(data stored in ACNUC8465 zone)

EMBL: AY865563

ID   AY865563; SV 1; linear; mRNA; STD; VRT; 564 BP.
XX
AC   AY865563;
XX
DT   22-APR-2005 (Rel. 83, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Danio rerio ras-like protein Rhoh mRNA, partial cds.
XX
KW   .
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-564
RX   DOI; 10.1016/j.ygeno.2005.03.010.
RX   PUBMED; 15894457.
RA   Salas-Vidal E., Meijer A.H., Cheng X., Spaink H.P.;
RT   "Genomic annotation and expression analysis of the zebrafish Rho small
RT   GTPase family during development and bacterial infection";
RL   Genomics 86(1):25-37(2005).
XX
RN   [2]
RP   1-564
RA   Salas-Vidal E., Meijer A.H., Cheng X., Spaink H.P.;
RT   ;
RL   Submitted (22-DEC-2004) to the INSDC.
RL   Molecular Biology, Institute of Biology, Leiden University, Wassenaarseweg
RL   64, Leiden, Z.H. 2333 AL, The Netherlands
XX
DR   MD5; 81082a8c266f4c573a82026a929a4305.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..564
FT                   /organism="Danio rerio"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:7955"
FT   CDS_pept        <1..>564
FT                   /codon_start=1
FT                   /product="ras-like protein Rhoh"
FT                   /db_xref="GOA:Q52WY5"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q52WY5"
FT                   /db_xref="ZFIN:ZDB-GENE-060228-7"
FT                   /protein_id="AAX20135.1"
FT                   /translation="TSVKCVLVGDCAVGKTALLVRFTSETFPDSYRPTVYENTGVDVFM
FT                   DGIQISLGLWDTAGHDTFRQIRPMSYQDADVVLLCYSVANPSSLNNLRHKWIAEVREYL
FT                   PKVPVLVVATQTDHREMGPYRANCTTSPEGKQVAQEIRAKGYLECSALSNRGVQQVFEC
FT                   AVRTAVNRARRQTRRRLLNLNPCKI"
XX
SQ   Sequence 564 BP; 149 A; 130 C; 152 G; 133 T; 0 other;
     acctcggtga aatgtgtact ggttggggac tgcgcagtgg gtaaaacggc acttctggta        60
     cggttcacct ctgaaacttt cccagatagc tacagaccta ctgtctatga gaacactgga       120
     gttgatgtct tcatggatgg aatccagatc agtttaggac tgtgggatac agcaggacat       180
     gatacattcc gccaaatccg gcccatgtcc tatcaagacg ccgatgtggt cttgctgtgc       240
     tattcagtag caaatccaag ttctttaaat aatttgcggc acaaatggat cgctgaggtg       300
     agggaatatc tgccgaaggt gccagtactg gttgttgcca cacagacaga ccatcgtgag       360
     atgggcccgt atcgtgctaa ctgcaccacg tccccagagg gcaagcaggt ggcacaggag       420
     attcgtgcca agggatatct ggaatgttcg gcccttagca atcgtggcgt acaacaggtt       480
     tttgagtgtg ctgtgcgaac agctgtaaat cgggcacgaa gacagacaag acgaagactg       540
     ctaaacctta acccctgtaa aatc                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page