(data stored in ACNUC26462 zone)

EMBL: AY911414

ID   AY911414; SV 1; linear; mRNA; STD; PLN; 1024 BP.
XX
AC   AY911414;
XX
DT   20-FEB-2005 (Rel. 82, Created)
DT   14-SEP-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Zea mays phosphoenolpyruvate carboxylase kinase 2 (PPCK2) mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Zea mays
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade;
OC   Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea.
XX
RN   [1]
RP   1-1024
RX   DOI; 10.1104/pp.104.042762.
RX   PUBMED; 15299132.
RA   Sullivan S., Jenkins G.I., Nimmo H.G.;
RT   "Roots, cycles and leaves. Expression of the phosphoenolpyruvate
RT   carboxylase kinase gene family in soybean";
RL   Plant Physiol. 135(4):2078-2087(2004).
XX
RN   [2]
RP   1-1024
RX   DOI; 10.1111/j.1365-313X.2006.02850.x.
RX   PUBMED; 16925599.
RA   Shenton M., Fontaine V., Hartwell J., Marsh J.T., Jenkins G.I., Nimmo H.G.;
RT   "Distinct patterns of control and expression amongst members of the PEP
RT   carboxylase kinase gene family in C4 plants";
RL   Plant J. 48(1):45-53(2006).
XX
RN   [3]
RP   1-1024
RA   Shenton M., Hartwell J., Marsh J.T., Jenkins G.I., Nimmo H.G.;
RT   ;
RL   Submitted (28-JAN-2005) to the INSDC.
RL   IBLS, University of Glasgow, University Avenue, Glasgow G12 8QQ, UK
XX
DR   MD5; f73ec619e78a3dc16ac227867ea34205.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1024
FT                   /organism="Zea mays"
FT                   /cultivar="CO328"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:4577"
FT   gene            1..1024
FT                   /gene="PPCK2"
FT   CDS_pept        1..897
FT                   /codon_start=1
FT                   /gene="PPCK2"
FT                   /product="phosphoenolpyruvate carboxylase kinase 2"
FT                   /note="protein kinase; ZmPPCK2"
FT                   /db_xref="GOA:Q5EC58"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5EC58"
FT                   /protein_id="AAX07936.1"
FT                   /translation="MSAELKRDYEIGEEIGRGRFGVVHRCTSRATGEAFAVKSVDRSRL
FT                   GDDLDRELAQLEPKLAQLAGAGNPGVVQVHAAYEDEAWTHVVINLCPGPDLLEWVGRRR
FT                   GAPVPEPVAAAIVAQVAQALALCHRRGVAHRDVKPENILIDAAAGSDDDEEDEAEAAPR
FT                   ARLADFGSAAWVGAGGLGRAEGLVGTPHYVAPEVVAGGEYGAKADVWSAGVVMYALLSG
FT                   GAFPFGGDSAAEVLAAVLRGSARFPPRLFGGVSPAAKDLMRRMICRDEWRRFTAEQVLA
FT                   HPWIVSGGGARAMERPT"
XX
SQ   Sequence 1024 BP; 145 A; 329 C; 414 G; 136 T; 0 other;
     atgagtgcgg agctgaagag ggactacgag atcggcgagg agatcgggcg cggccgcttc        60
     ggggtggtcc accgctgcac gtcccgcgcc accggggagg ccttcgccgt gaagtccgtg       120
     gaccggtcgc ggctgggcga cgacctggac cgcgagctcg cgcaactgga gccgaagctg       180
     gcgcagctcg ccggcgcggg caacccgggc gtggtgcagg tgcacgcggc gtacgaggac       240
     gaggcgtgga cgcacgtggt cataaacctg tgcccgggcc cggacctgct ggagtgggtg       300
     ggccgccgcc gcggcgcgcc cgtgccggag cccgtggccg ccgccatcgt cgcgcaggtc       360
     gcgcaggcgc tcgcgctctg ccaccgccgc ggcgtcgccc accgcgacgt gaagcccgag       420
     aacatcctca tcgacgccgc cgccgggagc gacgacgacg aggaggacga ggccgaggcg       480
     gcgccgcgcg cgcgcctggc ggacttcggg tcggcggcgt gggtgggcgc cggtgggctc       540
     gggcgcgccg agggccttgt ggggacgccc cactacgtgg cgcccgaggt ggtggccggc       600
     ggcgagtacg gcgccaaggc ggacgtgtgg agcgccggcg tggtgatgta cgcgctgctc       660
     tccggcggcg cgttcccctt cggcggcgac agcgccgcgg aggtgctggc ggccgtgctg       720
     cgcggcagcg cgcgcttccc gcccaggctc ttcggcgggg tgtcgcccgc cgccaaggac       780
     ctgatgcggc gcatgatctg ccgcgacgag tggaggaggt tcaccgccga gcaagtcctc       840
     gctcacccgt ggatcgtgag tggcggagga gcccgggcaa tggagcggcc aacctgagga       900
     ggaatccaga cggacgtgta ttgccgtaga gcactcaggc acggcaagga atcccggacg       960
     ttatgtatga ggtttttgta cgtacgtagt agtgtacggt agctgctgcc agctgcagaa      1020
     ggga                                                                   1024
//

If you have problems or comments...

PBIL Back to PBIL home page