(data stored in ACNUC8465 zone)

EMBL: AY879265

ID   AY879265; SV 1; linear; mRNA; STD; ROD; 1260 BP.
XX
AC   AY879265;
XX
DT   01-JUL-2005 (Rel. 84, Created)
DT   01-JUL-2005 (Rel. 84, Last updated, Version 1)
XX
DE   Rattus norvegicus mitogen activated protein kinase kinase 7 (Map2k7) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1260
RA   Itoh T., Horiuchi M., Itoh A.;
RT   ;
RL   Submitted (06-JAN-2005) to the INSDC.
RL   Neurology Research, The Children's Hospital of Philadelphia, Abramson
RL   Research Center Room 516-I, 3615 Civic Center Boulevard, Philadelphia, PA
RL   19104, USA
XX
DR   MD5; 2d4c741e971132b6315aef799e6f4132.
DR   Ensembl-Gn; ENSRNOG00000001047; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000061821; rattus_norvegicus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1260
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10116"
FT   gene            1..1260
FT                   /gene="Map2k7"
FT   CDS_pept        1..1260
FT                   /codon_start=1
FT                   /gene="Map2k7"
FT                   /product="mitogen activated protein kinase kinase 7"
FT                   /db_xref="GOA:Q4KSH7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4KSH7"
FT                   /protein_id="AAX61178.1"
FT                   /translation="MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQL
FT                   PLANDGGSRSPSSESSPQHPTPPSRPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTG
FT                   YLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVKQMRRSGNKEENKRI
FT                   LMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKM
FT                   TVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCA
FT                   AYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEP
FT                   PLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHYETLEVDVASWFKDVMA
FT                   KTESPRTSGVLSQHHLPFFR"
XX
SQ   Sequence 1260 BP; 319 A; 357 C; 346 G; 238 T; 0 other;
     atggcggcgt cctccctgga gcaaaagctg tcccgcctgg aggccaagct gaagcaggag        60
     aatcgtgagg cccgcaggag gatcgacctc aacctggata taagcccaca gcggcccagg       120
     cccaccttgc agctcccact ggccaacgat gggggcagcc gctcaccatc ctcagagagc       180
     tccccacagc accctacgcc ccccagccgg ccccgccaca tgctggggct cccgtcaacc       240
     ttgttcacac ctcgcagtat ggagagcatc gagattgacc aaaagctgca ggagatcatg       300
     aagcagacag ggtacctgac tatcgggggc cagcgttatc aggcagaaat caatgacttg       360
     gagaacctgg gagagatggg cagtggtacc tgtggtcagg tgtggaagat gcggttccgg       420
     aagacaggcc acatcattgc tgttaagcaa atgcggcgct cggggaacaa ggaagagaat       480
     aagcgcatcc taatggacct ggacgtagta ctcaagagcc acgactgccc ctacattgtt       540
     cagtgctttg gtaccttcat caccaacacg gacgtcttta ttgccatgga gctcatgggc       600
     acgtgtgcgg agaagctgaa gaaacggatg cagggcccca tcccagagcg aatccttggc       660
     aagatgaccg tggcgattgt gaaagcattg tactatctga aggagaagca tggggtcatc       720
     catcgtgatg tcaaaccctc caacatcctg ctggatgagc ggggtcagat caagctctgt       780
     gactttggca tcagtggccg ccttgttgac tccaaagcca aaacacggag tgctggctgt       840
     gctgcctata tggctcctga gcgcattgac ccgccagacc ccaccaagcc agactatgac       900
     atccgggccg atgtgtggag cctgggcatc tcactggtgg agctggcaac aggacagttc       960
     ccctataaga actgcaagac ggactttgag gtcctcacca aagtcctaca ggaagagccc      1020
     ccgctcctgc ctggtcacat gggcttctca ggggacttcc agtcatttgt caaagactgc      1080
     cttactaaag accacaggaa gagaccaaag tataacaaac tacttgaaca cagcttcatc      1140
     aagcactatg agacactcga agtggatgtc gcgtcctggt ttaaggacgt catggcaaag      1200
     accgagtccc caaggactag tggagtcctg agccaacacc atctgccctt cttcaggtag      1260
//

If you have problems or comments...

PBIL Back to PBIL home page