(data stored in ACNUC8465 zone)

EMBL: AY880882

ID   AY880882; SV 1; linear; mRNA; STD; ROD; 1194 BP.
XX
AC   AY880882;
XX
DT   01-JUL-2005 (Rel. 84, Created)
DT   01-JUL-2005 (Rel. 84, Last updated, Version 1)
XX
DE   Rattus norvegicus dual specificity mitogen-activated protein kinase kinase
DE   4 (Map2k4) mRNA, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1194
RA   Itoh T., Horiuchi M., Itoh A.;
RT   ;
RL   Submitted (07-JAN-2005) to the INSDC.
RL   Neurology Research, The Children's Hospital of Philadelphia, Abramson
RL   Research Center Room 516-I, 3615 Civic Center Boulevard, Philadelphia, PA
RL   19104, USA
XX
DR   MD5; 576e29c75b72c7da54ded9173016d1b8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1194
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10116"
FT   gene            1..1194
FT                   /gene="Map2k4"
FT   CDS_pept        1..1194
FT                   /codon_start=1
FT                   /gene="Map2k4"
FT                   /product="dual specificity mitogen-activated protein kinase
FT                   kinase 4"
FT                   /db_xref="GOA:Q4KSH6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KSH6"
FT                   /protein_id="AAX61181.1"
FT                   /translation="MAAPSPSGGGGSGGGGGTPGPIGPPASGHPAVSSMQGKRKALKLN
FT                   FANPPVKSTARFTLNPNTTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLG
FT                   EIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFY
FT                   GALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLK
FT                   IIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQG
FT                   YDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFIN
FT                   FVNLCLTKDESKRPKYKELLKHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD"
XX
SQ   Sequence 1194 BP; 350 A; 267 C; 295 G; 282 T; 0 other;
     atggcggctc cgagcccgag cggcggcggc ggctccgggg gcggtggcgg caccccgggg        60
     cccatcgggc ctccagcttc tggccacccg gcggtcagca gcatgcaggg taaacgcaaa       120
     gccctgaagt tgaattttgc aaatccacct gtcaaatcga cagcacggtt tactctgaat       180
     cctaatacca caggagtcca gaacccacac atagagagac tgagaaccca cagcattgag       240
     tcatcaggaa aactgaagat ctcccctgaa caacactggg atttcactgc agaggacttg       300
     aaagaccttg gagaaattgg acgaggagct tatggttctg tcaacaaaat ggtccacaaa       360
     ccaagtgggc agataatggc agttaaaaga atacgatcaa ctgtggatga aaaagaacaa       420
     aaacaacttc tcatggattt ggatgtagtg atgcggagta gtgattgccc atacattgtt       480
     cagttctatg gtgcactctt cagagagggc gactgttgga tctgtatgga gctcatgtct       540
     acctcgttcg ataagtttta caaatatgta tatagtgtgt tagatgatgt gatcccggaa       600
     gagatcttag gcaaaatcac tttagcaact gtgaaagcac taaaccactt aaaagaaaac       660
     ttgaaaatta ttcacagaga catcaaacct tccaatattc ttctggacag gagtggaaat       720
     ataaagctct gtgacttcgg catcagtgga cagctcgtgg actctattgc caagacgaga       780
     gatgctggct gtaggccgta tatggcacct gaaagaatag acccaagtgc atcaagacaa       840
     gggtatgatg tccgctctga tgtctggagt ttggggatca cattgtacga gttggccaca       900
     ggccgatttc cttatccaaa gtggaatagt gtatttgatc agctaacaca agtggtgaaa       960
     ggagaccctc cccagctgag taattccgaa gaaagggagt tctcccccag tttcatcaac      1020
     tttgtcaact tgtgccttac gaaggacgag tccaaaaggc caaagtacaa agagcttctg      1080
     aaacatccct ttattttgat gtatgaagaa cgtactgtag aggtcgcatg ctatgtttgt      1140
     aaaatcctgg atcagatgcc agctactccc agctctccca tgtatgtcga ctga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page