(data stored in ACNUC14238 zone)

EMBL: AY953023

ID   AY953023; SV 1; linear; mRNA; STD; ROD; 2118 BP.
XX
AC   AY953023; S61949;
XX
DT   27-MAR-2005 (Rel. 83, Created)
DT   27-MAR-2005 (Rel. 83, Last updated, Version 1)
XX
DE   Rattus norvegicus smooth muscle myosin heavy chain, alternative isoform B,
DE   S1 region mRNA, partial cds, alternatively spliced.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-2118
RX   PUBMED; 7684561.
RA   White S., Martin A.F., Periasamy M.;
RT   "Identification of a novel smooth muscle myosin heavy chain cDNA: isoform
RT   diversity in the S1 head region";
RL   Am. J. Physiol. 264(5 Pt 1):C1252-C1258(1993).
XX
RN   [2]
RP   1-2118
RA   White S., Martin A.F., Periasamy M.;
RT   ;
RL   Submitted (25-AUG-1993) to the INSDC.
RL   Department of Physiology and Biophysics, University of Vermont, Burlington,
RL   VT 05405-0068, USA
XX
RN   [3]
RP   1-2118
RA   White S.L.;
RT   ;
RL   Submitted (03-MAR-2005) to the INSDC.
RL   Anatomy and Neurobiology, University of Vermont, 149 Beaumont Ave.,
RL   Burlington, VT 05405, USA
XX
DR   MD5; f0fba18f0c4b815cad24fe71477d31ff.
XX
CC   On Mar 27, 2005 this sequence version replaced gi:385468.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2118
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /dev_stage="18d fetus"
FT                   /tissue_type="visceral smooth muscle"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        <1..>2118
FT                   /codon_start=1
FT                   /product="smooth muscle myosin heavy chain, alternative
FT                   isoform B, S1 region"
FT                   /note="contractile protein; alternatively spliced"
FT                   /db_xref="GOA:Q63862"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002928"
FT                   /db_xref="InterPro:IPR027401"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63862"
FT                   /protein_id="AAX51987.1"
FT                   /translation="KKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTK
FT                   KVIQYLAVVASSHKGKKDSSITQGPSFAYGELEKQLLQANPILEAFGNAKTVKNDNSSR
FT                   FGKFIRINFDVTGYIVGANIETYLLEKSRAIRHARDERTFHIFYYLIAGAKEKMRNDLL
FT                   LESFNSYTFLSNGFVPIPAAQDDEMFQETLEAMSIMGFSEEEQLAILKVVSSVLQLGNI
FT                   VFKKERNTDQASMPDNTAAQKVCHLVGINVTDFTRAILTPRIKVGRDVVQKAQTKEQAD
FT                   FAIEALAKATYERLFRWILSRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCIN
FT                   YTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLD
FT                   EECWFPKATDKSFVEKLCSEQGNHPKFQKPKQLKDKTEFSIIHYAGKVDYNASAWLTKN
FT                   MDPLNDNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVG
FT                   QLYKEQLGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQ
FT                   GFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRT
FT                   GVLAHLEEERDLKITDVIMAFQAMCRGYLARKAFTKRQQQLTASKVIQRNCAAYLKLRN
FT                   WQWWRLFTKVKP"
XX
SQ   Sequence 2118 BP; 582 A; 537 C; 536 G; 463 T; 0 other;
     aagaagaggc atgagatgcc gcctcacatc tatgccattg ctgatacggc ctacagaagc        60
     atgctacaag atcgtgaaga ccagtccatt ctgtgcacag gtgagtctgg agctggaaag       120
     acagagaaca caaagaaagt catacagtat ttggctgtgg tggcatcctc ccacaaaggc       180
     aagaaagaca gcagcatcac gcaaggccca tcttttgcct acggggagct ggaaaagcag       240
     cttctacagg caaacccaat cctggaggct ttcggcaatg caaaaactgt caagaatgac       300
     aactcctccc gctttggcaa gttcattcgc atcaactttg atgtcactgg ttacattgtg       360
     ggtgccaata tcgaaacata tcttctggaa aagtctcggg ctattcgaca tgctagggac       420
     gagagaacgt tccacatctt ctactatctg atcgctggag ccaaggagaa gatgagaaat       480
     gacctacttt tggagagctt caacagctac acatttttat ccaatggctt tgtgcccatc       540
     ccagctgcac aagatgatga gatgttccag gagacactag aggccatgtc catcatgggc       600
     ttcagtgaag aggaacagct agccatcttg aaggtagtat catccgtcct tcagcttgga       660
     aacattgtct tcaagaagga gcgaaacaca gaccaggcat ccatgcctga taacacagct       720
     gctcagaaag tttgccacct tgtgggaatt aatgtgacag atttcaccag agccatcctg       780
     accccacgta taaaagttgg acgggatgtg gtgcagaaag ctcagaccaa agaacaggct       840
     gactttgcca ttgaggcctt agccaaggcc acttatgagc gccttttccg atggattctc       900
     agccgtgtga acaaagcctt ggataagacc catcgtcagg gggcctcctt cctgggcatt       960
     ctggatattg ctgggtttga aatctttgag gtaaactcct tcgagcagct gtgcatcaac      1020
     tacaccaatg agaagttgca gcagctgttc aatcacacca tgttcatcct ggagcaggaa      1080
     gagtaccaac gagagggcat cgagtggaac ttcatcgact ttggcctgga cctacagcct      1140
     tgtattgaac tgattgagcg gccgaacaac cctcctggtg tgctggccct gctggatgaa      1200
     gaatgctggt tccccaaagc tacggacaag tcttttgtgg agaagctgtg ctcagagcag      1260
     ggcaatcacc ccaaatttca gaagcccaag cagctaaagg acaaaacaga gttctccatc      1320
     atccactatg ctgggaaggt ggactataat gcaagtgcgt ggctgaccaa gaacatggac      1380
     ccgctaaatg ataatgtgac ctcactcctc aatgcctcct cggacaagtt tgtggccgac      1440
     ctgtggaagg atgtggaccg cattgtgggg ttggaccaga tggccaagat gactgagagc      1500
     tcactgccca gtgcctccaa gaccaaaaag ggcatgttcc gcaccgtggg ccagctctac      1560
     aaagagcagc tggggaagct gatgaccaca ctgcgcaaca ccacgcctaa ctttgtgcgc      1620
     tgcatcatcc ccaaccatga aaagaggtct ggcaagctgg atgcatttct agttctggag      1680
     cagctgcggt gcaatggtgt gttggaaggc atccgcatct gccgtcaggg cttccccaac      1740
     aggattgtct tccaagagtt ccggcaacgc tacgagatcc tggcagcgaa cgccatcccc      1800
     aaaggcttca tggatggaaa gcaagcctgc attctcatga tcaaagccct tgaacttgac      1860
     cccaatctgt acaggattgg gcagagcaaa atcttctttc gtacgggagt cctggcccac      1920
     ctagaggaag aacgagacct gaagattact gatgtcatca tggctttcca ggcaatgtgt      1980
     cgtggctacc tggccagaaa agccttcacc aagaggcagc aacagttaac agccagtaag      2040
     gtgatccaga ggaactgcgc tgcctacctt aaactccgca actggcaatg gtggaggctc      2100
     ttcactaaag taaagccg                                                    2118
//

If you have problems or comments...

PBIL Back to PBIL home page