(data stored in ACNUC13479 zone)

EMBL: AY735577

ID   AY735577; SV 1; linear; mRNA; STD; PLN; 1119 BP.
XX
AC   AY735577;
XX
DT   26-SEP-2004 (Rel. 81, Created)
DT   26-SEP-2004 (Rel. 81, Last updated, Version 1)
XX
DE   Arabidopsis thaliana hypothetical protein AT2G18770 mRNA, complete cds.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1119
RA   Xiao Y., Underwood B., Moskal W., Wang W., Redman J., Wu H.C.,
RA   Utterback T., Town C.D.;
RT   "Reconstruction of cDNA sequences for hypothetical genes in Arabidopsis
RT   thaliana from 5' and 3' RACE products";
RL   Unpublished.
XX
RN   [2]
RP   1-1119
RA   Xiao Y., Underwood B., Moskal W., Wang W., Redman J., Wu H.C.,
RA   Utterback T., Town C.D.;
RT   ;
RL   Submitted (26-AUG-2004) to the INSDC.
RL   Plant Genomics, The Institute for Genomic Research, 9712 Medical Center
RL   Drive, Rockville, MD 20850, USA
XX
DR   MD5; 6739f9f82df3a2078f2c6c9ffeb2a11e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1119
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="2"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        116..898
FT                   /codon_start=1
FT                   /product="hypothetical protein AT2G18770"
FT                   /db_xref="GOA:Q5XVE5"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XVE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAU44447.1"
FT                   /translation="MDNLEDLKIVAEQWSKQGLEFVQKIPPPQLYTAIGVLLLATIWLL
FT                   SIRLFRRTKSDTVLLSGLSGSGKTVLFYQLRDGSSHQGAVTSMEPNEGTFVLHNENNTK
FT                   KGKVKPVHLIDVPGHSRLISKLEEYLPRAAAVVFVVDALEFLPNIRAASEYLYDILTNA
FT                   SVIKNKTPVLLCCNKTDKVTAHTKEFIRKQMEKEIDKLRVSRSAISTADIANDFTLGIE
FT                   GEVFSFSHCHNKVTVAEASGLTGETDQVQEFIREHVKP"
XX
SQ   Sequence 1119 BP; 360 A; 223 C; 226 G; 308 T; 2 other;
     acaaataaca acaacaattt cgccggcgtc gtcgtcgtcg tctctccatc accgtctctg        60
     ctgcattgat tcgcagcact gagtcctaaa tttccagtgt aaaaaaaatc agaaaatgga       120
     caacttggaa gatttgaaga ttgtggcaga gcagtggtct aaacaaggac ttgaatttgt       180
     tcaaaaaata ccaccacctc agctttatac tgccattggt gttctcttat tagctaccat       240
     ttggctctta tctattcgtt tgtttagacg tacaaaatcc gatactgtac tcctctctgg       300
     gctaagtgga agtggcaaaa cagttctctt ctatcaacta cgagatggat cttcccatca       360
     gggtgctgta acgtcaatgg aaccgaacga aggcaccttt gtgcttcaca atgaaaacaa       420
     cactaagaaa ggaaaagtaa agcctgttca tcttattgat gttcctggac actctcggct       480
     tatatctaag ctagaagaat acttgcctcg agccgccgct gttgtgtttg tagtagatgc       540
     attggagttc ctcccaaata tccgggcagc ttcagagtac ctttacgaca ttctgaccaa       600
     tgctagcgtt attaagaata agaccccggt tctgctttgc tgtaacaaga cagataaagt       660
     aactgcacac accaaagagt tcatccgcaa gcagatggag aaagaaatag ataaacttag       720
     ggtttcgagg agcgcaatat caacagctga tatagcgaat gacttcactc ttgggattga       780
     aggagaagtg ttttcctttt cgcattgcca taacaaagtc acggtcgctg aggcgtctgg       840
     actaacagga gaaacagatc aggtacaaga gttcatcaga gaacacgtaa agccatgagg       900
     attgtgtaag catctcagag aatgtactta aatgtctttt catttgtttg taaatgaaat       960
     tataatttga gaacttagat gatattcgtt ggaaggattt ttggatgttg aaaacgtgtt      1020
     tacygcatcg actggatctt ttagcgtttc atccaagcaa cctcactatc aataaattgt      1080
     ttacaaagkc aaaaaaaaaa aaaaaaaaaa aaaaaaaaa                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page