(data stored in ACNUC8465 zone)

EMBL: AY965253

ID   AY965253; SV 1; linear; mRNA; STD; VRT; 472 BP.
XX
AC   AY965253;
XX
DT   12-MAY-2005 (Rel. 83, Created)
DT   14-JUN-2005 (Rel. 84, Last updated, Version 2)
XX
DE   Danio rerio ras-like protein Rhogc mRNA, partial cds.
XX
KW   .
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-472
RX   DOI; 10.1016/j.ygeno.2005.03.010.
RX   PUBMED; 15894457.
RA   Salas-Vidal E., Meijer A.H., Cheng X., Spaink H.P.;
RT   "Genomic annotation and expression analysis of the zebrafish Rho small
RT   GTPase family during development and bacterial infection";
RL   Genomics 86(1):25-37(2005).
XX
RN   [2]
RP   1-472
RA   Salas-Vidal E., Meijer A.H., Cheng X., Spaink H.P.;
RT   ;
RL   Submitted (17-MAR-2005) to the INSDC.
RL   Molecular Biology, Institute of Biology, Leiden University, Wassenaarseweg
RL   64, Leiden, Z.H. 2333 AL, The Netherlands
XX
DR   MD5; c4fc1374d142d504f61ac058b2380b35.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..472
FT                   /organism="Danio rerio"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:7955"
FT   CDS_pept        <1..>472
FT                   /codon_start=3
FT                   /product="ras-like protein Rhogc"
FT                   /db_xref="GOA:Q507K4"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q507K4"
FT                   /db_xref="ZFIN:ZDB-GENE-030131-3402"
FT                   /protein_id="AAY32932.1"
FT                   /translation="TVFDNYSTQTCVDGRAVSLNLWDTAGQEEYDRLRTLSYPQTHVFI
FT                   ICFSVASPSSHANVRHKWHPEVCHHCPGVPVLLVGTKRDLRGDKETLEKLKEQGMSPTT
FT                   PQQGSALARSIGAVRYLECSALLQEGVREVFNEAVRAVLYPNAKKHTKKCVLL"
XX
SQ   Sequence 472 BP; 103 A; 147 C; 135 G; 87 T; 0 other;
     ctacagtgtt cgacaactac agcactcaaa cctgtgtgga cggccgtgct gtcagcctca        60
     acctgtggga caccgccggt caggaggagt acgaccgcct gcgaaccctc tcctacccgc       120
     agacacacgt cttcatcatc tgtttctctg tggctagtcc ttcctctcac gccaacgtca       180
     ggcataaatg gcacccggag gtctgccacc actgtcctgg cgtacctgtg ctgctggtgg       240
     gcaccaagag agacctgcga ggggacaagg agaccctgga gaagctgaag gagcagggga       300
     tgagtccgac cactccacag caaggcagtg cactggcccg cagcatcggg gcggtgcgat       360
     atctggagtg ctcggccctt ctccaggagg gcgtccgaga ggtcttcaac gaagcagttc       420
     gggctgttct ctaccccaac gccaagaagc acaccaaaaa atgtgtgctg ct               472
//

If you have problems or comments...

PBIL Back to PBIL home page