(data stored in ACNUC5340 zone)

EMBL: AY745229

ID   AY745229; SV 1; linear; mRNA; STD; INV; 319 BP.
XX
AC   AY745229;
XX
DT   10-OCT-2004 (Rel. 81, Created)
DT   31-JAN-2007 (Rel. 90, Last updated, Version 3)
XX
DE   Anopheles gambiae glutaredoxin (GRX1) mRNA, partial cds.
XX
KW   .
XX
OS   Anopheles gambiae (African malaria mosquito)
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Holometabola; Diptera; Nematocera; Culicoidea; Culicidae;
OC   Anophelinae; Anopheles.
XX
RN   [1]
RP   1-319
RX   DOI; 10.1073/pnas.0409348102.
RX   PUBMED; 15753317.
RA   David J.P., Strode C., Vontas J., Nikou D., Vaughan A., Pignatelli P.M.,
RA   Louis C., Hemingway J., Ranson H.;
RT   "The Anopheles gambiae detoxification chip: a highly specific microarray to
RT   study metabolic-based insecticide resistance in malaria vectors";
RL   Proc. Natl. Acad. Sci. U.S.A. 102(11):4080-4084(2005).
XX
RN   [2]
RP   1-319
RA   Ranson H., David J.P., Strode C., Vontas J., Nikou D.;
RT   "A microarray for studying metabolic resistance to insecticides in malaria
RT   vectors";
RL   Unpublished.
XX
RN   [3]
RP   1-319
RA   Ranson H., David J.P., Strode C., Vontas J., Nikou D.;
RT   ;
RL   Submitted (10-SEP-2004) to the INSDC.
RL   Vector Research Group, Liverpool School of Tropical Medicine, Pembroke
RL   Place, Liverpool, Merseyside L3 5QA, UK
XX
DR   MD5; d6c549eedd735c68f741b9406e398af0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..319
FT                   /organism="Anopheles gambiae"
FT                   /mol_type="mRNA"
FT                   /dev_stage="larva"
FT                   /db_xref="taxon:7165"
FT   gene            <1..319
FT                   /gene="GRX1"
FT   CDS_pept        <1..171
FT                   /codon_start=1
FT                   /gene="GRX1"
FT                   /product="glutaredoxin"
FT                   /db_xref="GOA:Q5XNS6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XNS6"
FT                   /protein_id="AAU93509.1"
FT                   /translation="CYELDKRNDGDEIQSVLGELTGARTVPRVFIGGNFVGGGTDIKKM
FT                   YDDGRLQKMLA"
XX
SQ   Sequence 319 BP; 77 A; 81 C; 85 G; 76 T; 0 other;
     tgctacgagc tggacaagcg taacgatggt gacgagattc agtccgtcct cggcgagctg        60
     accggtgccc gcacggtgcc gcgcgtgttc attggcggca attttgtcgg tggcggtacc       120
     gacatcaaga agatgtacga cgacggtcgg ttacagaaaa tgttggccta aaaccaccac       180
     tatccgctcg aagccgcttt ctactcttcc attcttccag ccgtgtaagc gtgtaaaagt       240
     gtaaagacaa accgcgtttt attaagactc tctctgttgc aaaggaatcg ttctgttcgt       300
     ggggccgaag cacaataaa                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page