(data stored in ACNUC23119 zone)

EMBL: AY751082

ID   AY751082; SV 1; linear; genomic DNA; STD; PRO; 363 BP.
XX
AC   AY751082;
XX
DT   13-OCT-2004 (Rel. 81, Created)
DT   04-JUN-2005 (Rel. 84, Last updated, Version 3)
XX
DE   Acidithiobacillus ferrooxidans ATCC 23270 galactose-1-phosphate
DE   uridylyltransferase-like gene, partial cds.
XX
KW   .
XX
OS   Acidithiobacillus ferrooxidans ATCC 23270
OC   Bacteria; Proteobacteria; Acidithiobacillia; Acidithiobacillales;
OC   Acidithiobacillaceae; Acidithiobacillus.
XX
RN   [1]
RP   1-363
RX   DOI; 10.1128/AEM.71.6.2902-2909.2005.
RX   PUBMED; 15932984.
RA   Barreto M., Jedlicki E., Holmes D.S.;
RT   "Identification of a gene cluster for the formation of extracellular
RT   polysaccharide precursors in the chemolithoautotroph Acidithiobacillus
RT   ferrooxidans";
RL   Appl. Environ. Microbiol. 71(6):2902-2909(2005).
XX
RN   [2]
RP   1-363
RA   Barreto M., Jedlicki E., Holmes D.S.;
RT   ;
RL   Submitted (14-SEP-2004) to the INSDC.
RL   ICBM, Universidad de Chile, Independecia 1027, Santiago, RM, Chile
XX
DR   MD5; 131aa83dbc7b158bfff7306d7e41e3dc.
DR   EuropePMC; PMC1151869; 15932984.
DR   StrainInfo; 102548; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..363
FT                   /organism="Acidithiobacillus ferrooxidans ATCC 23270"
FT                   /strain="ATCC 23270"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:243159"
FT   CDS_pept        1..>363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="galactose-1-phosphate uridylyltransferase-like"
FT                   /note="UTP transferase; similar to GalT; complements galT
FT                   mutant in E. Coli (S491); exhibits GalT activity in vitro;
FT                   lacks pfam01230 domain including histidine triad that is
FT                   characteristic of GalT family"
FT                   /db_xref="GOA:Q5XLV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XLV9"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAV27211.1"
FT                   /translation="MSIRPALTSDGKPADPITKDWIDQIADAIRKRCGKYPRMRMYAYR
FT                   NNGTDYLAMDFDPTEPEIRGGFSITMSVSGQDKVSLELPKKGEFEIVPGVTDWVDAMTL
FT                   ANLLCQSLVAWTEFNPV"
XX
SQ   Sequence 363 BP; 88 A; 88 C; 105 G; 82 T; 0 other;
     atgagtattc ggcccgctct gacatccgac ggtaagcccg cagatcccat cacaaaggac        60
     tggatcgacc agattgcgga cgctatccga aagcgatgtg gcaagtatcc gcgtatgcgg       120
     atgtacgcct atcgcaataa cgggacggat tatctggcaa tggattttga tccgacagag       180
     ccggagatcc gtggaggatt ctccatcacc atgagcgttt ccggtcagga caaagtgagt       240
     ctggaattgc caaagaaagg agagtttgag attgtccccg gggtgacgga ctgggtggac       300
     gctatgactc tcgccaatct gctctgtcag tctctagtgg cttggaccga gtttaatcca       360
     gta                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page