(data stored in ACNUC27125 zone)

EMBL: AY904364

ID   AY904364; SV 1; linear; mRNA; STD; HUM; 1452 BP.
XX
AC   AY904364;
XX
DT   14-DEC-2006 (Rel. 90, Created)
DT   31-MAY-2011 (Rel. 109, Last updated, Version 3)
XX
DE   Homo sapiens protein phosphatase 3 (PPP3CA) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1452
RX   PUBMED; 21647268.
RA   Landreville S., Lupien C.B., Vigneault F., Gaudreault M., Mathieu M.,
RA   Rousseau A.P., Guerin S.L., Salesse C.;
RT   "Identification of differentially expressed genes in uveal melanoma using
RT   suppressive subtractive hybridization";
RL   Mol. Vis. 17:1324-1333(2011).
XX
RN   [2]
RP   1-1452
RA   Landreville S., Salesse C.;
RT   ;
RL   Submitted (25-JAN-2005) to the INSDC.
RL   Unite de Recherche en Ophtalmologie, Centre de Recherche du CHUL,
RL   Universite Laval, 2705, Boulevard Laurier, Ste-Foy, Quebec G1V 4G2, Canada
XX
DR   MD5; 1af21d64c175887902cec54e2002f70e.
DR   Ensembl-Gn; ENSG00000138814; homo_sapiens.
DR   Ensembl-Tr; ENST00000323055; homo_sapiens.
DR   Ensembl-Tr; ENST00000394853; homo_sapiens.
DR   Ensembl-Tr; ENST00000394854; homo_sapiens.
DR   Ensembl-Tr; ENST00000512215; homo_sapiens.
DR   EuropePMC; PMC3107995; 21647268.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1452
FT                   /organism="Homo sapiens"
FT                   /chromosome="4"
FT                   /map="4q21-q24"
FT                   /mol_type="mRNA"
FT                   /cell_line="TP31"
FT                   /db_xref="taxon:9606"
FT   gene            1..1452
FT                   /gene="PPP3CA"
FT                   /gene_synonym="CALNA"
FT   CDS_pept        47..1411
FT                   /codon_start=1
FT                   /gene="PPP3CA"
FT                   /gene_synonym="CALNA"
FT                   /product="protein phosphatase 3"
FT                   /EC_number="3.1.3.16"
FT                   /note="calcineurin A alpha; alternatively spliced"
FT                   /db_xref="GOA:Q08209"
FT                   /db_xref="H-InvDB:HIT000386206.6"
FT                   /db_xref="HGNC:HGNC:9314"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="PDB:1AUI"
FT                   /db_xref="PDB:1M63"
FT                   /db_xref="PDB:1MF8"
FT                   /db_xref="PDB:2JOG"
FT                   /db_xref="PDB:2JZI"
FT                   /db_xref="PDB:2P6B"
FT                   /db_xref="PDB:2R28"
FT                   /db_xref="PDB:2W73"
FT                   /db_xref="PDB:3LL8"
FT                   /db_xref="PDB:4F0Z"
FT                   /db_xref="PDB:4Q5U"
FT                   /db_xref="PDB:5C1V"
FT                   /db_xref="PDB:5SVE"
FT                   /db_xref="PDB:6NUC"
FT                   /db_xref="PDB:6NUF"
FT                   /db_xref="PDB:6NUU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08209"
FT                   /protein_id="AAY17314.1"
FT                   /translation="MSEPKAIDPKLSTTDRVVKVCGDIHGQFFDLMKLFEVGGSPANTR
FT                   YLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYS
FT                   ERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDI
FT                   LWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYR
FT                   MYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMD
FT                   VFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMA
FT                   RVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHK
FT                   ITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ"
XX
SQ   Sequence 1452 BP; 410 A; 320 C; 333 G; 389 T; 0 other;
     cagtcggacg gacgagcagc gcgtcgctgt cctccggcag ctggagatgt ccgagcccaa        60
     ggcaattgat cccaagttgt cgacgaccga cagggtggtg aaagtttgtg gggacattca       120
     tggacaattc tttgatttga tgaagctctt tgaagtcggg ggatctcctg ccaacactcg       180
     ctacctcttc ttaggggact atgttgacag agggtacttc agtattgaat gtgtgctgta       240
     tttgtgggcc ttgaaaattc tctaccccaa aacactgttt ttacttcgtg gaaatcatga       300
     atgtagacat ctaacagagt atttcacatt taaacaagaa tgtaaaataa agtattcaga       360
     acgcgtatat gatgcctgta tggatgcctt tgactgcctt cccctggctg ccctgatgaa       420
     ccaacagttc ctgtgtgtgc atggtggttt gtctccagag attaacactt tagatgatat       480
     cagaaaatta gaccgattca aagaaccacc tgcatatgga cctatgtgtg atatcctgtg       540
     gtcagacccc ctggaagatt ttggaaatga gaagactcag gaacatttca ctcacaacac       600
     agtcaggggg tgttcatact tctacagtta cccggctgta tgtgaattct tacagcacaa       660
     taacttgtta tctatactcc gagcccacga agcccaagat gcagggtacc gcatgtacag       720
     gaaaagccaa acaacaggct tcccttctct aattacaatt ttttcagcac caaattactt       780
     agatgtatac aataacaaag ctgcagtatt gaagtatgag aacaatgtta tgaatatcag       840
     gcaattcaac tgttctcctc atccatactg gcttccaaat ttcatggatg tttttacttg       900
     gtcccttcca tttgttgggg aaaaagtgac tgagatgctg gtaaatgtcc tcaacatctg       960
     ctcagatgat gaactagggt cagaagaaga tggatttgat ggtgcaacag ctgcagcccg      1020
     gaaagaggtg ataaggaaca agatccgagc aataggcaaa atggccagag tgttctcagt      1080
     gctcagagaa gagagtgaga gtgtgctgac gctgaaaggc ttgaccccaa ctggcatgct      1140
     ccccagcgga gtactttctg gagggaagca aaccctgcaa agcgctactg ttgaggctat      1200
     tgaggctgat gaagctatca aaggattttc accacaacat aagatcacta gcttcgagga      1260
     agccaagggc ttagaccgaa ttaatgagag gatgccgcct cgcagagatg ccatgccctc      1320
     tgacgccaac cttaactcca tcaacaaggc tctcacctca gagactaacg gcacggacag      1380
     caatggcagt aatagcagca atattcagtg accacttcct gttcactttt tttttttttt      1440
     tttttttttt tt                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page