(data stored in ACNUC12215 zone)

EMBL: AY989815

ID   AY989815; SV 3; linear; mRNA; STD; HUM; 1628 BP.
XX
AC   AY989815;
XX
DT   19-APR-2005 (Rel. 83, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens XTES mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1628
RX   DOI; 10.1016/j.gene.2005.10.037.
RX   PUBMED; 16431037.
RA   Calenda G., Peng J., Redman C.M., Sha Q., Wu X., Lee S.;
RT   "Identification of two new members, XPLAC and XTES, of the XK family";
RL   Gene 370:6-16(2006).
XX
RN   [2]
RP   1-1628
RA   Lee S., Wu X.;
RT   ;
RL   Submitted (29-MAR-2005) to the INSDC.
RL   Membrane Biochemistry, New York Blood Center, 310 East 67th Street, New
RL   York, NY 10021, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1628
RA   Lee S., Wu X.;
RT   ;
RL   Submitted (22-AUG-2005) to the INSDC.
RL   Membrane Biochemistry, New York Blood Center, 310 East 67th Street, New
RL   York, NY 10021, USA
XX
DR   MD5; 37a28d8d4ce4f4afcff8bfd9f20b2696.
DR   Ensembl-Gn; ENSG00000172967; homo_sapiens.
DR   Ensembl-Tr; ENST00000331428; homo_sapiens.
XX
CC   On Aug 22, 2005 this sequence version replaced gi:71673354.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1628
FT                   /organism="Homo sapiens"
FT                   /chromosome="22"
FT                   /map="22q11.1"
FT                   /mol_type="mRNA"
FT                   /dev_stage="14-64 years of age"
FT                   /tissue_type="testis"
FT                   /note="caucasian"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        82..1461
FT                   /codon_start=1
FT                   /product="XTES"
FT                   /note="member of XK family; 53.4 kDa; putative membrane
FT                   transporter; only expressed in testis"
FT                   /db_xref="GOA:Q5GH77"
FT                   /db_xref="H-InvDB:HIT000333574.9"
FT                   /db_xref="HGNC:HGNC:28778"
FT                   /db_xref="InterPro:IPR018629"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5GH77"
FT                   /protein_id="AAX86010.1"
FT                   /translation="METVFEEMDEESTGGVSSSKEEIVLGQRLHLSFPFSIIFSTVLYC
FT                   GEVAFGLYMFEIYRKANDTFWMSFTISFIIVGAILDQIILMFFNKDLRRNKAALLFWHI
FT                   LLLGPIVRCLHTIRNYHKWLKNLKQEKEETQVSITKRNTMLEREIAFSIRDNFMQQKAF
FT                   KYMSVIQAFLGSVPQLILQMYISLTIREWPLNRALLMTFSLLSVTYGAIRCNILAIQIS
FT                   NDDTTIKLPPIEFFCVVMWRFLEVISRVVTLALFIASLKLKSLPVLLIIYFVSLLAPWL
FT                   EFWKSGAHLPGNKENNSNMVGTVLMLFLITLLYAAINFSCWSAVKLQLSDDKIIDGRQR
FT                   WGHRILHYSFQFLENVIMILVFRFFGGKTLLNCCDSLIAVQLIISYLLATGFMLLFYQY
FT                   LYPWQSGKVLPGRTENQPEAPYYYVNIEKTEKNKNKQLRNYCNSCNRVGYFSIRKSMTC
FT                   S"
XX
SQ   Sequence 1628 BP; 510 A; 290 C; 335 G; 493 T; 0 other;
     tgcagaacgt atcagtgaaa ctccctccca ctgtctcttg tattagcatc aaggaagcga        60
     gaaaaaataa gcaccctgag aatggagaca gtgtttgaag agatggatga agaaagcaca       120
     ggaggagttt catcttcgaa agaagaaata gtccttggcc agagactcca tctaagcttt       180
     ccttttagca ttatcttctc aactgttctc tactgtggtg aggttgcctt tggtttatac       240
     atgtttgaaa tttatcgaaa agctaatgac acattctgga tgtcatttac catcagcttt       300
     attattgtgg gggcaatttt ggatcaaatt atcctgatgt ttttcaacaa agacttgagg       360
     agaaataagg ctgcattact tttttggcac attcttcttt taggacctat tgtgaggtgt       420
     ttgcacacca ttagaaatta ccacaaatgg ttgaaaaatc ttaaacagga gaaggaagag       480
     actcaagtta gcatcacaaa gagaaacacg atgctggaaa gggagattgc attctcaatc       540
     cgggataatt tcatgcagca gaaggctttc aagtacatgt cagtgattca ggcttttctc       600
     ggttctgttc cacaattaat tttgcagatg tatatcagtc tcactatacg agaatggcct       660
     ttgaatagag cattgctgat gacattttcc ctgttatcag ttacttatgg ggccattcgc       720
     tgcaatatac tggccatcca gatcagcaat gatgatacta ccattaagct accgccgata       780
     gaattcttct gtgtcgtgat gtggcgtttt ttggaggtta tctcacgtgt agtgactctg       840
     gcattgttca ttgcatctct gaaactgaag agcctacccg ttttgttaat catatatttt       900
     gtatcattgt tggcaccgtg gctggagttt tggaaaagtg gagctcatct tcctggcaac       960
     aaagaaaata attccaatat ggtgggtaca gtactgatgc ttttcttgat cacactgcta      1020
     tatgctgcca tcaacttctc ctgctggtca gcagtgaaac tgcagttgtc agatgacaaa      1080
     ataattgacg ggagacagag gtggggccat agaatcctac actacagctt tcagttttta      1140
     gaaaatgtga taatgatatt ggtatttagg ttctttggag ggaaaacttt gctgaattgt      1200
     tgtgactcat taattgccgt gcagctcatc ataagctacc tattggccac tggctttatg      1260
     ctcctcttct atcagtattt gtacccatgg cagtcaggca aagtgttgcc aggacgtact      1320
     gaaaatcagc cagaagcacc gtactattat gtaaacatcg agaaaactga aaagaataaa      1380
     aataagcagc tgaggaatta ctgtaactcc tgcaataggg ttggatattt ttcaatcaga      1440
     aaaagtatga catgttcata aaatatacat atatactttc acagaacaat gagtaaagat      1500
     gctgaatgtg acttgttaag aggctcttaa atttaaaaaa tatacacagc aaaatcttgg      1560
     aagtggtttc taataaaatt catttatgtt ctcctgcgaa aaaaaaaaaa aaaaaaaaaa      1620
     aaaaaaaa                                                               1628
//

If you have problems or comments...

PBIL Back to PBIL home page