattgtgtc ttgtacatgg gatttctttc      1500
     ttgcaggtgt acactgcatg acaagtgaca agcctacctt tgtggaaaac tttatgtttg      1560
     ggtatgtgta cctgactgtg tgtatggaca tagagagcag tcattgtaga cttctgtttc      1620
     agatttttat ttttgcacat aggtttatta tcatgtacct attttgaaat cattatagaa      1680
     gacatccttt aaaaactagc ctgattctca tctaactcag gaaatctgag gatggtagga      1740
     aatgcatttt atttcagaaa ggatgtcatt atggcatgtc accctcgcac agacacagag      1800
     catagtcttt gactataaac tgactatagc tgtggtctgc tttgattgaa ttggagacta      1860
     ctttacactc taatcaacgt gataaaataa tgcttctctc tgtggcaaaa gaattttact      1920
     tctacaatgc gcagtagcct gggttgccaa gaaaacagct aattagctaa tgctgaagtg      1980
     tgactgttac tgagagtgga cagaggggtt attggcttat gcactatttt acccttcata      2040
     tttgctgctt gttactaagg gaattaaatt taacacagta aaaaaaaaaa aaaaaaa         2097
//

If you have problems or comments...

PBIL Back to PBIL home page