(data stored in ACNUC7421 zone)

EMBL: AY912104

ID   AY912104; SV 2; linear; genomic DNA; STD; PRO; 777 BP.
XX
AC   AY912104;
XX
DT   21-FEB-2005 (Rel. 82, Created)
DT   30-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Bacillus subtilis pantothenate kinase type III (yacB) gene, complete cds.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-777
RX   DOI; 10.1074/jbc.C500044200.
RX   PUBMED; 15795230.
RA   Brand L.A., Strauss E.;
RT   "Characterization of a new pantothenate kinase isoform from Helicobacter
RT   pylori";
RL   J Biol Chem 280(21):20185-20188(2005).
XX
RN   [2]
RP   1-777
RA   Strauss E., Brand L.A.;
RT   ;
RL   Submitted (29-JAN-2005) to the INSDC.
RL   Dept. of Chemistry, Stellenbosch University, Private Bag X1, Matieland,
RL   Western Cape 7602, South Africa
XX
RN   [3]
RC   Sequence update by submitter
RP   1-777
RA   Strauss E., Brand L.A.;
RT   ;
RL   Submitted (29-APR-2005) to the INSDC.
RL   Dept. of Chemistry, Stellenbosch University, Private Bag X1, Matieland,
RL   Western Cape 7602, South Africa
XX
DR   MD5; b93be2b3ac69f5893ea3f6470f4c4d6d.
XX
CC   On Apr 29, 2005 this sequence version replaced gi:58890972.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..777
FT                   /organism="Bacillus subtilis"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   gene            1..777
FT                   /gene="yacB"
FT   CDS_pept        1..777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacB"
FT                   /product="pantothenate kinase type III"
FT                   /EC_number="2.7.1.33"
FT                   /note="third isoform of pantothenate kinase; CoaX-like"
FT                   /db_xref="GOA:P37564"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37564"
FT                   /protein_id="AAW83041.2"
FT                   /translation="MLLVIDVGNTNTVLGVYHDGKLEYHWRIETSRHKTEDEFGMILRS
FT                   LFDHSGLMFEQIDGIIISSVVPPIMFALERMCTKYFHIEPQIVGPGMKTGLNIKYDNPK
FT                   EVGADRIVNAVAAIHLYGNPLIVVDFGTATTYCYIDENKQYMGGAIAPGITISTEALYS
FT                   RAAKLPRIEITRPDNIIGKNTVSAMQSGILFGYVGQVEGIVKRMKWQAKQKQKVIATGG
FT                   LAPLIANESDCIDIVDPFLTLKGLELIYERNRVGSV"
XX
SQ   Sequence 777 BP; 244 A; 147 C; 185 G; 201 T; 0 other;
     atgttactgg ttatcgatgt ggggaacacc aatactgtac ttggtgtata tcatgatgga        60
     aaattagaat atcactggcg tatagaaaca agcaggcata aaacagaaga tgagtttggg       120
     atgattttgc gctccttatt tgatcactcc gggcttatgt ttgaacagat agatggcatt       180
     attatttcgt cagtagtgcc gccaatcatg tttgcgttag aaagaatgtg cacaaaatac       240
     tttcatatcg agcctcaaat tgttggtcca ggtatgaaaa ccggtctaaa tataaaatat       300
     gacaatccga aagaagtagg ggcagacaga atcgtaaatg ctgtcgctgc gatacacttg       360
     tacggcaatc cattaattgt tgtcgatttc ggaaccgcca caacgtactg ctatattgat       420
     gaaaacaaac aatacatggg cggggcgatt gcccctggga ttacaatttc gacagaggcg       480
     ctttactcgc gtgcagcaaa gcttcctcgt atcgaaatca cccggcccga caatattatc       540
     ggaaaaaaca ctgttagcgc gatgcaatct ggaattttat ttggctatgt cggccaagtg       600
     gaaggaatcg ttaagcgaat gaaatggcag gcaaaacaga aacaaaaggt cattgcgaca       660
     ggaggcctgg cgccgctcat tgcgaacgaa tcagattgta tagacatcgt tgatccattc       720
     ttaaccctaa aagggctgga attgatttat gaaagaaacc gcgtaggaag tgtatag          777
//

If you have problems or comments...

PBIL Back to PBIL home page