(data stored in ACNUC8465 zone)

EMBL: AY865555

ID   AY865555; SV 1; linear; mRNA; STD; VRT; 579 BP.
XX
AC   AY865555;
XX
DT   22-APR-2005 (Rel. 83, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Danio rerio ras-like protein Rhoaa mRNA, partial cds.
XX
KW   .
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-579
RX   DOI; 10.1016/j.ygeno.2005.03.010.
RX   PUBMED; 15894457.
RA   Salas-Vidal E., Meijer A.H., Cheng X., Spaink H.P.;
RT   "Genomic annotation and expression analysis of the zebrafish Rho small
RT   GTPase family during development and bacterial infection";
RL   Genomics 86(1):25-37(2005).
XX
RN   [2]
RP   1-579
RA   Salas-Vidal E., Meijer A.H., Cheng X., Spaink H.P.;
RT   ;
RL   Submitted (22-DEC-2004) to the INSDC.
RL   Molecular Biology, Institute of Biology, Leiden University, Wassenaarseweg
RL   64, Leiden, Z.H. 2333 AL, The Netherlands
XX
DR   MD5; b61be053f52b668732de5aea21893da4.
DR   Ensembl-Gn; ENSDARG00000026845; danio_rerio.
DR   Ensembl-Tr; ENSDART00000040645; danio_rerio.
DR   Ensembl-Tr; ENSDART00000177931; danio_rerio.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..579
FT                   /organism="Danio rerio"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:7955"
FT   CDS_pept        1..>579
FT                   /codon_start=1
FT                   /product="ras-like protein Rhoaa"
FT                   /db_xref="GOA:Q6NUX8"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NUX8"
FT                   /db_xref="ZFIN:ZDB-GENE-040426-2150"
FT                   /protein_id="AAX20127.1"
FT                   /translation="MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVAD
FT                   IEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVK
FT                   HFCPNVPIILVGNKKDLRNDEHTRRELQKMKQEPVKPEEGRDMANRINAFGYLECSAKT
FT                   KEGVREVFEMATRAALQAKKRGKKNACALL"
XX
SQ   Sequence 579 BP; 170 A; 120 C; 156 G; 133 T; 0 other;
     atggctgcga ttcgtaagaa gcttgtaatc gttggagatg gagcctgtgg aaagacgtgt        60
     ttactcatcg ttttcagtaa agaccagttt cctgaggttt acgttcccac agtgtttgag       120
     aactatgtcg ctgatattga ggtggattca aaacaggtgg aactggctct atgggataca       180
     gctggccaag aggactacga caggctgagg cccctgtcct acccagacac tgatgtcatc       240
     cttatgtgct tttccataga cagtcctgac agtttggaga acatcccaga gaaatggacg       300
     ccagaagtaa aacatttctg ccctaatgtt ccaataatac tggtgggtaa taaaaaagat       360
     ttacggaatg acgagcacac tcgacgggag ctgcagaaga tgaaacagga accagttaaa       420
     ccagaggagg gacgagacat ggctaatcgc atcaatgcct tcggctacct tgagtgttca       480
     gctaaaacta aggagggcgt gagggaagtg tttgaaatgg ccacaagagc ggcgctccaa       540
     gccaagaaac gtggcaagaa gaatgcctgc gctttgcta                              579
//

If you have problems or comments...

PBIL Back to PBIL home page