(data stored in ACNUC7421 zone)

EMBL: BA000002

ID   BA000002; SV 3; circular; genomic DNA; STD; PRO; 1669696 BP.
XX
AC   BA000002; AP000058-AP000064;
XX
PR   Project:PRJNA211;
XX
DT   08-DEC-2004 (Rel. 82, Created)
DT   10-OCT-2016 (Rel. 130, Last updated, Version 10)
XX
DE   Aeropyrum pernix K1 DNA, complete genome.
XX
KW   .
XX
OS   Aeropyrum pernix K1
OC   Archaea; Crenarchaeota; Thermoprotei; Desulfurococcales;
OC   Desulfurococcaceae; Aeropyrum.
XX
OS   Aeropyrum pernix ovoid virus 1
OC   Viruses; Guttaviridae; Betaguttavirus.
XX
OS   Aeropyrum pernix spindle-shaped virus 1
OC   Viruses; unclassified archaeal viruses.
XX
RN   [1]
RP   1-1669696
RA   Tanaka T., Hino Y., Kawarabayasi Y., Kikuchi H., Tajima T., Sekigawa T.,
RA   Oguchi A., Yamazaki S., Tanikawa S., Fujita N., Harayama S.;
RT   ;
RL   Submitted (14-DEC-1998) to the INSDC.
RL   Contact:Director-General of Department of Biotechnology National Institute
RL   of Technology and Evaluation (NITE), NITE Genome Analysis Center (NGAC),
RL   Department of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066,
RL   Japan URL    :http://www.bio.nite.go.jp/
XX
RN   [2]
RX   DOI; 10.1093/dnares/6.2.83.
RX   PUBMED; 10382966.
RA   Kawarabayasi Y., Hino Y., Horikawa H., Yamazaki S., Haikawa Y., Jin-no K.,
RA   Takahashi M., Sekine M., Baba S., Ankai A., Kosugi H., Hosoyama A.,
RA   Fukui S., Nagai Y., Nishijima K., Nakazawa H., Takamiya M., Masuda S.,
RA   Funahashi T., Tanaka T., Kudoh Y., Yamazaki J., Kushida N., Oguchi A.,
RA   Aoki K., Kubota K., Nakamura Y., Nomura N., Sako Y., Kikuchi H.;
RT   "Complete genome sequence of an aerobic hyper-thermophilic crenarchaeon,
RT   Aeropyrum pernix K1";
RL   DNA Res. 6(2):83-101(1999).
XX
RN   [3]
RX   DOI; 10.1093/dnares/dsi023.
RX   PUBMED; 16769697.
RA   Yamazaki S., Kikuchi H., Kawarabayasi Y.;
RT   "Characterization of a whole set of tRNA molecules in an aerobic
RT   hyper-thermophilic Crenarchaeon, Aeropyrum pernix K1";
RL   DNA Res. 12(6):403-416(2005).
XX
RN   [4]
RX   DOI; 10.1074/mcp.M500312-MCP200.
RX   PUBMED; 16455681.
RA   Yamazaki S., Yamazaki J., Nishijima K., Otsuka R., Mise M., Ishikawa H.,
RA   Sasaki K., Tago S., Isono K.;
RT   "Proteome analysis of an aerobic hyperthermophilic crenarchaeon, Aeropyrum
RT   pernix K1";
RL   Mol. Cell Proteomics 5(5):811-823(2006).
XX
DR   MD5; bacb35c9327fb01212bd323b746fdfc8.
DR   BioSample; SAMD00061092.
DR   EnsemblGenomes-Gn; APE_rRNA01.
DR   EnsemblGenomes-Gn; APE_rRNA03.
DR   EnsemblGenomes-Gn; APE_rRNA05.
DR   EnsemblGenomes-Gn; APE_tRNA01.
DR   EnsemblGenomes-Gn; APE_tRNA02.
DR   EnsemblGenomes-Gn; APE_tRNA03.
DR   EnsemblGenomes-Gn; APE_tRNA04.
DR   EnsemblGenomes-Gn; APE_tRNA05.
DR   EnsemblGenomes-Gn; APE_tRNA06.
DR   EnsemblGenomes-Gn; APE_tRNA07.
DR   EnsemblGenomes-Gn; APE_tRNA08.
DR   EnsemblGenomes-Gn; APE_tRNA09.
DR   EnsemblGenomes-Gn; APE_tRNA10.
DR   EnsemblGenomes-Gn; APE_tRNA11.
DR   EnsemblGenomes-Gn; APE_tRNA12.
DR   EnsemblGenomes-Gn; APE_tRNA13.
DR   EnsemblGenomes-Gn; APE_tRNA14.
DR   EnsemblGenomes-Gn; APE_tRNA15.
DR   EnsemblGenomes-Gn; APE_tRNA16.
DR   EnsemblGenomes-Gn; APE_tRNA17.
DR   EnsemblGenomes-Gn; APE_tRNA18.
DR   EnsemblGenomes-Gn; APE_tRNA19.
DR   EnsemblGenomes-Gn; APE_tRNA20.
DR   EnsemblGenomes-Gn; APE_tRNA21.
DR   EnsemblGenomes-Gn; APE_tRNA22.
DR   EnsemblGenomes-Gn; APE_tRNA23.
DR   EnsemblGenomes-Gn; APE_tRNA24.
DR   EnsemblGenomes-Gn; APE_tRNA25.
DR   EnsemblGenomes-Gn; APE_tRNA26.
DR   EnsemblGenomes-Gn; APE_tRNA27.
DR   EnsemblGenomes-Gn; APE_tRNA28.
DR   EnsemblGenomes-Gn; APE_tRNA29.
DR   EnsemblGenomes-Gn; APE_tRNA30.
DR   EnsemblGenomes-Gn; APE_tRNA31.
DR   EnsemblGenomes-Gn; APE_tRNA32.
DR   EnsemblGenomes-Gn; APE_tRNA33.
DR   EnsemblGenomes-Gn; APE_tRNA34.
DR   EnsemblGenomes-Gn; APE_tRNA35.
DR   EnsemblGenomes-Gn; APE_tRNA36.
DR   EnsemblGenomes-Gn; APE_tRNA37.
DR   EnsemblGenomes-Gn; APE_tRNA38.
DR   EnsemblGenomes-Gn; APE_tRNA39.
DR   EnsemblGenomes-Gn; APE_tRNA40.
DR   EnsemblGenomes-Gn; APE_tRNA41.
DR   EnsemblGenomes-Gn; APE_tRNA42.
DR   EnsemblGenomes-Gn; APE_tRNA43.
DR   EnsemblGenomes-Gn; APE_tRNA44.
DR   EnsemblGenomes-Gn; APE_tRNA45.
DR   EnsemblGenomes-Gn; APE_tRNA46.
DR   EnsemblGenomes-Gn; APE_tRNA47.
DR   EnsemblGenomes-Gn; EBG00001177865.
DR   EnsemblGenomes-Gn; EBG00001177866.
DR   EnsemblGenomes-Gn; EBG00001177867.
DR   EnsemblGenomes-Gn; EBG00001177868.
DR   EnsemblGenomes-Gn; EBG00001177869.
DR   EnsemblGenomes-Gn; EBG00001177870.
DR   EnsemblGenomes-Gn; EBG00001177871.
DR   EnsemblGenomes-Gn; EBG00001177872.
DR   EnsemblGenomes-Gn; EBG00001177873.
DR   EnsemblGenomes-Gn; EBG00001177874.
DR   EnsemblGenomes-Gn; EBG00001177875.
DR   EnsemblGenomes-Gn; EBG00001177876.
DR   EnsemblGenomes-Gn; EBG00001177877.
DR   EnsemblGenomes-Gn; EBG00001177878.
DR   EnsemblGenomes-Gn; EBG00001177879.
DR   EnsemblGenomes-Gn; EBG00001177880.
DR   EnsemblGenomes-Gn; EBG00001177881.
DR   EnsemblGenomes-Gn; EBG00001177882.
DR   EnsemblGenomes-Gn; EBG00001177883.
DR   EnsemblGenomes-Gn; EBG00001177884.
DR   EnsemblGenomes-Gn; EBG00001177885.
DR   EnsemblGenomes-Gn; EBG00001177886.
DR   EnsemblGenomes-Gn; EBG00001177887.
DR   EnsemblGenomes-Gn; EBG00001177888.
DR   EnsemblGenomes-Gn; EBG00001177889.
DR   EnsemblGenomes-Gn; EBG00001177890.
DR   EnsemblGenomes-Gn; EBG00001177891.
DR   EnsemblGenomes-Gn; EBG00001177892.
DR   EnsemblGenomes-Gn; EBG00001177893.
DR   EnsemblGenomes-Gn; EBG00001177894.
DR   EnsemblGenomes-Gn; EBG00001177895.
DR   EnsemblGenomes-Gn; EBG00001177896.
DR   EnsemblGenomes-Gn; EBG00001177897.
DR   EnsemblGenomes-Gn; EBG00001177898.
DR   EnsemblGenomes-Gn; EBG00001177899.
DR   EnsemblGenomes-Gn; EBG00001177900.
DR   EnsemblGenomes-Gn; EBG00001177901.
DR   EnsemblGenomes-Gn; EBG00001177902.
DR   EnsemblGenomes-Gn; EBG00001177903.
DR   EnsemblGenomes-Gn; EBG00001177904.
DR   EnsemblGenomes-Gn; EBG00001177906.
DR   EnsemblGenomes-Gn; EBG00001177907.
DR   EnsemblGenomes-Gn; EBG00001177908.
DR   EnsemblGenomes-Gn; EBG00001177909.
DR   EnsemblGenomes-Gn; EBG00001177910.
DR   EnsemblGenomes-Gn; EBG00001177911.
DR   EnsemblGenomes-Gn; EBG00001177912.
DR   EnsemblGenomes-Gn; EBG00001177913.
DR   EnsemblGenomes-Gn; EBG00001177914.
DR   EnsemblGenomes-Gn; EBG00001177915.
DR   EnsemblGenomes-Gn; EBG00001177916.
DR   EnsemblGenomes-Gn; EBG00001177917.
DR   EnsemblGenomes-Gn; EBG00001177918.
DR   EnsemblGenomes-Gn; EBG00001177919.
DR   EnsemblGenomes-Gn; EBG00001177920.
DR   EnsemblGenomes-Gn; EBG00001177921.
DR   EnsemblGenomes-Gn; EBG00001177922.
DR   EnsemblGenomes-Gn; EBG00001177923.
DR   EnsemblGenomes-Gn; EBG00001177924.
DR   EnsemblGenomes-Tr; APE_rRNA01-1.
DR   EnsemblGenomes-Tr; APE_rRNA03-1.
DR   EnsemblGenomes-Tr; APE_rRNA05-1.
DR   EnsemblGenomes-Tr; APE_tRNA01-1.
DR   EnsemblGenomes-Tr; APE_tRNA02-1.
DR   EnsemblGenomes-Tr; APE_tRNA03-1.
DR   EnsemblGenomes-Tr; APE_tRNA04-1.
DR   EnsemblGenomes-Tr; APE_tRNA05-1.
DR   EnsemblGenomes-Tr; APE_tRNA06-1.
DR   EnsemblGenomes-Tr; APE_tRNA07-1.
DR   EnsemblGenomes-Tr; APE_tRNA08-1.
DR   EnsemblGenomes-Tr; APE_tRNA09-1.
DR   EnsemblGenomes-Tr; APE_tRNA10-1.
DR   EnsemblGenomes-Tr; APE_tRNA11-1.
DR   EnsemblGenomes-Tr; APE_tRNA12-1.
DR   EnsemblGenomes-Tr; APE_tRNA13-1.
DR   EnsemblGenomes-Tr; APE_tRNA14-1.
DR   EnsemblGenomes-Tr; APE_tRNA15-1.
DR   EnsemblGenomes-Tr; APE_tRNA16-1.
DR   EnsemblGenomes-Tr; APE_tRNA17-1.
DR   EnsemblGenomes-Tr; APE_tRNA18-1.
DR   EnsemblGenomes-Tr; APE_tRNA19-1.
DR   EnsemblGenomes-Tr; APE_tRNA20-1.
DR   EnsemblGenomes-Tr; APE_tRNA21-1.
DR   EnsemblGenomes-Tr; APE_tRNA22-1.
DR   EnsemblGenomes-Tr; APE_tRNA23-1.
DR   EnsemblGenomes-Tr; APE_tRNA24-1.
DR   EnsemblGenomes-Tr; APE_tRNA25-1.
DR   EnsemblGenomes-Tr; APE_tRNA26-1.
DR   EnsemblGenomes-Tr; APE_tRNA27-1.
DR   EnsemblGenomes-Tr; APE_tRNA28-1.
DR   EnsemblGenomes-Tr; APE_tRNA29-1.
DR   EnsemblGenomes-Tr; APE_tRNA30-1.
DR   EnsemblGenomes-Tr; APE_tRNA31-1.
DR   EnsemblGenomes-Tr; APE_tRNA32-1.
DR   EnsemblGenomes-Tr; APE_tRNA33-1.
DR   EnsemblGenomes-Tr; APE_tRNA34-1.
DR   EnsemblGenomes-Tr; APE_tRNA35-1.
DR   EnsemblGenomes-Tr; APE_tRNA36-1.
DR   EnsemblGenomes-Tr; APE_tRNA37-1.
DR   EnsemblGenomes-Tr; APE_tRNA38-1.
DR   EnsemblGenomes-Tr; APE_tRNA39-1.
DR   EnsemblGenomes-Tr; APE_tRNA40-1.
DR   EnsemblGenomes-Tr; APE_tRNA41-1.
DR   EnsemblGenomes-Tr; APE_tRNA42-1.
DR   EnsemblGenomes-Tr; APE_tRNA43-1.
DR   EnsemblGenomes-Tr; APE_tRNA44-1.
DR   EnsemblGenomes-Tr; APE_tRNA45-1.
DR   EnsemblGenomes-Tr; APE_tRNA46-1.
DR   EnsemblGenomes-Tr; APE_tRNA47-1.
DR   EnsemblGenomes-Tr; EBT00001756204.
DR   EnsemblGenomes-Tr; EBT00001756205.
DR   EnsemblGenomes-Tr; EBT00001756206.
DR   EnsemblGenomes-Tr; EBT00001756207.
DR   EnsemblGenomes-Tr; EBT00001756208.
DR   EnsemblGenomes-Tr; EBT00001756209.
DR   EnsemblGenomes-Tr; EBT00001756210.
DR   EnsemblGenomes-Tr; EBT00001756211.
DR   EnsemblGenomes-Tr; EBT00001756212.
DR   EnsemblGenomes-Tr; EBT00001756213.
DR   EnsemblGenomes-Tr; EBT00001756214.
DR   EnsemblGenomes-Tr; EBT00001756215.
DR   EnsemblGenomes-Tr; EBT00001756216.
DR   EnsemblGenomes-Tr; EBT00001756217.
DR   EnsemblGenomes-Tr; EBT00001756218.
DR   EnsemblGenomes-Tr; EBT00001756219.
DR   EnsemblGenomes-Tr; EBT00001756220.
DR   EnsemblGenomes-Tr; EBT00001756221.
DR   EnsemblGenomes-Tr; EBT00001756222.
DR   EnsemblGenomes-Tr; EBT00001756223.
DR   EnsemblGenomes-Tr; EBT00001756224.
DR   EnsemblGenomes-Tr; EBT00001756225.
DR   EnsemblGenomes-Tr; EBT00001756226.
DR   EnsemblGenomes-Tr; EBT00001756227.
DR   EnsemblGenomes-Tr; EBT00001756228.
DR   EnsemblGenomes-Tr; EBT00001756229.
DR   EnsemblGenomes-Tr; EBT00001756230.
DR   EnsemblGenomes-Tr; EBT00001756231.
DR   EnsemblGenomes-Tr; EBT00001756232.
DR   EnsemblGenomes-Tr; EBT00001756233.
DR   EnsemblGenomes-Tr; EBT00001756234.
DR   EnsemblGenomes-Tr; EBT00001756235.
DR   EnsemblGenomes-Tr; EBT00001756236.
DR   EnsemblGenomes-Tr; EBT00001756237.
DR   EnsemblGenomes-Tr; EBT00001756238.
DR   EnsemblGenomes-Tr; EBT00001756239.
DR   EnsemblGenomes-Tr; EBT00001756240.
DR   EnsemblGenomes-Tr; EBT00001756241.
DR   EnsemblGenomes-Tr; EBT00001756243.
DR   EnsemblGenomes-Tr; EBT00001756244.
DR   EnsemblGenomes-Tr; EBT00001756245.
DR   EnsemblGenomes-Tr; EBT00001756246.
DR   EnsemblGenomes-Tr; EBT00001756247.
DR   EnsemblGenomes-Tr; EBT00001756248.
DR   EnsemblGenomes-Tr; EBT00001756249.
DR   EnsemblGenomes-Tr; EBT00001756250.
DR   EnsemblGenomes-Tr; EBT00001756251.
DR   EnsemblGenomes-Tr; EBT00001756252.
DR   EnsemblGenomes-Tr; EBT00001756253.
DR   EnsemblGenomes-Tr; EBT00001756254.
DR   EnsemblGenomes-Tr; EBT00001756255.
DR   EnsemblGenomes-Tr; EBT00001756256.
DR   EnsemblGenomes-Tr; EBT00001756257.
DR   EnsemblGenomes-Tr; EBT00001756258.
DR   EnsemblGenomes-Tr; EBT00001756259.
DR   EnsemblGenomes-Tr; EBT00001756260.
DR   EnsemblGenomes-Tr; EBT00001756261.
DR   EnsemblGenomes-Tr; EBT00001756262.
DR   EnsemblGenomes-Tr; EBT00001756263.
DR   EuropePMC; PMC1160258; 15980515.
DR   EuropePMC; PMC134845; 11844782.
DR   EuropePMC; PMC2222616; 18042280.
DR   EuropePMC; PMC2237900; 18286179.
DR   EuropePMC; PMC2685585; 16877322.
DR   EuropePMC; PMC3310297; 22481976.
DR   EuropePMC; PMC4019937; 24818264.
DR   EuropePMC; PMC4168702; 25252700.
DR   EuropePMC; PMC555942; 15757509.
DR   EuropePMC; PMC5797428; 29434576.
DR   EuropePMC; PMC5911459; 29713633.
DR   EuropePMC; PMC99098; 11752244.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01125; sR4.
DR   RFAM; RF01137; sR21.
DR   RFAM; RF01138; sR23.
DR   RFAM; RF01139; sR2.
DR   RFAM; RF01143; sR16.
DR   RFAM; RF01146; sR15.
DR   RFAM; RF01150; sR11.
DR   RFAM; RF01152; sR1.
DR   RFAM; RF01310; sR7.
DR   RFAM; RF01312; sR9.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   StrainInfo; 267839; 1.
XX
CC   Kawarabayasi, Y. is at National Institute of Advanced Industrial
CC   Science and Technology (AIST), Tsukuba, Ibaraki 305-8566, Japan.
CC   Tanaka, T., Hino, Y., Kawarabayasi, Y. and Kikuchi, H. are
CC   original submitters.
CC   Tajima, T., Sekigawa, T., Oguchi, A., Yamazaki, S., Tanikawa, S.,
CC   Fujita, N. and Harayama S. submitted a revised version of the
CC   genomic sequence with a single bp insertion and the result of
CC   reannotation.
CC   The genome of A. pernix was completely re-annotated in May 2006.
CC   Single nucleotide was inserted at position 941,216.
CC   Some ORFs were added or modified according to the result of
CC   proteome analysis at NITE (Yamazaki, S. et al., Mol Cell
CC   Proteomics. 5, 811-823 (2006)).
CC   The detailed process of re-annotation is described in
CC   http://www.bio.nite.go.jp/dogan/GeneralFeature?GENOME_ID=ape_G1.
CC   All locus tags of A. pernix were replaced to new identifiers by
CC   the following rules.
CC   1. Prefix 'APE' or 'APES' was replaced by 'APE_'.
CC   2. ORF numbers were inherited except for those with previous locus
CC   tag starting with 'APES'.
CC   3. An alphabetical character like 'a' was added after the ORF
CC   number where new ORF was inserted between existing ORFs, including
CC   those with previous locus tag starting with 'APES'.
CC   4. Version number like '.1' was added where the start position of
CC   existing ORF was changed.
CC   Please visit our web site.
CC   URL:http://www.bio.nite.go.jp/e/
CC   DOGAN ; Database of the Genomes Analyzed at NITE
CC   The database contains genome sequence data, physical maps
CC   and the genomic and proteomic data of the microorganisms
CC   analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
CC   The microbial strain and microbial genomic DNA clones used for
CC   the sequencing project are available through the NBRC.
CC   URL:http://www.nbrc.nite.go.jp/e/index.html
XX
FH   Key             Location/Qualifiers
FH
FT   source          order(1..478213,491983..542634,580684..1669696)
FT                   /organism="Aeropyrum pernix K1"
FT                   /focus
FT                   /strain="K1"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: NBRC 100138"
FT                   /db_xref="taxon:272557"
FT                   /culture_collection="NBRC:100138"
FT   source          478214..491982
FT                   /organism="Aeropyrum pernix ovoid virus 1"
FT                   /mol_type="genomic DNA"
FT                   /proviral
FT                   /db_xref="taxon:1032474"
FT   source          542635..580683
FT                   /organism="Aeropyrum pernix spindle-shaped virus 1"
FT                   /mol_type="genomic DNA"
FT                   /proviral
FT                   /db_xref="taxon:1032473"
FT   CDS_pept        complement(213..938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0001"
FT                   /old_locus_tag="APE0001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0001"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78910"
FT                   /db_xref="GOA:Q9YGA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YGA0"
FT                   /protein_id="BAA78910.1"
FT                   /translation="MVDILSSLLLSLPFGVIGFLLVLSPGSIWTPVKESIGYVYVSRRV
FT                   TVKASKLLGSLTLLASLISFVVGAAYGITIQASTLALLLALITVVTVEYSMRLAEIESL
FT                   NQPVLEGFEPVGSIKLKYLTIILLVYLISIVFSIEGSLKLYSIGAYGTLASHLSIEILA
FT                   GYTVFLSVKRPEAYVIPGLSRETIELLQFFMPTSLSLIAIGVYMILAGFHMWWIILLAG
FT                   VTTLFVVTMLIMINKEGKY"
FT   CDS_pept        complement(938..1276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0002"
FT                   /old_locus_tag="APE0002"
FT                   /product="putative transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0002"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78911"
FT                   /db_xref="GOA:Q9YG99"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG99"
FT                   /protein_id="BAA78911.1"
FT                   /translation="MDPADKLMKDARTGVLALAVLHVLVNHGALHGYWLRKILGNLMGW
FT                   TPPETSLYDALKRLEKLGLIKGRWVRSGRGPLRKYYEITDAGRETYEVVVKDFSKMVGW
FT                   LICRKGRE"
FT   CDS_pept        complement(1260..2174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0004"
FT                   /old_locus_tag="APE0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0004"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78913"
FT                   /db_xref="GOA:Q9YG97"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR042150"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG97"
FT                   /protein_id="BAA78913.1"
FT                   /translation="MRIEIDKRHYIGLAVFLTVSFVPAYLLDYTIAIKLLTSMQEPTTT
FT                   LPRNKLLLTIVLLFRMWLPATGVIAALWVEGYRNMEKIKEILRINIPSLKWTILSAVAP
FT                   LASYVMSLPIAKALGVSIGPCGYFKEVSNTTLLITTVIILILLGLIAGVTMNALVALGE
FT                   ELGWRGYLFTILDKKVNDLGKVIIIGLIWSVWHAPLIYAGYNYNVSMLGDCGSYSQGWP
FT                   AIVVFTLYTIAFTSILLPLRRHSNSIITPAIAHGTVNGIGGVFAALTIGNRLVAPPAGI
FT                   SVVVSMLIVGFLIKWWVSRGSSR"
FT   CDS_pept        2270..2836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0006.1"
FT                   /old_locus_tag="APE0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0006.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78915"
FT                   /db_xref="GOA:Q9YG95"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG95"
FT                   /protein_id="BAA78915.2"
FT                   /translation="MAVEQLTIAGSELLKHELTSKLVIGVLLSVWIVIVAVIKLRKYSR
FT                   NRQIVGLIVAAVATVVVLGTIAYIFNPLQTYGAYLESRTLQIRFYMNDEVAVDLCNAQL
FT                   SLLSRSNAINLLYIRTNGIADPFSGITAGYYKTVDEREAYVLIAGKDIDDVLAIEFDSK
FT                   IILLGLKGANDFYQKLIIYKSSNCR"
FT   CDS_pept        3905..5440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0007.1"
FT                   /old_locus_tag="APE0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0007.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78916"
FT                   /db_xref="GOA:Q9YG94"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG94"
FT                   /protein_id="BAA78916.2"
FT                   /translation="MVFDKRSVIVILVTMIAISGLIVVPLIVVPLIREGNTSEASEEGY
FT                   PSPTNVETVVDSSDIKKTTSGRARISLSLGAQPLNAIFSGGKFIYIVEDRKVDEKEGHA
FT                   KKVILRIIDLRSMTVETSVVIDEYSVSPSGTGPCISEDGSGKSGYPSYRLLGYDGRYVY
FT                   YARECPNTPYLYVVDLLNSRVVNTGIKTYWLAAVRDGVAYEYKDGTISATDVVEGRVLW
FT                   SHKLTPGYVFPEPQGPGRAFTGVLKGAWVDDNSLILLLQDSDQATGELVWVYSLVVASE
FT                   EGVRESYLEAFRVKSDFASYDIRVGFDGERVYVLTGLIWSYRGAYQGVVTLDSLALDGS
FT                   AKRLLVREVGGAPEDGYLPLYLFVDDGRVGIGYAVWRNVVEAMDVGTVTRVEPPILVFE
FT                   TLTPEGEVLWAREIAVDIEQGKLLGFRENSLYFTDGRYVYKMGPDRAAEKLADLGTQGL
FT                   SADTVLGAIIAAPILFPFLPFITPDTTTVMVMVDTTLYIYNGPEAQLLSVALG"
FT   CDS_pept        complement(5774..6058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0009.1"
FT                   /old_locus_tag="APE0009"
FT                   /product="putative mercury ion binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0009.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78918"
FT                   /db_xref="GOA:Q9YG92"
FT                   /db_xref="InterPro:IPR001802"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG92"
FT                   /protein_id="BAA78918.2"
FT                   /translation="MIIFKRHSQAILFSHNKQEKALLGIEGMHCEGCAIAIETALKNVK
FT                   GIIDTKVNYSRGSAIVTFDDTLVSINDILEHYIFKVPSNYRAKLVSFIS"
FT   CDS_pept        complement(6213..7820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0010.1"
FT                   /old_locus_tag="APE0010"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0010.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78919"
FT                   /db_xref="GOA:Q9YG91"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG91"
FT                   /protein_id="BAA78919.2"
FT                   /translation="MSARKGTEKLGFWEVFSIGVGGMIGGGIFATLGLSLELAGAAAPL
FT                   AFLLAGSVALITSYSYAKLSSRYPSEGGTIEFIVRAYGDNVISGGLNIMLLASYIVMIS
FT                   LYAHAFGSYGASMINCCPREAYIALVVFVIAGLTVVNMLGAIMSGRVELGLVIFKLLVL
FT                   ILVAVVSMPLVDWNRLGVREWPSILSIVAGGMIIFLAYEGFELVANTAKDVRDTTTLRK
FT                   GLYASVVTVIIVYVLIAIVAAGTLDPDTVRIARDYALAVLVEPVLGKIGFTLVVAAALA
FT                   STSSAINATLYGSARVSYIIAKYGEAPQLLGRHIWRGAYEGLLVISILGLLLALYASLE
FT                   QISTAGSGGFLIIFAAVNLAAYKLRRETGANPLISLVGFILNLTSLAILVYQMASMNPG
FT                   ELAILAVLIAGSMAAEALYRRIKGRRLPQVIDPSLKVRESLISGWRNLTARAAEIIKRE
FT                   IMNAEVYITGSIARGEYEKSGDIDLIVSTTKPLSPHEVKFIEERLVKELNLPPSHPLHI
FT                   HTVTRDKLENFKHKVKID"
FT   CDS_pept        8071..8889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="APE_0011.1"
FT                   /old_locus_tag="APE0011"
FT                   /product="fructose-bisphosphate aldolase class I"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0011.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78920"
FT                   /db_xref="GOA:Q9YG90"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YG90"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA78920.2"
FT                   /translation="MISSQDVGKRVRLSRILPDGRSVIFAFDHGIEHGPGEIPEERLDP
FT                   RLLIREVVEAGVDAIMTTPGIARLTWDIWANRVAMIIKVSGKTSIRPQDDQFLQSAISS
FT                   VDEVVALGGDGVAATVYWGSQFEDKMLERWTRIRLRAEKLGLPALQLAYPRGPHIKNRY
FT                   AVDIVAYGARAAMETGADLIKTYYTGSTESFRRVVSAAGGVPVLMSGGARTPSPQEFLH
FT                   KVYSVMEAGGGGVVVGRNIFQAGDIRAMVKAIRAIVHEGFDPEKASKLLG"
FT   CDS_pept        8908..9840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0012"
FT                   /old_locus_tag="APE0012"
FT                   /product="ATP-dependent 6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="ATP-PFK"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0012"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78921"
FT                   /db_xref="GOA:Q9YG89"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG89"
FT                   /protein_id="BAA78921.1"
FT                   /translation="MLEHLVQAVAVGHALVDLRLYVERIPGVDEEAVIKDETRSVGGSA
FT                   ANVAVVLRRLGVQSGIIGKIGLDDFGRIAVDNLMREGVDISGLRVSLRDRTGFSVVVRD
FT                   KEGSITIYSFKGAAEKLEPGEIDADAIGRSKHVHVASLRPDTTLKTVEIAKKRSITVSW
FT                   DPGRVLSKMGAERLANIISKVDIIFVNRNEAKNLTGYHDYRQAARHLKKLGPKIVVIKL
FT                   GASGSYILYSDGEVFVPAIKPERVVDTTGAGDSYAAGFIAGLLRGYTIEKASLYATIVA
FT                   SIKVSRLGSNAAPSHEEVVEKARELGVEI"
FT   CDS_pept        9991..11652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="APE_0013.1"
FT                   /old_locus_tag="APE0013"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="DAD"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0013.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78922"
FT                   /db_xref="GOA:Q9YG88"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YG88"
FT                   /protein_id="BAA78922.2"
FT                   /translation="MKRPRSRLWYDGLENTPHRVYLRAIGFTSDDFQKPLIAVVAAWSE
FT                   AGPCNFNVLPGSLRVKEGVRSAGGVPLAVPTIVVNDGINMGTPGMRYSLISRELIADTI
FT                   EAQVASHGFDGWVGIGGCDKTQPGIMMAMARLDLPSIYIYGGTAEHGVLDGETVTVQSA
FT                   FEAVGAYLKGLIDEERLYEIEKAAMPTPGTCQGLFTANTMAILAEALGLSPLGSASPPA
FT                   TSSERARELARAGALAVGLVETGLTPRRILTYEAFYNAIVTLMAISGSTNAVLHLLAIA
FT                   REAGVKLALDDFDEASRKVPVIAALAPAGKYTMVDLHNVGGAPVILRKLLDRGLLYGEA
FT                   VTVEGVEIGKLLSKWEPRTDYNILYDFDKPYKPHAGLRILRGSLAPRGAVMKIGASGIL
FT                   KFKGAAKVFDSEEEAFKAIERGYVEEGDVVVVRYVGPKGAPGMPEMLKITAAIVGAGLG
FT                   EKVALITDGRFSGATRGVMVGHAAPEAAVGGPIALVENGDEIVIDGEKGTLDVLLGGDE
FT                   LARRRDKWSPPPLPKQGLLRKYAKLVTQADEGAVTH"
FT   CDS_pept        complement(12387..13907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0017.1"
FT                   /old_locus_tag="APE0017"
FT                   /product="carbohydrate kinase, FGGY family"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0017.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78926"
FT                   /db_xref="GOA:Q9YG84"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG84"
FT                   /protein_id="BAA78926.2"
FT                   /translation="MGGCDSILSIDIGTTRIKAGLVDCNTLEITGRGSVSTPVSYPRKG
FT                   WSEQDPEELWQAIVRASSAALEGFEASRVSGVIFSTYLAGVVLLDRDNYELTPIITWLD
FT                   ERAHGLPRELFSGVLKVSGYNLLHLVDLLRLTGGAPSKTGKDPLSKMVWLRENKPDLFT
FT                   KAHTIGTLKTWVLAKTAEARLVSPDDAHLTWLADTRGGRAVWSPRLARRYGIPLEKLPG
FT                   IAGPTDVAGGLVSSAARDLGLPQGIPVIVGAGDIASSAVGSGALAAGEYHIYVGTSSWI
FT                   GVHSTRRLLDVRHYIGSLLSAKPGEYLVIGEQEIAGGMIDWILDVTGMDYRAVEDIHSI
FT                   PPGSEGLIATPWLYGERTPIDDPHAKGVLVGLTLRHTKKHLVRAAVEGVALNIAWAMEH
FT                   MTRLAGKPKLVRGVGGGFRLRTLAKVIASALNATIETVSQPEMAGVRGAGALAAAALKG
FT                   SSIESEAGKIPVSWRAEADSNASKAYKDLLQIYQEIYSRLKSVFRRLS"
FT   CDS_pept        complement(13925..15319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0020.1"
FT                   /old_locus_tag="APE0020"
FT                   /product="putative pyridoxal-dependent decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0020.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78929"
FT                   /db_xref="GOA:Q9YG81"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG81"
FT                   /protein_id="BAA78929.2"
FT                   /translation="MDRVLRELFLLSSRDINPWTGRVFTHVYDPGMDEVRKAASKALEL
FT                   YRDKTMLDFTVYPSIIELEKQLLGFAGHLFHAPEGYSGTFTYGGTESIILAVLAARERW
FT                   RRAGKSGAGKIVMPITAHPAFAKAAYLLGLKVERVPVDSVTLQADPAIIEEKIDRDTVM
FT                   IVASAVDYPYGSLDPVEDLGDIAAARDVWLHVDACIGGMVLAFASDAGEEVGKFDFGVE
FT                   GVRSFSVDMHKYGYAPKGSSILLFRRARDKKPTIFVDSSWPGYPLVNQAILSTRSAGTL
FT                   AAAWAVARTLGVEGYRELAGMVLEARRRIQKGLESLGLEVLGRPKAGILSFTDSDIDVV
FT                   EVATRLGRAGWVVQLQPGNKHLGFPTSIHLTISPIHARVVDSFLAAVEESIRGAPEPES
FT                   RFEPALIEEGFKAVEDLLRRIENAGFDDKAVRVVNEMIYLLKPDVVAELIKEAMLEIFK
FT                   PSWPGW"
FT   CDS_pept        complement(15391..15909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0023.1"
FT                   /old_locus_tag="APE0023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0023.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78932"
FT                   /db_xref="GOA:Q9YG78"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010036"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG78"
FT                   /protein_id="BAA78932.2"
FT                   /translation="MKRDWLLLLDLDGTLWDHLDVSSLKPPFTRVSHNAIVDSGGVEVR
FT                   LYGYMVALALWARRSGAVVSSFSWNVPFKALEALRVLGASHIFHYHVIEPHPWKGRMLT
FT                   KLLRVLRVERRLYLTPGRIVYFDDREIHLDDIRESVGEVNYVKSHVDCGGLEECTRLVQ
FT                   SLLRMDAAG"
FT   CDS_pept        complement(16021..16419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0024.1"
FT                   /old_locus_tag="APE0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0024.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78933"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG77"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA78933.2"
FT                   /translation="MIIGLADGRFGLRFRGIFSKISEKKVAADIILLKLSRYSAEHLRL
FT                   YGRVYAVDPDKVKSRARNDELSLLADKLLSSIENYSVKAVLVSDGRQSIMVYHDGGVLK
FT                   ALNIRLPFIPLFQRTVLKWIAEVYGSVL"
FT   CDS_pept        complement(16416..16823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0025.1"
FT                   /old_locus_tag="APE0025"
FT                   /product="putative transcriptional regulator, TrmB family"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0025.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78934"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG76"
FT                   /protein_id="BAA78934.2"
FT                   /translation="MISREIVGKLTSLGFKEYEARVYAALVLYGPSKAGEISLRSGVPR
FT                   PRVYDVLRDLIAKGFVERTQGSPTYYRAVDPEHVIGEMRDRYVRSAEEAIIELKLPKGG
FT                   MRRSSCPYSIWRVSGVLGIVSNFLLKERSLT"
FT   CDS_pept        16932..18800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0026"
FT                   /old_locus_tag="APE0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0026"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78935"
FT                   /db_xref="GOA:Q9YG75"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG75"
FT                   /protein_id="BAA78935.1"
FT                   /translation="MSLEKSEKLVVDLRDATRKIIHMVGGKAASLGELLEHGLPVPPGF
FT                   VVTTRAYDLFVEKNGLKSVIENFSGANQAAILRRLILEGEVPREVVEAIREAYYSRGDG
FT                   RVAVRSSATVEDLPEAAFAGQHDTFLNVEGIDRVVEAVKKCWASLWSDRAVAYRESLGV
FT                   SHSKAKMAVIVQRMVDADVSGVMFTANPVTGVREEVVVNAFRGLGESIVSGVVTPDHYV
FT                   LVKTRFGWKIVEKRISGDKPVLDDRTLVRLASIGARIQRLFGTPQDIEWALEKGRIYIL
FT                   QSRPITSLPEPPPKVGRLKRSLLLMLAEFLPERPYPLEIAWIDAVFSNAVGRVASYYGV
FT                   RLPSVSDLIEEDDDGVPVRINPYFRIGVSPSIILAPARLLINTLRYNAIRWRNDSDLEE
FT                   FNKRFHMLDSRLKDVSEWREIVDIVDGILYNTVFIGELRRKYLPSAVLSAVVLRIWLSL
FT                   MGKGEMFPKLMFSCLDTKVSEANRQLERLASLVKSNGELFRIFVQEEPTNILDVIKSSR
FT                   KFEFFYRELQKFLAEYGHREASGSLLLSRGSWVEKPELVIGIVKSLLTIRKTADEDSSC
FT                   HRFEETLNSLFSTRLLRFIWLERCFSGFYIMLGSSIGLGRIHVSTL"
FT   CDS_pept        18728..19384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0028"
FT                   /old_locus_tag="APE0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0028"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78937"
FT                   /db_xref="GOA:Q9YG73"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG73"
FT                   /protein_id="BAA78937.1"
FT                   /translation="MFLRILYNAREFHRIREDTRFYAMKLVPALKKAFVRMGERLRDEG
FT                   IIDDSLDIYYLKLDEIKSIQRWPPPENMGADLRAVALARKRKMKSLSSKPFVDPRLLLV
FT                   ISRRDNIEGALVTGIPASPGIAVGTVKIVRDASEFHKLRHGDILVAPFTTPAWTPLFRV
FT                   AAAVVTDTGGPLSHAALTAREYGIPAVVGTGLATKVLKDGMRVRVDGYRGAVYKA"
FT   CDS_pept        19396..20850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0031.1"
FT                   /old_locus_tag="APE0031"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0031.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78940"
FT                   /db_xref="GOA:Q9YG70"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG70"
FT                   /protein_id="BAA78940.2"
FT                   /translation="MSPGEESRIHLTTKALSLALTAFLVMYVEAVLYTSVPAIQAELGI
FT                   SPVEASWIFTSYLVTGSVLIPLMGRLGDAVGRRRTLILILIIFGISLLLGGSVNSFRLL
FT                   LGLRAAQGVGMTALPLIYAIVREEFPPNRAPVIQGILAAMNGIGLLIALPAGGWVTENL
FT                   DWRLNFVLISPLALLSILLNIALLKDTRDLSLDKSLSGMRVSVASVLSFAALVTSLLIL
FT                   ITIHTTGESGEYAQGLLLAIFIVSLLAFRWSERRSSAPLLPISTFNRSVRLGVFCASII
FT                   AVTFQLVLFVLPYLLQTPHPNGFGLTPTESGVYMMLLIVSYAISSPLAGYLVVRVGMKR
FT                   IAYAGSLLSAAAYLAVAVKPLQSPLLEVTLVSLGFVGMAFINNSLINIVVYSADKSYLS
FT                   TTTSLYTLLRTLGSALGPLIGGLIFSMCSYSEIKTTQITSFSIDPLSYSLAFAAASSLF
FT                   LIVLAMVLQIDEPSLLKDLSPSRVLT"
FT   CDS_pept        20910..22379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="APE_0033.1"
FT                   /old_locus_tag="APE0033"
FT                   /product="phosphoenolpyruvate carboxykinase [ATP]"
FT                   /EC_number="4.1.1.49"
FT                   /note="PEP carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0033.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78942"
FT                   /db_xref="GOA:Q9YG68"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YG68"
FT                   /protein_id="BAA78942.2"
FT                   /translation="MEDVVKALAKEVLSSADIEWNPPPGLLRRESSRYAGFTKTGSLAV
FT                   VSSKARARRPDRTRVKYLRDEGFDRLVVDAWDYVVKASFYAVERCVGSGDRRFRILALV
FT                   EKSYPHLALMSHLNFFPCGSTGSYDMVTIDVPSYSDVWMLVERRSNSTLVLGSDYYGEL
FT                   KMSFLRLAMNEARDRHLGVGLHAASKLYRVRVEGSMREVGVLVFGLSGTGKTTLTVEDH
FT                   GLREPEYVRVMQDDIVILDWRGVAHGTEMNLYPKTDSVPELKKLEPAVLHPDAVLENVV
FT                   VKSDGTPDFTDLSLTRNARALAIREAIPIASGSVDLMGTNVLVFLTRRPEMPPLARLTS
FT                   PYQAVAYFMLGESFRTSAEAGKPEPVRVPGFDPFMLEPKWRSAYSLLDLIKSLNMNVYV
FT                   MNTGHAKDRKIPPELSKHLLLSLVKENVDWKLDKHMGFEIAVRAGGVNLDGYNPEELYG
FT                   ESYVRVVDLLRRDRQEFLRSIPSVSFLADYV"
FT   CDS_pept        22506..23912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0035.1"
FT                   /old_locus_tag="APE0035"
FT                   /product="ABC transporter, substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0035.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78944"
FT                   /db_xref="GOA:Q9YG66"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG66"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA78944.2"
FT                   /translation="MEAPRSLAITAGLLIVVILISLFSYLSITSRIESVEQSVSSVQED
FT                   ISEVKQRISGIEQEIKGIKEAAGGETTTPVTETEVKTETVVVEKVTLTVIGPWSGKEQE
FT                   YFMTALEKFMEENPNVTIKYVPMRAEEVARTLSVQFEAGVTPADVVITPWAWWIVEMAQ
FT                   KGHVIEVTGLINEDEYVGGILDNVKWNNKLWGVPFTMWLKPGFWYKKSFFAKHGLSEPN
FT                   SWEEFLQLLDQIKGIEGIKNPIVSGDSVGWPLSDVTEHFIIAFGGPELQYKLITGEVSF
FT                   TDPQVVEIFEKLAMLIEQGYFSEPIEWTSAVEKWWAEEYALYFMGTWITGMVEDPNDLA
FT                   FFPLPGARGVVGGTDYAFIPKYTENLEAAKLLLQYLATEGQAVHVSTPAGKVPTWLGVS
FT                   VDQLWPPMQGVFAKIKELNMTIVPDLDDTVGGNWQVLFWDQLKLLWVQPDRLSEVLETL
FT                   ASQHPASAGG"
FT   CDS_pept        23927..24823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0038.1"
FT                   /old_locus_tag="APE0038"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0038.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78947"
FT                   /db_xref="GOA:Q9YG63"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG63"
FT                   /protein_id="BAA78947.2"
FT                   /translation="MAGPPRGYFKALVFLLPAFTFITIFVIAPSIATVYLSLNVDGHIN
FT                   LEKYAEVVSERSPDKALIMITSRPESPPWGALIHNIIWMALHIPLVTFLGLFLAYLLKY
FT                   TFGSSIVKTIVFIGMVIPMVVGGLIVRFMFDEYVGVVPLVFKALGVDFLAKTWTNYPQL
FT                   SLLSLILGSVWLWTGFSLTVYSAALGSIPSSFIEAARIDGAGHWHIFWKIVFPLVRPAT
FT                   IIVVVMTMLWDLKIFDIVYVATLGGPGGSSNVLALVMYQYMARALDYQAASAVAVILTL
FT                   LTLPPGLWLALRLRRGG"
FT   CDS_pept        24838..25698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0040.1"
FT                   /old_locus_tag="APE0040"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0040.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78949"
FT                   /db_xref="GOA:Q9YG61"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG61"
FT                   /protein_id="BAA78949.2"
FT                   /translation="MLASRRLRQVLRVDVVLINLLAWGFALVWLLPFIGLFMVSVRPYG
FT                   EVIVKGWWNIVDATFTMDNYIKAWSYDPYSVSGGYINSLIVALPATVIPVAAASFAAYG
FT                   FSRFSFPLKSYLFLVTILLMALPQQIVVVPLFLLLKNLGLINTFPGIILVHSAWGMAWI
FT                   IFFMKNFFDILPREVEEAARVDGASDFRIFYKIVLPMSLPGILSASVLQFTWVWSSFFF
FT                   ELIFLIDPSKWVITQRIANMKGTYLVDWGLIAAGSVFAMAVPLAVYMLLQRYYIRGFVG
FT                   WAAKG"
FT   CDS_pept        25706..26812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0043.1"
FT                   /old_locus_tag="APE0043"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0043.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78952"
FT                   /db_xref="GOA:Q9YG58"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG58"
FT                   /protein_id="BAA78952.2"
FT                   /translation="MAEIRLEGVVKRFGKVVAVDHVDLSIKDGEFFVLLGPSGCGKTTT
FT                   LRLIAGLEYPDEGRILIDGEDVTFKDPKDRNVAMVFQNYALYPHMSVFDNIAFTLHLRR
FT                   KEMGLTKDDIRRRVIEVAKLLRIEDLLDRKPGQLSGGQQQRVALARALVRRPKVWLMDE
FT                   PLSNLDALLRLAMRAELKKLQKDLKITTVYVTHDQAEAMSMADRIAVMNKGRVVQVGTP
FT                   EEVYMRPKHTFVATFIGAPPMNLVECDVESVGEDLWISCPGFSRRVPEEARSVIESKGV
FT                   RKIYLGIRPEFISVSRRETEGSIAGKVYVVEPLGSEYVVNVDIGDGIIIKAKVLGLREK
FT                   MTPGDKVYLKLDWSKVKIFDYRTGEALA"
FT   CDS_pept        26994..28115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="APE_0045"
FT                   /old_locus_tag="APE0045"
FT                   /product="phosphate ABC transporter, phosphate binding
FT                   protein"
FT                   /note="PBP"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0045"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78954"
FT                   /db_xref="GOA:Q9YG56"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG56"
FT                   /protein_id="BAA78954.1"
FT                   /translation="MLDKKLVLTVLAVVVLLGIGLALASGWLGGEQGESSGGSGPAQVV
FT                   LQGEGSTFIYPQIQAWSEEIKKTYPWITINYNPTGSGAGQSAFKDGVVDFAGSDTPLPR
FT                   EVWSAMQGNVIQIPVVIGMLAIVYNIPGLEDLKLDAKTIALIYKGEIEYWDDPRIASLN
FT                   PGASLPHEKIVAVHRSDSSGTTHVFTIFLHKGAPDVWTEDLVGKSVDWPVDATGRGVGG
FT                   KGNQGVMEVVKNTPYSIGYVEYAYVVKAGEGVNVALVANRDDVFLKPSPEGAQAAASGA
FT                   VQNLPDSPDDDWSTGYDAIIYAPGKDSYPITSWSFLLFYKQYNDRDKAEAIKKFIEWIN
FT                   TEGQTKIIEGYIPIPDEIRQINMKAVEMISYTG"
FT   CDS_pept        28128..29060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="APE_0047.1"
FT                   /old_locus_tag="APE0047"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0047.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78956"
FT                   /db_xref="GOA:Q9YG54"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG54"
FT                   /protein_id="BAA78956.2"
FT                   /translation="MASILYRDRPFFTILFTASVISASILVILFVVLLYYSIPAFQKYG
FT                   LNLFLNSAWKSLETRPGDYGLLVPIAGTLVSAMLAVVLGLPASLSAVIFAEEVIPPTMY
FT                   RVREAFNTIVDMMTGLPTIVYGLWGVTFLAPALKGTLLEWLYTYLSFIPLFSCKPLTGT
FT                   TILTASLLLALMIVPFIYSVVRESYRQIPRTYREAALSLGTTKYEYTRLMLGMVRPAIL
FT                   AGVLIGFGRAAGETVAVALVVGNTFNMPTCLLAPSYTVSSLIANQFANASLYPYMTNVL
FT                   VAGGLFLLALGIVTNILGLSYLRKVRFYV"
FT   CDS_pept        29053..29907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="APE_0048"
FT                   /old_locus_tag="APE0048"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0048"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78957"
FT                   /db_xref="GOA:Q9YG53"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG53"
FT                   /protein_id="BAA78957.1"
FT                   /translation="MFEGRRLKEKAFILLVTLITLVTVAPLFHIIAMVTLKGSYVIVKA
FT                   GIEFFTATPGPPGSEILGGVGPAILGSLWLAITTAIIGVPLSVLTAIFIVEYRENPLAK
FT                   IAKVFSGSLLEIPTVLIGMLVFLVVVTPMGHYSLLAGSIALAIVMLPYTVSYVERALEN
FT                   VPKTYREAGYSLGMTRAQVVAKVVVGIARRGIAAGVLIGLSKVVAETAPLLFTIGSARS
FT                   NYPLYPSDLLQPGDALPLLIFQFAQTPYENWQELAWGSAFILTAIVLATFSAMRLIVKE
FT                   VKL"
FT   CDS_pept        29907..30668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="APE_0050"
FT                   /old_locus_tag="APE0050"
FT                   /product="phosphate ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0050"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78959"
FT                   /db_xref="GOA:Q9YG51"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YG51"
FT                   /protein_id="BAA78959.1"
FT                   /translation="MKLMDVRVSGLNVWITDKHILKGISFKAQPGTVTAIMGPSGSGKS
FT                   TLIRVINRLIDLIPGARVEGEVWINNMNVMKEDPYNIRRYTGMVFQEPNPFPHMTIYEN
FT                   VAIGPKLHGLAKNKKELDEIVEWALKMAHLWDEVKDRLSDYPHQLSGGQRQRLSLARAL
FT                   ALKPRVLLLDEPTANIDPVSTVKIEQSIVEYAKEEMATVIIVTHTPQQAARISDQILFL
FT                   YEGRVIEYGPTKELVLRPRHELTKKFLGGEV"
FT   CDS_pept        30668..31273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0051"
FT                   /old_locus_tag="APE0051"
FT                   /product="phosphate transport system protein PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0051"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78960"
FT                   /db_xref="GOA:Q9YG50"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG50"
FT                   /protein_id="BAA78960.1"
FT                   /translation="MSVEPARRDLEAIYSNLDRMYNIVVKIVADTLRSLEEWSINEALE
FT                   DHLYLAENLSAVVEEQATFFIAKYQPLGPELLEAKSLIRTSYDLYRIARYCREINRVIA
FT                   YTSRGGRTLKPSQQVRKAAEIVASMVGDAYKAYRSRDNELRRKVEETDNMIDKIYDAML
FT                   ERIGKVESLSQTEAVDLLIVRHLERIADHAVYIARQAE"
FT   CDS_pept        complement(31407..31922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0052.1"
FT                   /old_locus_tag="APE0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0052.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78961"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG49"
FT                   /protein_id="BAA78961.2"
FT                   /translation="MLRTIAIAAVLALVFIAIGAYAIYTSEYSDVSTLQSVTRASRVTV
FT                   QAGVAYLGYGTATVIYGGKTYTLEARGAYGILMPTDGSGSSYAFFVMEGEKGYKVAALY
FT                   ELDSFTARYGGSPVFEDTVVVDGVYRPGEELVLLTPAGEESLPVVTVNAILKGCHAAYD
FT                   SEKAVVEQ"
FT   CDS_pept        complement(32017..32877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0053.1"
FT                   /old_locus_tag="APE0053"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0053.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78962"
FT                   /db_xref="GOA:Q9YG48"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG48"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA78962.2"
FT                   /translation="MADMVVGAVDTPLGPLMGIYNTRKGCIETVEGWVQNAVGGLRGFY
FT                   FNPHSVFDKLSKSLTGDCVTLDNKLAPPVSPVSAWGVGRSYAEHAREMGMSKQIAFFSK
FT                   PVTSLTGHLNPVVVPPVSEKPDYEGEIVIIIGKRIKNASTAEAGKAIAGYTAGADITDR
FT                   LLQDMMSWSMAKGLDTYGPVGPVATIIDSPDDLDGLCVHTWLNGEKVQRGCTGDMIVSI
FT                   PDMVSRLSALATLRPGDIVFTGTPPGVGHARKPPRYLRHGDELEVRVSGLPPLRNQIVK
FT                   TPGQQ"
FT   CDS_pept        complement(33058..33588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0054.1"
FT                   /old_locus_tag="APE0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0054.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78963"
FT                   /db_xref="GOA:Q9YG47"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG47"
FT                   /protein_id="BAA78963.2"
FT                   /translation="MGVVTTLIAFTLVVYAPYVALAYRFKQRGLGRSALLVIASALILT
FT                   LASILVPVGLVSLGSILVMGLLAADFMEGRLPYPKLLGYSIAGTLSGFIATAFWSINSE
FT                   LALYYNLPAVELGYFVYDAAIESLGDPTSPYAHYTIPVFLRVPWVIILTSIASWSLVGV
FT                   CLELLSRLFSKSS"
FT   CDS_pept        complement(33674..34966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0055"
FT                   /old_locus_tag="APE0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0055"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78964"
FT                   /db_xref="GOA:Q9YG46"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG46"
FT                   /protein_id="BAA78964.1"
FT                   /translation="MDLVAALLFTLTIMLVVSRYVDEVAAALAGVTALILLTNYTPEEA
FT                   FNFVEWNVIAILLGMWIIAGYMIEGGFTEATIRLVSRSAGTYRKFLLYMALLSGFISMF
FT                   IDNVLVILLVGSLTIAAAKKAGGNPVLAILLVGFSANFMGTALLMGDLPPQLLHTIAGA
FT                   EFLDFIWTRGKPSSFPLLTATFLLTLGVFYILFIRREPNSRIDDAGLSGESTNRGGLLI
FT                   ISLTFFTMTVIAMALRPLLGFPLGFITMAGASQLALTVEVLRRLGLAGMVEFENALKHV
FT                   EWRALLFYAALFSLVGGLESEGVIEEIARLLVGSVSSDPAIAYTVMYWSVGLLSLVIEH
FT                   DALLLTFLYIVKDAASLAGIDPWNIYWGMAWSATLASNATTAAAPALYVAVAMSDREGH
FT                   RVRALEFLKYSLTFAFTSLIIHYIITLIVWI"
FT   CDS_pept        complement(35035..35787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0056.1"
FT                   /old_locus_tag="APE0056"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0056.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78965"
FT                   /db_xref="GOA:Q9YG45"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG45"
FT                   /protein_id="BAA78965.2"
FT                   /translation="MGQAPVIYEERNGVAIIRLNRPEKLNALNLEAWMQLGEYLRKACR
FT                   SGIKAVVITGSGRAFSSGDDIRSMYSLESLEDSLSFFKTLHGALEAMARCRRPIVAAVN
FT                   GLAVGGGAEILLLADVVLASREAWFAFPESHIGLIPPLLSTLGRSVFGERKARMLGITG
FT                   AKLDVEEAKAMGLVDDVVEPGELEAKALEVAESLGLIPDQSVAEIRRATVEPYRVELEN
FT                   MVNRLAELVLTKEAKERMRLFLERRKKE"
FT   CDS_pept        35926..40392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0057.1"
FT                   /old_locus_tag="APE0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0057.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78966"
FT                   /db_xref="GOA:Q9YG44"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG44"
FT                   /protein_id="BAA78966.2"
FT                   /translation="MNGNRLSPVKLAILAAIVLAAVSSYTAVAESVNIIPEDDYQSGLV
FT                   EVVIEGLDTGVSYTIAVEGGAVIVAVAGNVNVASYSENSVELVTGDGLATVYVYAREPR
FT                   VYTVSLYSGGEKVAQASFEIQQLSGESDPPPDIVVDDSLELAVSTSLLTGSPPPSGVEI
FT                   LAPFIPSSDGAAVVYVTGSITVDDRVSISVDTNKTREYGVDALLLIGASGGVPGEKADI
FT                   TVQQGAVLGFKASGDSGFVVKLSSFNLTLDGVLEVRLGGLTGLELEYLTIKDASRGRVK
FT                   LFLPSYSSLGDALATGNYISLHNVEGFINVVQVNSDPGKILAVRLELSGPPWPGLELVS
FT                   KHHNVPLYIVEGPASQMEFLRIRGVGVLALEPDSILKLKLPLEVVLEGSYFVKQLPLAA
FT                   VTVASTHPTEDLPLLLAPSVEVSSKSGSGGYFAIAGIWLEAEDMSIGNEGSLYLTALSY
FT                   AKLDVDTASINSSTTIIGRPPEGILPVAPPEADTILNTVDLNVEAEEIIARDAILKAED
FT                   IEFVAGSGGITMGAVLAEAQNLSLKSNGDAVSATVSASSLLVGDIVLSNNIEAVFSTTI
FT                   LTSPIETRISLGRNTSLTTYSLLSHSPLIVSGSTNGSSTFTGTASVSTKLGLFNLNTPD
FT                   LTIYVSSGVLELEAYKTRGSITIMREGKASIELNTPDSQLSLLIAIWGGSITLEDSSFK
FT                   KFTVKTTRDDLTIFMKGVVRVYEEASFEVSYWSKLRVKGVDGELSASSLIMTAPEGEIT
FT                   LEDTLISGVNNFRVDESEAMPYRFETSNVTVEGGSNSAITVKSVETIISSTTINATVIT
FT                   VLSETASIEGSSIQGRTLNIQASNGLVLQDNTLRGEVNTILSSQTGSVEVKKLTVEGCS
FT                   QITLDGVEGYVEFSASCGGQSTLAIQFNGGVYTLTGEVEGELEVSLSNGARLTMSMLEV
FT                   KGGGLRIVGGEDTVVEGSASLVVECIARASATSLEVSGLTADLNIVVRGAMEPICVDLV
FT                   ASPLGGSISLSSLEDLSLNIITMSNVSLTLLSEGAISVVLPQNDVPLDSPELSVASSGS
FT                   LEVTGGFVNVDSLTLKGQSVVVNRAHANASSIEISGENVSIEYSEFTVERLNISYNRLY
FT                   VRNSNIAVEKLDILGDITYYTEPGLSVILNTRVSGLQGGPGFELELLGSNNVLIVNSEL
FT                   SPSAITQKETASSTIAFTSSKVATENLEVSASHESGLSLVAIASQIDINGMLSISSRGV
FT                   KLSLLSSSFQAGGCSLEEGSDIISVDSRVNAGCNVTKLIEEAVAYAWGAIAGDFSVGYE
FT                   SSAAIKVGGINTIVYYTALEDSTIYVTLVPESREALVLTASIATIDCSDKLLVDELGGT
FT                   LLTVAQAVEEGGECMLRFTTALSGRNTWLISLKDIEPDSVETTTVTETLTTTLATTETE
FT                   YQTYTLVETETSTSIIYSTLTETVKETVTSTSTIKSPVVSSITITTTETITAPTSQNYL
FT                   WIAAGLIVAILAASAGYVVLRRLFLAS"
FT   CDS_pept        40405..41106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0060.1"
FT                   /old_locus_tag="APE0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0060.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78969"
FT                   /db_xref="GOA:Q9YG41"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG41"
FT                   /protein_id="BAA78969.2"
FT                   /translation="MTHYKTEVLRVVVVEALRRARSRGVTYRELAEATGVDETLLARYV
FT                   SGRVMPGARQAERIWKGLLDILGPARLLAESLEKGRLDVEAALGDPLFVVMSQLYFLDR
FT                   IKARVDRILVPEAAGIGLATALGIALGVHVVVARRTKEYTWAEYVEAGFEDPASGRSMI
FT                   FYARKDLLSGAEWILIVDDIVQTGRTLHAMEKIVESVGGRVAAIAAVIVVGSEWKRFVR
FT                   SRVIPILEIAR"
FT   CDS_pept        41221..42510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0061.1"
FT                   /old_locus_tag="APE0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0061.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78970"
FT                   /db_xref="GOA:Q9YG40"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG40"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA78970.2"
FT                   /translation="MSMNRRDFLKLAGAAGAGLVVGGLGGYILSAPRKQQSQAPTGGGL
FT                   SLKALWIYVGPVEDYGWTRAHHDGHMKARSKLGWLESSYIETVSEDKAYDVIKAQLDAE
FT                   GYDAVFATSYGYMDALKRLATEYPDVKFYHCSGPWEEFRDLPNVSTYFAEFYQLYYLNG
FT                   LAAAGATETCNLGYIPAFLIPEVVRHINAYVIGAVEGAKVLGKCGDGRNIRVLVTPPLN
FT                   SWFAPDKARDAARLLVETYDVDVIAYTEDTTAVLETAESYWDQGVKVYSFSHYTDMYAY
FT                   FKSQGKTLRSHLTGQISDWGPIYVDLLVRQAAGVYEKIDIWARLGDYTPIRWAKSPSES
FT                   LAGSPEGAVYLAPLNTEAIPAKMLEHIKLRYEQMKELLFEPFTGPIRGYSIDAQGRPQE
FT                   DPKLKVREGERLGRNPLWVMDWLHENAETL"
FT   CDS_pept        42608..44086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0063"
FT                   /old_locus_tag="APE0063"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0063"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78972"
FT                   /db_xref="GOA:Q9YG38"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG38"
FT                   /protein_id="BAA78972.1"
FT                   /translation="MFKGLAVEDLDVVYPGGVHALKGVTASFPAGVVTALLGENGAGKT
FT                   TLLKAIMGVVKPRKGRILVDGYELRPKGPGDSLRSGIYMASQNPPVYPGIKAYEDLAVT
FT                   LMVAGRKAGLRQARTMLAEASEALGLNIDPDRYLGEMGFSERQRLEVIKALALGSRAVL
FT                   LDEPTTHLTPEEAARMLEAAGRLAASGAAVLLVTHRIGEAMEHADRLVILRKGVKVYEG
FT                   PPPSSTEEVAKLMFGEVLAPREPKTFTAATSTGRPVLSVDRVSLPPRLRMARLEVRQGE
FT                   VVGVAGVAGNGQEELFEVIVGLRKPAKGRILIAGVDVTRAPPLARRRLGLGVIPEERLG
FT                   HALVPGESIAFNIALSIHTARDGFIVDWRYYEKLAEEMIRDMGIKAVSPRQMVDELSGG
FT                   NMQRLVLARELWLKPRLLVAMNPAAGLDLEGQQAVAEMMRMSSERGGVLVIDEDLDFLL
FT                   RVSNKIYVASGGIVKGPYLPTEEKSIVTAMGGLE"
FT   CDS_pept        44083..45018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0065"
FT                   /old_locus_tag="APE0065"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0065"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78974"
FT                   /db_xref="GOA:Q9YG36"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG36"
FT                   /protein_id="BAA78974.1"
FT                   /translation="MRRTASIGVAVLSTIIAGIMLSFIGPGPAAFVEGLIKAATTPSLV
FT                   SYSVIYAAILVAAASGLVLSYRAGLITIGVEAQVTASAVAALYALAYAGLGLPGALTLA
FT                   AIVSLAIGIVIAALRVYLDVNEILSSLMINYIVLYMVNGLVSGPLREGAFTKTRSIEAF
FT                   VGPLEAGLAAVSMAALSWILLERTSLGISLRASGPAPRAADIYTIGRARAMLLSSLPQS
FT                   LAAAAAGLILLGGIQTVFTALKQPQGYGYAAVLVSWMAELSPTTLIPVSLFFAWIAGAG
FT                   FILQAYGMPSSLVLLLQSIALTVYMVARRL"
FT   CDS_pept        45034..45867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0067.1"
FT                   /old_locus_tag="APE0067"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0067.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78976"
FT                   /db_xref="GOA:Q9YG34"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG34"
FT                   /protein_id="BAA78976.2"
FT                   /translation="MISAVLTTLIPLSLAALGEAVLERTGRVNLGVDGLMAVGAAVGAL
FT                   AGVETGSLLAGLAAGALAGGVGSLSYIILTDRLGVNMIVAGLLVFFAGIGLGDLVGSKI
FT                   AGRPGPVLTSLYTTAATIGIAAVALHLILYNTVTGTALRVVGENPAAAKERGVPVWRLR
FT                   LSAALVQGLSAGLAGYIMVAGLSYGKWYSGVTAGLGWVALGIVILGYWTPIGVLIASTA
FT                   VSTVFSMRTQIAAATGIPPLADAIPYILVLILLAAGTHLYERIGLRPPASIWRRR"
FT   CDS_pept        45961..46422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0067a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0067a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34707"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E94"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAF34707.1"
FT                   /translation="MKIAIASEKASEPVFRVAGGHFAHAPIFLIYKVDNGVPKLEEIRE
FT                   NPLAAIPDEDAGGDVHHHHHHKGLHGPSKYKYLKDNVLSDVNLIIAGGACMTSIAYFLS
FT                   EGVSLSFADPGTPADEVLKAAVEKASEGKLPEISVYAWGKLVDPDEIEE"
FT   CDS_pept        46629..47108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="APE_0069.1"
FT                   /old_locus_tag="APE0069"
FT                   /product="dUTP diphosphatase"
FT                   /EC_number="3.6.1.23"
FT                   /note="dUTPase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0069.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78978"
FT                   /db_xref="GOA:Q9YG32"
FT                   /db_xref="InterPro:IPR023537"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YG32"
FT                   /protein_id="BAA78978.2"
FT                   /translation="MFLSGRDLVLLGVVKGHSNGAIQPAGVDLSVGEIESLADAGFLGE
FT                   EDKIMPKGDRIQCEYGVCELEPGAYRLRFNEVVSIPPGHVGFCFPRSSLLRMGCYLGCA
FT                   VWDPGYTGRGQAMLLVANPHGLRLEMGSRIAQLVVARVEGPLTSLYKGDYQGEGL"
FT   CDS_pept        complement(47135..47677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0070.1"
FT                   /old_locus_tag="APE0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0070.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78979"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG31"
FT                   /protein_id="BAA78979.2"
FT                   /translation="MTGPLPSSTEEKTQEPTIEPATYAEQQAKDLASDNTAMPETYLLE
FT                   KFTPSKHLSKVACNPMVVALSLIGGSVIARVRGKTITSLISIIERHLTLSRNPGNSMII
FT                   FIVSGDSGKRLHIVLDTSSRELGVCVKELASYLNDPGVGKKASVKGLESIIDKISNVAG
FT                   DIIILWVPKSILGLQRG"
FT   CDS_pept        complement(47940..48599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0071.1"
FT                   /old_locus_tag="APE0071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0071.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78980"
FT                   /db_xref="GOA:Q9YG30"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG30"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA78980.2"
FT                   /translation="MLRRPSGPGRDKMPYGQKIVPKFIIYAAEGLQKVDTKGWRLRIEG
FT                   NVEKPLSLAYSDLLELASDRGRFDFHCVTGWSVMGRVWEGISLKHLIHMAKPRPSVNWV
FT                   AIVSTGGYTTVIPLEESLRDESMVALLLDGRPLPEENGYPARIFIPSLYGWKHAKWVEK
FT                   IVLLDEYVDGYWEALSYHERGRVSLEERFKVRNVEVAREGRLLGKPRPLKPGTILE"
FT   CDS_pept        49294..50331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0072"
FT                   /old_locus_tag="APE0072"
FT                   /product="heme exporter protein C"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0072"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78981"
FT                   /db_xref="GOA:Q9YG29"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG29"
FT                   /protein_id="BAA78981.1"
FT                   /translation="MARLTNAIPFIAVSIIIADLAIAVYAAYEGPFPAVVPLGSPLAYR
FT                   NIYIHPPVAFTTYIIFGLAGLASALYLWRRDVRFSRLALYAAGLGVIYGFTTLATGIAW
FT                   ASESWGAPWSWDPKQTAVLLMLLAYLGYFPLRSSIGDPERRELVSSVYLVASLSLVILS
FT                   ILANRVLESLHPTGEAVRDFASDFQAGWMFGARMILAIGTGLSMIVLSYMKTGLPRPLL
FT                   TLVAIAALLSLASAVYMAAPLLEGEYYRVVNAEVGSNGLVYSITVVKSDGSEETIRFST
FT                   PVESPVKPATTTDGRPTLTGHIIVLSGDGSLRVLPHWSTPLSLALYTIAVLAGVEIARR
FT                   SSKGG"
FT   CDS_pept        50407..52197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0073.1"
FT                   /old_locus_tag="APE0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0073.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78982"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG28"
FT                   /protein_id="BAA78982.2"
FT                   /translation="MIPAIERLGRSEVVEISARSSDLEWGRRRPEYSIFWWPGRRLVGG
FT                   VRAVLAALSVPDPGVVVDAVDGRGFEKIRSYTSGKLIVDPFSGGGTIPLEASRMGYKAI
FT                   GLDSNPYAVSVAKASSTLLDGRCRGKAVCLLEAAQRAWRKVSSLWCGDWFCIIHILLAR
FT                   CPPCEAPAWVSRWRNGSYLVLDEGGLKTVSGIRVTPNKPRVSLPEGLPEEAPGYVAYAA
FT                   EVLTPKGRRWVYLGDGKLGEMVAKYLRSTLPAARSLTEALSGFPVPPGKETSKLLASGI
FT                   SDFKYLYTPRQLATISAFLGEAAQADCSLEAACIAGSSSRAASLLAMYYQPARRVNLAF
FT                   VLKTYWLPINPVELNPLANTCMPETPRIHCKPVGRGGIWGLIKRYIRGCGESGSSPEFR
FT                   VWDSHRGLPEGIRPYAVVTDPPYPGMQSYGQLSLVYSLPHVLSGLPAPHSWSEIDSMSR
FT                   SYVEDLSRALSASGSLVESGGYMVLLLSSGTNRGATIIARLVYSLANDSLKLVTILPLA
FT                   GESPGRLGRSLNKVVYVVVFKRGTPYSRNPLKPLEWTAEVAEAAGYGPKEASVSREIAS
FT                   ILASKLEDLLETSSQCCRQY"
FT   CDS_pept        complement(52159..53010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0076.1"
FT                   /old_locus_tag="APE0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0076.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78985"
FT                   /db_xref="GOA:Q9YG25"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG25"
FT                   /protein_id="BAA78985.2"
FT                   /translation="MDRRSSELLGVAAALTAALLWSTIGVVQRLAEARGADTETLIVGR
FT                   TLGGSLLALALLAIYRAVPTRRSFAVAVLGLAPLYYTYMMSVSIVGAAVASLLLYTAPA
FT                   WVALLGTVFLGETPSVRDVVTIILGLAGAALVSLGGEGKAGELRLLGIVLGVASGFFYA
FT                   LYIVMARFFQSRGAGVMEVSLAPIALTGPLLGVALKPSLPPNSVEVAASIYFAVFTMVT
FT                   PYLLNVYALRRIEAHRVSVMSLIEPLSAVLLAVLLLGEDLTALQALGGVLILAAALGAS
FT                   FK"
FT   CDS_pept        53276..53791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mogA"
FT                   /locus_tag="APE_0077"
FT                   /old_locus_tag="APE0077"
FT                   /product="molybdopterin biosynthesis protein MogA"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0077"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78986"
FT                   /db_xref="GOA:Q9YG24"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG24"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA78986.1"
FT                   /translation="MSSEPRWVSGLSLNYCMVITSDKVYAGLKEDRITPLVSSTLESRG
FT                   RRLAAVTKVRNTFEEIVSTIASMASRRECDIILVTGGTGPGPRDVTADAVSRLAIYTLP
FT                   GYGEEFRRLSASEVGPRGLLSRAEAYVLPGGTPVFTTPGNPGAVSLALKIILGLDTHLV
FT                   DQLKGKGH"
FT   CDS_pept        complement(53788..54009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0077a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0077a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34708"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E93"
FT                   /protein_id="BAF34708.1"
FT                   /translation="MPLGSGLLKSRLASIKEELESLEPFSKNVWPLVRAAEKALEEGDV
FT                   EAAEWLALIAEIRTSYARYWAAKNRRRG"
FT   CDS_pept        54129..54527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speH"
FT                   /locus_tag="APE_0079"
FT                   /old_locus_tag="APE0079"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /EC_number="4.1.1.50"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0079"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78988"
FT                   /db_xref="GOA:Q9YG22"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="InterPro:IPR027549"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YG22"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA78988.1"
FT                   /translation="MERREDVIVGKHVYGSLYGVPREKATDEEYLRGVVVRAAESAGAT
FT                   VHAVNSWTIPGEKGGVSVIVLVLESHLALHTWPEYDYATFDIYTCGEHTDPWKAFELLL
FT                   SELKPRKYTVHYVDRSQEKTVLEAQPRR"
FT   CDS_pept        complement(54512..56533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0080.1"
FT                   /old_locus_tag="APE0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0080.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78989"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG21"
FT                   /protein_id="BAA78989.2"
FT                   /translation="MSIMSERIHSAYSKANRMGEVVGRVTRYSPVTTSPGSIVEVEVDT
FT                   VKYFSRGGVRIGDYLCIVDPKTLHIILGVVSTIKRADELALAGVDVPLTPNSSPGPTSP
FT                   ESILTSPIAGVRLLLEADPDSGLEPRPVSTPIEPQSPVFDPSPETLRYMLGLPGGGVLL
FT                   GALSSLYGPVKGGSVAVRLPYKALLHHTLVIGTTGSGKTTLLKNMIASLTSEDGDFIVP
FT                   IILDMNSDFIQLPIPSRGESDLEVLRSVRPPRKTVIVVPVSVDAASDALELDRNIYSGV
FT                   AQLYHEDVLSQLVSSGGKWNCIERPEGVRCESDRLPFIIVPYFIDSVRRGNMPGESLSQ
FT                   LAPGMTRLSLELLRSLRERFYRYSGRAGYPPLYVLSSALSAYIEASRRNSEIEDVVSSS
FT                   LESMSAFMVGLGGGSNLSQARVEPLGLGMRSLVDLVLEILSSIRPHRSTAEALYRKIQG
FT                   LMDSGVVDVSIVENSRIRVLLEPSWRFIIELAADARAPVVVDLAWLASRSGSSVFAPRI
FT                   LGYRVLQSILRMRQDEWARRRVSKQLLIIIDEAHQFFPQERGGYEEQEASRQVASMISS
FT                   MARLGRARGIGFVFSTHSPNDLHDIILQLSNTKIVLRTEKAHLEKLSIPADVKDAVPYL
FT                   MDRYMIVTSFVFRGGYVLAATGKPVTMHTDFSSIYLRG"
FT   CDS_pept        complement(56575..57759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0082.1"
FT                   /old_locus_tag="APE0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0082.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78991"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG19"
FT                   /protein_id="BAA78991.2"
FT                   /translation="MLAIEVVSEIASTVTGKLGEARLSNRPLSLEDLMIISEEGIEDVE
FT                   NVIIEEYYSYPLKTVKIKEAGSLGDVYAIDSSSRTVETPLHLILIGAVSLSSRLKRLEA
FT                   DYPSFEKPLVSLNIRPYLVLDRLNLAGEPDPHLGDAYSDILRFSLENAMLSYLLERLIE
FT                   DRYPEDYASAVIIDGPILNGSILAKLSTRIGDVWSELYRERQRIIASIEALGVPVIGYV
FT                   KRIEASTLLSRANAYLELLEDCLGFAPRASDSAIIEAAVGYGCHKWRPGYALKSLLSRV
FT                   VYGNGDEKLFEYLILPGGRYQLFSPKRRVYRIEYTRHSLRLLEGYGFRPYHIVLSETLL
FT                   RGSLEPVTLARSDRRARSISMALKRIVLSGLKSKGARVSYSMLFEGDVWWRTVT"
FT   CDS_pept        complement(57823..58536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0084.1"
FT                   /old_locus_tag="APE0084"
FT                   /product="NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0084.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78993"
FT                   /db_xref="GOA:Q9YG17"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG17"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA78993.2"
FT                   /translation="MEDRGCCFSVISRHRSVRSFSTEPIPQEDIRKILEAARRHVSPWN
FT                   IQPVHVTVVTDSKLKSRLSDALWGQEQIKEAPVFFVFSVDYAKVLESIKLLGLEAREPG
FT                   LTELLQGYISASVALAWSIAVAEDLGYVVNIIAAYGNPCEVADILGLPSYVVPVAGLLV
FT                   GKPKGELPPLTPRAPVEALAGWNSYGDLEDKVKAYMSLGEKFVNNMWRVHRHGGPVDRM
FT                   DNVIRECLKSRGFRV"
FT   CDS_pept        complement(58607..59266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0085.1"
FT                   /old_locus_tag="APE0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0085.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78994"
FT                   /db_xref="GOA:Q9YG16"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG16"
FT                   /protein_id="BAA78994.2"
FT                   /translation="MLVELHSHTTVSDGFQTPMEIVKIAAKAGLAAIAVTDHDTFRGSS
FT                   LAKRAAKLLGGVAVIPAAEVRSEWGDVVVLCSNDVSDDFPRAIEELREWAVERGCVTIA
FT                   AHPGYSRYHGIPLDAIRRAASLFDAIEVWNAYTPPHFNFMAIRLAEDLNHTPVSGSDAH
FT                   VPSMVGVAPALVDSDNESAEGVVEAIAKGRARPTIGFPGLRAILENIGWSLYRIIE"
FT   CDS_pept        59379..59825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0085a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0085a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34709"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E92"
FT                   /protein_id="BAF34709.1"
FT                   /translation="MLKPGDKLPPLTGRSINGSYIRLTSEHLPPGGAVIVVSTSESRLK
FT                   PFERLQDEFYRLKSSILAIVPGRPPAKSRLRSLGKLTIIYDPGLEYLTMIGLARRSFLK
FT                   ISRVKDAVIIVDDSLRVKAIFMGSKFENLALRALEVLRENLGSG"
FT   CDS_pept        59910..60401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0086"
FT                   /old_locus_tag="APE0086"
FT                   /product="thiol peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0086"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78995"
FT                   /db_xref="GOA:Q9YG15"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG15"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA78995.1"
FT                   /translation="MPGVGEQAPDFEGIAHTGEKIRLSDFRGRIVVLYFYPRAMTPGCT
FT                   REGVRFNELLDEFEKLGAVVIGVSTDSVEKNRKFAEKHGFRFKLVSDEKGEIGMKYGVV
FT                   RGEGSNLAAERVTFIIDREGNIRAILRNIRPAEKHADLALEEVKKLVLGKKAERAGEVI
FT                   "
FT   CDS_pept        complement(60406..60720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0087.1"
FT                   /old_locus_tag="APE0087"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0087.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78996"
FT                   /db_xref="InterPro:IPR018686"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG14"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA78996.2"
FT                   /translation="MGLKTWECSICGGTIIEGQRFTFIPGQGAVHFECLAESTLKKPSG
FT                   DAVALLDANEVLLYTIVRLKEAARIAESEEIKNSIDNVRIEVERLAGILSKKLVEAVKG
FT                   "
FT   CDS_pept        60867..61838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0088.1"
FT                   /old_locus_tag="APE0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0088.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78997"
FT                   /db_xref="GOA:Q9YG13"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG13"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA78997.2"
FT                   /translation="MSSERVTLFKRRVQKLGGSSLIITLPKQWINKMNINAGDVLVVVD
FT                   EGEYLKIIPENFSPPVRSLSVSINSLPKDDEEKVRFIKCAYGHGYDRVTVFTENTRNGG
FT                   VALFKNGEILDRMAKELPISKISVSSNAVLIEFSRDSDDSINPSLKLKLYSGALNAVLD
FT                   NIAKGRIDNAEEDLAKLYSLSLDIARSSVRKSLGFSCETSRLTYISGFFLALAETISLL
FT                   TDYLSSGRRLSRKDIDLLEDTRSLLLETLGSLATGSVKRVEHAKEAAEKLREVLVSNGE
FT                   NISTPVYSLSVNAVSLVRTVAELSLCKLKEKEQGDLVGIRVK"
FT   CDS_pept        62549..63997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0089.1"
FT                   /old_locus_tag="APE0089"
FT                   /product="probable peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0089.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA78998"
FT                   /db_xref="GOA:Q9YG12"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG12"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA78998.2"
FT                   /translation="MKSGENSRYDFYPPDPVLLEKLVEKALDKGASYAEARFHARLGDS
FT                   VLVVNDRVVGGGFEIEEGVAFRVIVDGALGFASTSLLSEESLDSVVDHAVSIARSSSRG
FT                   FRKKVGMSEERLGQAQYSLKVKKDFRNLELEDKASIVLEYSKSLESKSVDLKAKTFSYS
FT                   DVLEAKLIITSDGGNIESIIPRVSIFYNIAAEHGDRRANKWGHLAGSGGLELVGELGLE
FT                   SMLKDDVNSLEVNLVKAEPSPKGVMDVIISPEIVGLALHESIGHPSEADRVMGREAAQA
FT                   GLSYRMWLDGRIGSSKVTVADDPTVPGSYGFYLYDDEAVPARERILINKGELAELLHSR
FT                   TTAYSFGVQSNGAARAMNYRSEPIVRMSNTYLKPGDMRFEELLEDVKEGIYMKSYMEWN
FT                   IDEFRLVARYVGLEAYLIKNGRIVKPVRDTVLEIPTESFYSKIDGVGKDLRFYAGICGK
FT                   GEPPQPLPVWMGGPHVRVRDVRVG"
FT   CDS_pept        64012..65361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0091"
FT                   /old_locus_tag="APE0091"
FT                   /product="probable peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0091"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79000"
FT                   /db_xref="GOA:Q9YG10"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG10"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79000.1"
FT                   /translation="MAPGEVTERERLEEAARTILNALPGDAEKAVKIVGSKSIMVKAAR
FT                   GSVSVAQGFQDLLLEIYLARDGKIAVTSFKTPRLDDAAKIAARVVDKLEKSPLYAPLPE
FT                   PSGSSSQAVDEKVATMVAEGDTAGLTSLLDPDRWGDISGMAELAVTTTVLTASNGAELT
FT                   LEKTSFNGYTRIFGREFRSGQWSWVSTRFDEKLAEEAIRTAKQLAEECSKLPEEVPEPG
FT                   SYRLLLSPMVGGNLLEIVASSLLAGSVLLGFSMFSHNKPGDRIASDALTLSSTPLDDEL
FT                   PGYSMFDDEGVATRDIAAIENGVLKTFLHNTKTARLMGAETTGNAGWILPRLFNLQVDP
FT                   GDISPDNVYEALGDGLYLTNNWYTRLQNYLEGRFSTVLRDAVIRVRNGKPVSCTPGYKL
FT                   RLAGSLKDLIINVEAAGSKPYNIMWWEVNRPFKLPHIIVASSPGIEVRRG"
FT   CDS_pept        complement(65371..66471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0092.1"
FT                   /old_locus_tag="APE0092"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0092.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79001"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG09"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79001.2"
FT                   /translation="MVLKIVYHEDFLKHSPDPYDHPENPSRLVEAVRGLEESGVYKHLE
FT                   AVTPPVGDVGLYTRVHSPAYLRHVLSTAESGLDWLDPDTYVGPGTLVALKRLGGASVEV
FT                   YNIVRSGGEALLLGRPPGHHAGIRGRALGAPTAGFCIVNTAALIARMLSEQGKTVILDF
FT                   DLHHGNGTQEIFYDDPDVYHVDVHQDPTTIYPGTGFPEDIGEGDAKGTKINIILPPNSG
FT                   DDIYVSAARLALGILERLEPDYIVVSAGFDAYRGDNAFTVMRGGTAMYYLIGSELSRMA
FT                   RRGVAAVLEGGYGVGLRRALPAFAAGLANLENPYPDTEEESPPSVKRMYVAGLKRLAAA
FT                   IKGLNRVVEEAVLEELERGGWEKRYG"
FT   CDS_pept        complement(66579..67616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0093.1"
FT                   /old_locus_tag="APE0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0093.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79002"
FT                   /db_xref="GOA:Q9YG08"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG08"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79002.2"
FT                   /translation="MSANDSARTFVFIPRKVQRLGASSLIVTIPKEWAKRNNVDVGDVV
FT                   SLVDIGDRLIILPTNTTRRIVVHFDGRHKRIVKHVSKLVLCGFVFGQDKIVISSPRQGT
FT                   IKDIIENLQNLMVMLPYIYITGKDREVVIDLDSPVEEPWHALKVLGRHLIGYSENLLKI
FT                   LGSDDEDVSSFTMESTVTEIYRSNYRLLRAVTINTARGGIESIMGLYFFLYAAMLAAAT
FT                   DEIHDLGREIIKLKDRLTWDERERLKFIVEMLEVALATLSANMDPNSVKKVEEAYWKIR
FT                   SVLDLKGDLSKIVGDGSTAFAYLVARAVNVARTLEIASNIMMCHMLTQKYSTLMNESSN
FT                   SEGSS"
FT   CDS_pept        67976..68473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0096.1"
FT                   /old_locus_tag="APE0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0096.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79005"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG05"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79005.2"
FT                   /translation="MVLEARSYRLVLRKTTRGPVVQFRVSVPGARESTLVRMGGRMAER
FT                   IFNHMAEVLKKHNLITEETKSENYTAYRLNLDIGPSVGGYLVMIRRSRNPEAWINYFEG
FT                   LITEDPYKGGRAFLAHALHLSVELSKSMGAERTRAQLPPKVLDSVSAGFKVISKKLWSL
FT                   KK"
FT   CDS_pept        complement(68480..69124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0097.1"
FT                   /old_locus_tag="APE0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0097.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79006"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="InterPro:IPR018036"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG04"
FT                   /protein_id="BAA79006.2"
FT                   /translation="MRADGKAMLHGRLYAGIDPSGGRSSWGFAVVSWLPGRCHIIEAWE
FT                   SRPSRVYSSLERLASIPVDAVGVDAPVNVLREAGPWRGCELEALKKGARLLPLNTPGMV
FT                   RLSRNGLSVFRLFEEAGVPVVETHPTSILSSLDLANTAYRRRHLLDAIISAVAVGAFFE
FT                   EPASVRAALGDCILIYSVGEHIGRECGLSGKKQVLEETIKKVLKEKRTWQR"
FT   CDS_pept        complement(69239..72118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0099"
FT                   /old_locus_tag="APE0099"
FT                   /product="family B DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0099"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79008"
FT                   /db_xref="GOA:O93745"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/Swiss-Prot:O93745"
FT                   /protein_id="BAA79008.1"
FT                   /translation="MRVRGGQEAAQDKETSLDSDEERGRRGLRQTTLLDYMAGPAKPKK
FT                   PEPPPTLHREREPESKYQNTLPETTGKEPASMSLRRNQPSSKHEEYNSESGDVRGLTLE
FT                   PSPQSELSDDDVILELVREPWVESVRGYLLDVRYDGSLGKAVLMLYDPSSGSLVKWADR
FT                   TGHKPYFLTDARPEDLRAAGVDVSHDESFLQYDLVEKFHPIDRKLVKLTKIVVSDPLAV
FT                   RRLREKVSSAGFSVWEADIKYHHNYIFDRQLIPGILYEVGGVRIVHTLPLEMDDATRIV
FT                   DEIFREEPREVRERAREWLRIFEAPPPKLPLIAFDIEVYSPIATRLPDPSTAPYPVISA
FT                   ATADSSGRSRVVLLYRDGVEFTEGALPEGTEVEIYDSERAMLLDLVRILQRYPLVVSFN
FT                   GDNFDLPYIARRLEVLGVPREFAPIELKQDYATFRRSLHIDLHKLFGIRALQVYAFGNK
FT                   YRELSLESISRALLGKGKVELKAPVSELNLNKLIEYNLQDARLTLELLTFSNNLVFNLI
FT                   IMVMRTSKLGIEDITRSQISNWIRGLMYWEHRRRRWLIPSRGEIEKLSSAGARVGAIIK
FT                   DKKYRGAIVLDPPVGIFFRVLVLDFASLYPSLIKQWNLSYETVNNPNCRDTIEVPEVGH
FT                   RVCREFKGISNEIVGMLRDFRVRLYKKKSKDKSLREEERLWYDVVQSAMKVYINASYGV
FT                   FGSEKFSLYSLPVAESVTALGRAVLRGTLEKSRELNLHIVYGDTDSLFIWDPPKDVLND
FT                   LVDYVERTYGLELELDKVFRAILFSGLKKNYLGITEEGDIVIKGMVAKKSNTPEFIKDE
FT                   FSKAVKILSKLEKPEDVEAILAELRDHINTVYNNVKKKVYTLDQFAIKVMLSKNPREYD
FT                   KNTPQHVKAAMLLQRLGLTLSRGDIVYYVKTRDKLGVKPVQLARLSDVDPGKYVEHVKT
FT                   AFEQMLMAFGISWDDISGVRKLDRLLFDS"
FT   CDS_pept        72760..74778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0101.1"
FT                   /old_locus_tag="APE0101"
FT                   /product="putative iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0101.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79010"
FT                   /db_xref="GOA:Q9YG01"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YG01"
FT                   /protein_id="BAA79010.2"
FT                   /translation="MSSAVLLYSLVEFYRRVFRGYAPLEAAENTGGLRATVDRLVWYGL
FT                   LQYKVLRHRFPGIMHASIFYGILVLFIATIIRALDYYIGGWLLQPPFFYVYKLANNMAG
FT                   ILVIVGVTMAAYRRWRGLTPGLPRDPGYYLVLALLAAIVVTGFVVEGMVVALYRYGEGF
FT                   ESPLYDPVGYLVYLALEGVDRDILVEAYRGLWLLHLAMAQLGIALIPFTNLWHIPAVLA
FT                   NIAFARPGPAVASLRTYEDLDERIEQDKPIGVVKLSDTTWKQRLDFEACTSCMRCTNSC
FT                   PAAESGKVLDPRGVVYGLRLKLREGDWESEVLDPENPGDGSKAGVNPEAIWSCLTCGAC
FT                   VNECPVLIHHVDIILDVRRGMMSTGSEHVPEQVLNVLQNLQYNGNPLGQSPLDKEEWFQ
FT                   ELGEKLGDEVIAREGEEYEVLYWAGCVTGYDPRIRPVGESILRLLRKAGVKAAIMPYTG
FT                   CTGEPALRMGEEALFVELMIQFLEELSKYKFKKLVVNCPHCLTTIKHDYRRYKRYLEKR
FT                   EDAKHLTEVLDRLEVEHHSVTLARLVREGKLKAAADDGKPVTYHDPCYLGRWNGVYSEP
FT                   REVLRRGAGLRIREMPRNMEKSFCCGGGGGQLFYEVKRGRRVSRIRAEEASQTLGGEGV
FT                   VAVACPFCNTMFRAEAEEFGFEVKDIAEILDKEGSGG"
FT   CDS_pept        complement(74775..75242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0103.1"
FT                   /old_locus_tag="APE0103"
FT                   /product="small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0103.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79012"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFZ9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79012.2"
FT                   /translation="MSEYGFDDEFRRIIMRFYQALREAEETFSTMTRLAIGELREFEEL
FT                   LEQRLQEFQGEGIEPIVSVDDLGDRLRILIDLPGMDRESLNIVVLEDRVEISARIREHV
FT                   VKRALGSLSEKFSFREYRGVYRLPAPVDPRSVRIRTRGSLIIVEADKKAAV"
FT   CDS_pept        complement(75287..76066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0104.1"
FT                   /old_locus_tag="APE0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0104.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79013"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFZ8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79013.2"
FT                   /translation="MNSSIVYREEIYGWEFLEFEHLEDVKFMIVGLPDVGLVGAITGMH
FT                   LIRSKDMSYTVGIDHYGALPPVVIMNRGRVLHPIRIYRSGDVAALITDVPILPAAIPSF
FT                   SAAVVEYSRRRGIEYIISATGVGNPKRLEQEKPSLYWLASDKKASLLASSLRMASEPEQ
FT                   GIIVGPYAIILKEAMKKHVHNLVLLADSFIDIPDPEAAAVIVEGINSITGLNVSVDELI
FT                   KQAEEIKLRMRDLMKETKAVMARMGKEMEYRAPILYT"
FT   CDS_pept        76192..76416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxA"
FT                   /locus_tag="APE_0104a.1"
FT                   /old_locus_tag="APES001"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0104a.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79014"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFZ7"
FT                   /protein_id="BAA79014.2"
FT                   /translation="MIKVVIEPRESCMPDFVCVAVCPEVFEKHGDGRARVRGGLGEGFF
FT                   DRSLEACASEAARLCPRGIIRVYRVGDDG"
FT   CDS_pept        76470..77261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0105"
FT                   /old_locus_tag="APE0105"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0105"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79015"
FT                   /db_xref="GOA:Q9YFZ6"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFZ6"
FT                   /protein_id="BAA79015.1"
FT                   /translation="MQLASWRLLARTIKNVDVVVEVVDIRDPMVTRSRRAERMAEALDK
FT                   RLLIVLNKSDLVPLRVAEKWARIIEGMGFDVIYVSARHRLSTRRLRGFIKHLADVKPFS
FT                   AGVIGFPKTGKSSVINALRGRKGAPTSPIPGSPGYTKGLQLLKIEPGFYMVDTPGVIPV
FT                   EGGWPESIIRGRSPEDLPDPVPPAAALIEKILRYNRRAFQAAYGITAQDPYEIMERLAV
FT                   KRGWFYKTTKEPLIEEAARTIIRDYHKAKIPFYVPPEEFTR"
FT   CDS_pept        complement(77364..77735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0106.1"
FT                   /old_locus_tag="APE0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0106.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79016"
FT                   /db_xref="GOA:Q9YFZ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFZ5"
FT                   /protein_id="BAA79016.2"
FT                   /translation="MQPGSIGLDRLARVLALLLALGFCAFDLKSLLTGPRLPTFILAEN
FT                   LLYAIALGAPALAYRKPVSPIAIAVVGAFAAGRVSRSVVTSEGTLGELALPHIPLLLAL
FT                   AAAALLAAAALYRRCVGSG"
FT   CDS_pept        complement(77777..79417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="herA"
FT                   /locus_tag="APE_0107"
FT                   /old_locus_tag="APE0107"
FT                   /product="bipolar DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0107"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79017"
FT                   /db_xref="GOA:Q9YFZ4"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFZ4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79017.1"
FT                   /translation="MSSESSICGGDEIGVIIGESSYSYSTILLERDSLGKVIVGSHVVS
FT                   TLNGRCVLGIVESIRSGLPLLGDEVRDLDSVKRMLESDVASVVESTRYHVARVRWVSYL
FT                   ETLLERGEQSAPKIPPQPGSTVRLARSEVLGRVFSPEGDSWVRIGSLLGSGVEYRIDVN
FT                   KLTRHLAILAVTGGGKSNTVCVITRRLVGQLGVTTVIFDRHGEYGTLGLGAGEARLLRP
FT                   ARVNPASLSYWELLYMAGFEPQATAQKRVLRWLWGELARRYRQGKIGAADLIPKAVEVL
FT                   EKASRSSKSSKQDPGSLARAFSEVLGDEPSNAPAVRQDQILGVLDKLNDLQDLYGSALD
FT                   PNIPIDLTRIIEPGKATIMDLSMMEDNVADAVASHYLRRLLQARVNSRGEGLSGLEVYP
FT                   VPVITIIEEAHVLIPRDEPTLTKRWAARIAREGRKFGVGLVIVSQRPKKLDVDVLSQTN
FT                   NKIILKMVEPQDISYVRAASEELSEDLASLLPSLNTGEALIMGSMARMPAVVKIDKCEA
FT                   PTGGRDINIVEETRRWLSREEDSLEELAL"
FT   CDS_pept        complement(79401..80606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0109.1"
FT                   /old_locus_tag="APE0109"
FT                   /product="5' to 3' nuclease repair protein NurA"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0109.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79019"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFZ2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79019.2"
FT                   /translation="MKTVHRTIADEAREVRPLVEGLLRERREKSIMCPGLLGFRPIEIW
FT                   EGMDNIVAVDGGNRSRDYREFTIYLARAWAGGGGREALLHSLGVVVPPSDAEARISIYR
FT                   EILEAVVAKEAVPGGGRGLLLLDGSPSTALKWWRPGLSRWGLKMSAAISEAEKMLPSIR
FT                   GQTLIPDCVEGGCVETLLEKATRRPASNRAAMILATLTDNIEQLRWIVAVEVAEKLYMY
FT                   KTMLEEAWARGYTPVFVAKTSRSTEICRGPIADAAYIEARAPQSPSYAVAREDLMVKVG
FT                   LNNMLGIEVGEGDGRFIPDVAGLRKFYENLAEVSTYARLAPGGPILRVSILLPGGDKKL
FT                   GDHLGLLESILSRLANFSPSGYPVPLLIAHEKARVSGDDLERASLLLGLSLKEVSRGVL
FT                   RI"
FT   CDS_pept        complement(80633..83392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0110"
FT                   /old_locus_tag="APE0110"
FT                   /product="DNA double-strand break repair rad50 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0110"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79020"
FT                   /db_xref="GOA:Q9YFZ1"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR022982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFZ1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79020.1"
FT                   /translation="MYVLKRLELRNIMSHFNTSIDFREGFTAIVGRNGAGKSTILEAIL
FT                   FSITPHQAPRRSSMISENSSRGEIYLALQSSEGRLLELRNKLIRRGGGTNTEAAIITLE
FT                   GRRIASKPTGYKEEIHKILGLRGLPNPASYIEKAIIISQGGLQTLAEILSEPKELRDLL
FT                   DAALGYALLKQAISNIGDVVLGVSPDGSPVKLGSKSITRLQSGYMTLRNEVLGVDREIR
FT                   EASKRLEELEREREELERRARDLESEAKALQSEIGKLETMEEMLVNVTSMIRSERSKLD
FT                   TINTRLRYAESKISSIDDLEKRRAELRAKASLAHEVAELARLQSRLDKLGRDLEMIRDA
FT                   VEKLEVSRRLKEIESARREAENRLLEARSSIKEEQRRYTLLDYRVTRGRSIVTNIRRVL
FT                   SECRSKDLCGSEKPESVLERLDAVINDLESKARALDQEASALEAEARRLVQALSMLEES
FT                   GGSARCPVCGAELPPGRAEAIARHYRHEAERLRKAAKEKAAEAEKARAEASRLQDKRRR
FT                   IELLLSRLNQLEEGLRELGFQTPEDLAKAEQKLRMLRERLEELRKLENSLEEKVRNLSR
FT                   EEVALREAKTRALEVLQRLGIKEEEAREKLKTLSSESKKLERMLVSKAEDLATRLGITA
FT                   YRSLDDLLEKAREALEGVDKELSAIERRLEEARRLKEEAAKLKWEAEQVMKRLEELEAE
FT                   EKKLRKEVSRKSEIEARLKEVQNTLAELDDRISRIDREMGELQTRIREMKSRKASGEEA
FT                   LKLYLPAAASRRIMEEIGEIAYRRLLAVLEDEMNDILSRFNLDVAGVEIREKAAREIEV
FT                   KAIGGNGAYRPLEAVSGGERTVLALSFVLALNKAVGGKLGFLALDEPTANLDEDRRRSL
FT                   VEVLRGISVEGLVRQLVVVTHHEDVRDYADTICLVTRTQQGSRVECTY"
FT   CDS_pept        complement(83399..84628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0113"
FT                   /old_locus_tag="APE0113"
FT                   /product="double-strand break repair protein MRE11"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0113"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79023"
FT                   /db_xref="GOA:Q9YFY8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032885"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFY8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79023.1"
FT                   /translation="MPKVLHVADVHLGARPYGLEERRDDIFRSFEFVVETALKDRPDAV
FT                   LIAGDLFDKPKLPLRDVKQAVELVRALTDAGIPVLAAHGEHDTPSVRDETLLSLMEASL
FT                   DGFKAPLYRSGMRPGDFVVDLGSLKVAVVPFFKVPLEERRRLTLRFLREFDQISRTSSG
FT                   TLVLLAHMSLDAEMQFDAVASPSDLPSGAKYAALGHLHAPRIRLDAPTPYAYPGVLDPL
FT                   KVEEINTPGSPLYVDLSGDAPIIEKVKVPRRPQYRIEVDIGDGGSIYNAVNRGLRRVLA
FT                   NVRASREDWLKPLIHVIIKSDKPISKARVIAEARKAAGGADVLLKIHWKIVAGGEHAGT
FT                   SPGLQGEGPLDLAKIAAEYYKIPLNAASTILHDLAEAAAEKDELRVREILETLATTVSQ
FT                   DTWKRILYMR"
FT   CDS_pept        complement(84782..84934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl40e"
FT                   /locus_tag="APE_0113a"
FT                   /old_locus_tag="APES002"
FT                   /product="50S ribosomal protein L40e"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0113a"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79024"
FT                   /db_xref="GOA:Q9YFY7"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR023657"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFY7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79024.1"
FT                   /translation="MPITDPELVAIFEKRVLNKKVCRRCGALNPMSATKCRRCRSKNLR
FT                   PKKKK"
FT   CDS_pept        complement(85004..86056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fen"
FT                   /locus_tag="APE_0115.1"
FT                   /old_locus_tag="APE0115"
FT                   /product="flap structure-specific endonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0115.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79026"
FT                   /db_xref="GOA:Q9YFY5"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019973"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR023426"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFY5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79026.2"
FT                   /translation="MGVNLRELIPPEARREVELRALSGYVLALDAYNMLYQFLTAIRQP
FT                   DGTPLLDREGRVTSHLSGLFYRTINLVEEGIKPVYVFDGKPPEMKSREVEERLRRKAEA
FT                   EARYRRAVEAGEVEEARKYAMMAARLTSDMVEESKELLDAMGMPWVQAPAEGEAQAAYM
FT                   ARKGDAWATGSQDYDSLLFGSPRLVRNLAITGRRKLPGRDQYVEIKPEIIELEPLLSKL
FT                   GITREQLIAVGILLGTDYNPGGVRGYGPKTALRLVKSLGDPMKVLASVPRGEYDPDYLR
FT                   KVYEYFLNPPVTDDYKIEFRKPDQDKVREILVERHDFNPERVERALERLGKAYREKLRG
FT                   RQSRLDMWFG"
FT   CDS_pept        86208..86765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0116.1"
FT                   /old_locus_tag="APE0116"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0116.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79027"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFY4"
FT                   /protein_id="BAA79027.2"
FT                   /translation="MIKGVYADKLLEGRKTTTIRLGIVKPRYREVIIHGHGRPLAKAEI
FT                   VDVHVKKVSELTLEDARRDGFRSVRELIESLERVYGYKLDPEDAVTIIHLRVKQRFDNL
FT                   DLSDPYLGLEPADIARLGLRYLGDSLSDEEKRVLEDLTRTNSIRATAVRLYGSIERRGR
FT                   VRRVLRRVLQELLRRGLIKGEK"
FT   CDS_pept        86999..87286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0116a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0116a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34710"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E91"
FT                   /protein_id="BAF34710.1"
FT                   /translation="MGYTLNEQLTDITICPRCSAPSAIYRYSISSERSNEGVYVRIVYS
FT                   MKCDICGYSESMRGSMPLSVAYKLRHLFIPRVKIALEKTYLLAEKLEKRA"
FT   CDS_pept        complement(87535..88800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0117.1"
FT                   /old_locus_tag="APE0117"
FT                   /product="misacylated tRNAthr hydrolase"
FT                   /note="ThrRS-ed"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0117.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79028"
FT                   /db_xref="GOA:Q9YFY3"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR015011"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="PDB:4RR6"
FT                   /db_xref="PDB:4RR7"
FT                   /db_xref="PDB:4RR8"
FT                   /db_xref="PDB:4RR9"
FT                   /db_xref="PDB:4RRA"
FT                   /db_xref="PDB:4RRB"
FT                   /db_xref="PDB:4RRC"
FT                   /db_xref="PDB:4RRD"
FT                   /db_xref="PDB:4RRH"
FT                   /db_xref="PDB:4RRI"
FT                   /db_xref="PDB:4RRJ"
FT                   /db_xref="PDB:4RRK"
FT                   /db_xref="PDB:4RRL"
FT                   /db_xref="PDB:4RRM"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFY3"
FT                   /protein_id="BAA79028.2"
FT                   /translation="MRLLYLHADRFEYKTVKPALKNPPDPPGEASFGEALVVFTTVEDG
FT                   DGPQTVMYAASDIASHSSRLKVTTVILYPYAHLSSRLAKPMAAHKRLIELEGALRTKFP
FT                   GHVHRAPFGWYKSFSIACKGHPLAELSRSFTEAGALQPWPAVEDYKTGLSGEVLARAGL
FT                   LGGGSLSPASWALEVHRRLAEEVVGPAESVGFGESLSEAYQACISSSVTTLLMGPYPPS
FT                   IVFGPLEDDPVEAVSRVLGLISPQLEGVKPLLSGGEGALKASSPDGAELPVAFLKEGRV
FT                   CLGPTLSFFKLAVSMLVEKARKEGLTPYLNPTLTPVQSAVIPVDSESEGYAQRIAEDLA
FT                   ASGVRVSIVRGSGLGRRVREAGRSWASLVIVVGKREEETGTVVVRRRWEPGKQEVLTLD
FT                   ELSSEAKKLASGSRGSLYSTTL"
FT   CDS_pept        88998..89957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="APE_0119"
FT                   /old_locus_tag="APE0119"
FT                   /product="DNA repair and recombination protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0119"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79030"
FT                   /db_xref="GOA:P0CW92"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR011938"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CW92"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79030.1"
FT                   /translation="MGEDKREIKDITDLPGVGPTTAQKLMEAGYTTLEAIAAATPQEVS
FT                   QATGIPILTAQKIVDAAREALNIDFKTAYDLKIESMNIKKITTGSRNLDELLGGGIETK
FT                   TITELFGEFGSGKTQICHQLSVNVQLPEDKGGLEGKAVYVDTEGTFRWERIEQMARGVG
FT                   LDPDEVMKNIYWIRAINSHHQIAIVDKLFTMVKNDNIKLVVVDSVTSHFRAEFPGRENL
FT                   AMRQQLLNRHLHQLMRLADIFNVAVVITNQVMARPDVFYGDPTQAVGGHVLGHAPGVRV
FT                   YLKKSRGNKRIARVVDAPHLPEGETVFAITEWGIRDPE"
FT   CDS_pept        89933..90673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0121"
FT                   /old_locus_tag="APE0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0121"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79032"
FT                   /db_xref="GOA:Q9YFX9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFX9"
FT                   /protein_id="BAA79032.1"
FT                   /translation="MGYKGSRVERRKACNTRRCLGSAPIIDTVVFTPHILPAAVATILL
FT                   SVAGLMDAIWREIEPAYWYLAVKTSILAFAASLYLEGGLASTPSKALVHVSLTLILVAV
FT                   SLALFKLCLLGGSDVAAFILVAVSSPYSPGLPIPPLAVALIASAPLAAMYIAVSHVRLR
FT                   RRGGLLTPEDLAFDPRFKWWIPRVEGEVVERFFHGCRLDADPPALAALTGLRVRAEPGI
FT                   PLVAFMALGYLAYVAAELLAIQPI"
FT   CDS_pept        90727..91260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0122.1"
FT                   /old_locus_tag="APE0122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0122.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79033"
FT                   /db_xref="GOA:Q9YFX8"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039383"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFX8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79033.2"
FT                   /translation="MSRHVWVKRWYSILWAPWRMKYIKQAGSREGCVFCEAPSMGDDAK
FT                   ALIVYRGSLSYVILNKYPYNSGHIMVTPYRHVAELEDLTMDEIVEMAKLVRASVKALKR
FT                   VYAPHGFNIGVNIGEAAGAGIAGHFHIHIVPRWRGDSNFMLTVGGTKVIPESLEDTFKK
FT                   LKPAVEEEARKEGV"
FT   CDS_pept        91264..92262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0124"
FT                   /old_locus_tag="APE0124"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0124"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79035"
FT                   /db_xref="GOA:Q9YFX6"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFX6"
FT                   /protein_id="BAA79035.1"
FT                   /translation="MENGFNHLFIITHTDLDGIGAGAVAVRLLGRVDGGYTVVFAEPYN
FT                   LHNSIEDILDHLGKGDLIIISDLGANRESLPRAADLLASATSKGVAVKWFDHHIWSNDE
FT                   LELLRRAGVEVTVDTSTCATGVVARYLTPDGGDGFIKQFVDAVCSADLWKWTHPLSGKL
FT                   FRVVGERNQDMEWKHKVLAKFAAGVMWDEELEKRLEGYVNEELRGYTTAIKNAVTIKIH
FT                   DLRIASTYKNFRGPPSSSMIGALLLHRYNADIAIIVRSDGGLSLRSRRVNVQPIARELG
FT                   GGGHPKAAGAKIEVPLLVRLASRLYPKILSLYAARLVAAKASELSLIEATG"
FT   CDS_pept        92399..93850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0125.1"
FT                   /old_locus_tag="APE0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0125.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79036"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFX5"
FT                   /protein_id="BAA79036.2"
FT                   /translation="MNRGRRTTVAYPLLLSLLILLSIVCQAAHAQEPTLRHPPELKDPI
FT                   TSLLNSGLIPTLSYSDYAMLAKQLSEVMSNAIAEALQGSLVSDNDLDAVVAMLGASEAL
FT                   SRMPEEYTPRAEAVVEEAKRAVEGLEVFLLAYGLDEDEPYASKTIAVGLLDSGGEPRIV
FT                   VMGPASHVLLTLVNAVIIDRDVVVLFPVSSQVVIMSAQSGGLPSGVEIGPGRPGIEDKI
FT                   RDEFLPEEVKESYSRGVSGQTVNGEYQDSENEGGEDKIVDISSLLKELASRLTKQGGQG
FT                   SGDTGSYLPSGGAVGSGTAAIVASPIGKLGITYEDFARIADILRLDLPEAQAEGDLEGG
FT                   EVLVPVSPLERAGSSMGLVLTAVAVLGVITLTASYAPEIRRTLSARLAMSRGSAAASAA
FT                   EVCYRAALEVLETQGLRRMPWETPREFLVRAEKSLVDEQVYAMRYITWLYELHRYGGLK
FT                   PSPGEAEECMRMVEALRARGRDGDR"
FT   CDS_pept        93855..94856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0126.1"
FT                   /old_locus_tag="APE0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0126.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79037"
FT                   /db_xref="GOA:Q9YFX4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFX4"
FT                   /protein_id="BAA79037.2"
FT                   /translation="MLTVFLILIAILGSMEIRPRALILSIATPSDAPLPYNDGPLGVSD
FT                   LASSLENMGYSVTVLPEVDDVARILAGPGGERLVFIVIGADSLRGDVLAKMLTVLADNG
FT                   DARVSLVYADEEPPLPLDSVEWKRLQTSFCGQQYFSLGEVEPAESLIVSTSDGSISVLT
FT                   GFAAPLVLEIYGGISYASKPPGGEEVFLYAWPSLGEVRGFWYSLGGVCGGEDRLVVIGD
FT                   STLFLNNYYSRSEGYAHIASLIMAKAAPESEATVVFVQELYISQRERMNVAVMLAPSVL
FT                   LTAAADLYSTLESGVRAFIGETPLKPAFAGSVAVFLLAVLPLFVKGRRRQVG"
FT   CDS_pept        94864..95808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0127"
FT                   /old_locus_tag="APE0127"
FT                   /product="conserved hypothetical protein MoxR"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0127"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79038"
FT                   /db_xref="GOA:Q9YFX3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFX3"
FT                   /protein_id="BAA79038.1"
FT                   /translation="MERVTQAELGWSLEVLARVKREVARFVIGKEREVKLALATMIAKG
FT                   HLLVEGVPGVAKTTLAKALAGAFGLRFSRIQFTPDTLPSDVIGTHVYVGNGFVFRRGPV
FT                   FANVVLADEVNRANPRTQSAFLEAMQEGQVTVWGETHRLPSPFIVLATMNPIELEGVYP
FT                   LPEAQLDRFMARIRLGYPTRVEEIKIIEKGDEVEDLNVEPAASPEDLKRLQDTARRIYV
FT                   DRKLVEYIADIVRETRRIEEVEIGASPRAGIHILKLSRALALMSGRDFATPDDVKEAAR
FT                   AALPHRLKLRKVYISKHSSEGLVEDVLKKVPPP"
FT   CDS_pept        95774..96889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0129.1"
FT                   /old_locus_tag="APE0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0129.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79040"
FT                   /db_xref="GOA:Q9YFX1"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFX1"
FT                   /protein_id="BAA79040.2"
FT                   /translation="MRMFSRRFRRLSPRDIIGGDVTLRRPSVAEALAVASASFIASFYV
FT                   SGETILLAAGLALGGLAIASSLPARAGRVFIAGIRLEFMIPGRIVEGEVRTGRLLVENR
FT                   TLNPMVLKIILKPEEGLEVEPERAEVHAPPLSRRSISLVVKPRFGRYKLIASIEEARSP
FT                   LGLWSLQPEQPQTAVEVLATPKPEVVSEDISVLTGPGSLDRGREGSGLDYRSFREYQPG
FT                   DDPRSIEWKLTGRRGAPVVREVEGAESSKPVRLVLAIRPQHYRKPLYNSPYGAAARRLY
FT                   TISMMLAEEGVRHSVLLPGARGFQELEISTPRDTLELGLALAIYTPEDPPIDYAYLIED
FT                   LARRDSPVIVVSPKGTLGEIVDKDRVYVLEV"
FT   CDS_pept        96896..97999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0130.1"
FT                   /old_locus_tag="APE0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0130.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79041"
FT                   /db_xref="GOA:Q9YFX0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFX0"
FT                   /protein_id="BAA79041.2"
FT                   /translation="MSRLRIALALVGLAAALWLRDLHLYYLDYRGLPPAVSGITVVDLE
FT                   AVTRTIVDIASLSLAVSFIVSPAYSLAVGMIWAAADAILWLDPQAAVYTAALSLAIYTV
FT                   ANLASHARNIKQLVFGLLELAPLAVPIAAACLLYIIIERLPFILVSRGVLRGDTALLAT
FT                   VSGATLAWDFAAAAASLFLVGLIAPRIYIDILTFMGGSRVAVALAREEALESLEDEARG
FT                   SFEHLSSYLASLLASMLLAPLVRDLLKDLSYALVGWIHWILAEAAALLPLVILFYVIKR
FT                   TIYVMVTGRLDSALQILSVILAASLLASAVSSQTLLLEALTGIPASESSLGRLDYVALP
FT                   EAGLAIEYSLRRLDEVLSIVVRLFWGG"
FT   CDS_pept        complement(98101..98646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0131.1"
FT                   /old_locus_tag="APE0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0131.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79042"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFW9"
FT                   /protein_id="BAA79042.2"
FT                   /translation="MRRRRIDDYIHPGDPEVRAGPLDEELRRQLTDIGERLSRIEKRLD
FT                   EVEGLLKAILRLLKSSEKRGGLPRRGGGLEDRVLDAIEREGYILVSESRTKTGLSPAAL
FT                   ISLARSTGLIILDAGGDVAVLTPESYTRFRGMLREISTSDPEEAASRLGEYGRLFLLLR
FT                   KKGTVYYDAKEGGWRLLE"
FT   CDS_pept        98849..99163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0132.1"
FT                   /old_locus_tag="APE0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0132.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79043"
FT                   /db_xref="InterPro:IPR007355"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFW8"
FT                   /protein_id="BAA79043.2"
FT                   /translation="MAMFYIRRVETPEGLVMVLVTDEDVMERAVYDEERGVRIIVSRSF
FT                   YGGSLGTEADAIKTIEKADIIVLTGEKSVSIGVRMGLVNPDSVLEVKGIKQVQVFKFSY
FT                   "
FT   CDS_pept        99284..100084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfB"
FT                   /locus_tag="APE_0134.1"
FT                   /old_locus_tag="APE0134"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0134.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79045"
FT                   /db_xref="GOA:Q9YFW6"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFW6"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79045.2"
FT                   /translation="MPDIAVLVKASLNPDMARIGPDDSVDLNSIPLKISDIDRNAVEEA
FT                   VKLKEKLGGKLYAVSVLTWGPVKLRNKDLRLAVQEALAKGVDEAIVVADDELTPGDQTT
FT                   TAKAIKAALEKHGVKPELILAGEATIDEVTSQVPGRLASLLGYKYLSFVRKLDVDNGRI
FT                   IAERDLEDYIEVVEASLPAVVSVTQEINEPRPPTLLQIRRAARKPVKEYSASELENVGK
FT                   PVRRIVQIRGVQVKRKQQIIEGDNLEEIAEKLIEALAREGVLKL"
FT   CDS_pept        100104..101030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfA"
FT                   /locus_tag="APE_0135"
FT                   /old_locus_tag="APE0135"
FT                   /product="electron transfer flavoprotein alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0135"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79046"
FT                   /db_xref="GOA:Q9YFW5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFW5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79046.1"
FT                   /translation="MKVLAVAYDPRDFGELATGVRDSLGDAELVFLAVHKAAEEPGKAS
FT                   GYSEKVFVSRTSSPESIALLLEKLISEEKPDIIVGEAYKNLRDALSRVAGKLDLPMATD
FT                   VSSFSVENGKVKFRKGFLSEKAVMEAEIPKPAVILFLTRFTKPKEISPESQARIVELEP
FT                   PQGETKVVETRPKEMGGANLEEAEIIVGVGRGFKSKEDLKLAFELAELLNAQIGCTRPI
FT                   AADLKWLSEDHWIGISGKRVAPKLYLAIGISGSPQHMSGVQNAKIIVAVNKDKNAPIFK
FT                   QADYGVVADLYQFIPVLIKKLRERKSN"
FT   CDS_pept        101126..102256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0136.1"
FT                   /old_locus_tag="APE0136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0136.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79047"
FT                   /db_xref="GOA:Q9YFW4"
FT                   /db_xref="InterPro:IPR012443"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFW4"
FT                   /protein_id="BAA79047.2"
FT                   /translation="MAELFIPDEPIIEVTAVLSAILILVLVLPFKVRIVEENLEAFFFI
FT                   MGLLGVATIYYYGILPTPDSLIGLFIKAFKTPLAIAHVGPIPIGIVQAVVFFGLVFYFF
FT                   HKHIYSILASTMEKVGIPVFAFILTFLLGLISSVISVIVTAVILAEIAAALNISRERKV
FT                   KYVVYASFAVGIGAALTPLGEPLSTIAISKLNAHFTYLIDILGVYIVPGIAVSAVAAAY
FT                   SLRGEVYREGLVKFVYEESINEILLRGFRVFLFVAALELLGASFTPMVKWYFAQLPSWA
FT                   LYWINTISAVVDNATLTAAEMGPFLTEEQIRSALMSLLISGGMLIPGNIPNIVAAGRLR
FT                   ITMNEWARVGVPFGIALLLAYFIVIEVLDIHITLSF"
FT   CDS_pept        102380..103879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="APE_0137"
FT                   /old_locus_tag="APE0137"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0137"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79048"
FT                   /db_xref="GOA:Q9YFW3"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFW3"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79048.1"
FT                   /translation="MAKASAESLGGTVASEESIASYIGAGILSSGGNAVDAAVATSLAL
FT                   TVLIPHLGGVGGDFFMLYRSPEGRVFFVNGSGFAPRRLTREEVLGRGLQEIPESGPLSP
FT                   TTPGYLAGLYHSWRSFGTMEWASLVKPARLLASRGFPLPPSTARSLKLRRECLEADPGS
FT                   REAVLKTLPREEGSPARLPGLAALLSGVEEDPLYLYQGEPAEALEEYLASIGGVMGAED
FT                   LAGTRGFTAEPLYSEYRGWKVWEMPPNTQGVTTLHLLMLLEEEELPEPFSPERVDILAG
FT                   LARMAYSIRDRYVGDPRYMPIDPHELARKETLLKLLGQEESNGSKATGDTTFFAVADRE
FT                   GGIVAGIQSLFYPWGSCVTEPRFQVTLNNRARGFTLKEGLPSTLRPGAFPLHTLSSVIM
FT                   EQRERVIALGASGGHLRPQQHALFVTNIVDYGMNVLDAINAPRAVWDPGRGEILCEEGF
FT                   GCRPSWRKVERIGVANAVEVAGSVKRGYTDMRGDGLPAVAP"
FT   CDS_pept        103961..104827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0140.1"
FT                   /old_locus_tag="APE0140"
FT                   /product="ATP-dependent universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0140.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79051"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFW0"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79051.2"
FT                   /translation="MAKVLEHILLPLDLSEVSKPLAISVAELASRHKSRVTLLHVIEEA
FT                   MVIHVAAGYDVSSLIRSIEKNAREKLDKIKKLMMEKGANVVVYEDIPVGNPGTVISEVA
FT                   EEVGATEIVMGSKGLGIFRILPLGSTVRETVKISRKPVIRLKTYKENGHVKVAYSPMLF
FT                   RKILVGADRNTSKSMIDYAVNAASTDDGKVILAHIIEPPLEEPSYEVKNVFKYGEKAGE
FT                   ERGVEVEIVVARGRPDKMLTAIASQMDASSVLVGRTVERRLSELILGSTLDRLMTLCEL
FT                   PLIVYPL"
FT   CDS_pept        104888..106090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0141.1"
FT                   /old_locus_tag="APE0141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0141.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79052"
FT                   /db_xref="GOA:Q9YFV9"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFV9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79052.2"
FT                   /translation="MVEKVLATGVGAAKAARGSSIIYRKWVRGTGGLISGDLVEVIDRN
FT                   GSEIACGLWEENTPVAVRIIHWGKCLERSPEEALERALEAAYKARVRSKWAVEFDSYRL
FT                   INSDGDRLSGLIADVYKDVAVVQSSSPAIDRHISYISQAIRKFTGVTHVYEKSVQRSRL
FT                   DIGLEPRRRWLMGRRKEVVIEEGQARFIVDVERGQKTGFFLDQRVNRLELARVAGPGDS
FT                   VLDVFSYTGGFGIHALLSGASKAVFIEEDAHAVKLLRKNLRLNGIQENKALILNTSIWK
FT                   AIQAGEPRESFDIVTVDPPAFIQKPGQEAKKRGFRAYKSSYLFALERAAGNSIVYLSSC
FT                   SYFLSREEFITLVTEVASALEKEYRILGDVRGASPDHVYRGEEYLSYLKGAFIHIDPSV
FT                   T"
FT   CDS_pept        106321..106863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0142"
FT                   /old_locus_tag="APE0142"
FT                   /product="putative transcriptional regulator, DtxR family"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0142"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79053"
FT                   /db_xref="GOA:Q9YFV8"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFV8"
FT                   /protein_id="BAA79053.1"
FT                   /translation="MSRGRADTAGDCSKNGRRSRILHYLMAIYLLNGLPGGEYARFIKI
FT                   ARLLDVSPSTVSIMTRRLQMKGLVELIPNMGVRLTEQGLKILSNYLWKSAILEVLLARA
FT                   GVDIDNCRGMGLRMAEGLSDEDAWILYKVLGEPKYCPHKKPIIPPDEINAENARQIALC
FT                   CGISILQIPNNRLQPPS"
FT   CDS_pept        complement(107051..107722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0143.1"
FT                   /old_locus_tag="APE0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0143.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79054"
FT                   /db_xref="GOA:Q9YFV7"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFV7"
FT                   /protein_id="BAA79054.2"
FT                   /translation="MGLESWAKKWNPPESTTETVGQKLRNFISPPPPIRNQIIQAVYRI
FT                   QGQISKLDYSLAKLQSYDKMLFEKVVNSLVEGDKSKATMYANELAEVRKMAKVIITVRY
FT                   ALERVRLRLETAMVFGDVNATLAPAIVALKQVAGHLKGMMPDVFTELMEVDESLQAAMM
FT                   QMTAHVPIALDNAYVSEEASKILKDASIVAEQRLKEHFPDLPSFEKVAAQGERTSEGNG
FT                   K"
FT   CDS_pept        107854..108594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0145"
FT                   /old_locus_tag="APE0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0145"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79056"
FT                   /db_xref="InterPro:IPR041461"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFV5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79056.1"
FT                   /translation="MAIKVDTFYGVIGSEVRDEYERVVGTLVSFSSNVDGEIQSIELKI
FT                   VDRGIERIPGGRVKIVDGKIVVVPEWKYEATRVIEALERAYKRRRAVENIAKQSSIPSS
FT                   IVENMKRQLTEEIKRLKIKAEEAKTRIKERIAEIDDEMLHIAGATANLQMLYFSGEISD
FT                   RSYTSGMNHLRKLNDSLEREKSDAKRVLDKLEKTYEAATNVLEAPAPSKPEGEKSIQAK
FT                   GEKQGPGKAPEKRDGELIVKIEEA"
FT   CDS_pept        complement(108844..109683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0146.1"
FT                   /old_locus_tag="APE0146"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0146.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79057"
FT                   /db_xref="GOA:Q9YFV4"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFV4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79057.2"
FT                   /translation="MKTGAVPKGLRVAVLGVGKIGGAIVKSLLSCGAVVTGTGRRRETL
FT                   ERISRLGAEATVDNRLAAKVSDVVILSVKPYQLPRLLEEIRDVMEGKIVVSVVAGVRLS
FT                   TLSRALEGSHVYRAMPNINALIGRSTTAVAEYTGDKRASFVESILSCMGSVYWIPEEWM
FT                   DVWTALVGSMPAYVAVMIDSLTLGGVSAGLPREVAFKAVIDTLGATAEHLGKRDIHPSV
FT                   LRDEVTTPAGTTIEGLKVIEGEGVDAALIRTVEAAARRAAAIGEAIDNEVRRSLNLR"
FT   CDS_pept        109785..110336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0147.1"
FT                   /old_locus_tag="APE0147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0147.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79058"
FT                   /db_xref="GOA:Q9YFV3"
FT                   /db_xref="InterPro:IPR012091"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFV3"
FT                   /protein_id="BAA79058.2"
FT                   /translation="MESSLTFLLLPVGFPGEVLVTLARRAREAMPVPSLWLASTDPLEP
FT                   PIEAYSWERMQFDAEKVNEHIHSVLYDYVREGIRIIGVVDADGYIPGFNFVFGLASTAL
FT                   GVATVYTRRLKTGGNGLYTERLLKEVLHEAGHLLGLDHCSNRECVMSFSRSVEEVDRKA
FT                   PLFCSSCKAKLVLKYGSRGQ"
FT   CDS_pept        complement(110340..110774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0148.1"
FT                   /old_locus_tag="APE0148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0148.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79059"
FT                   /db_xref="GOA:Q9YFV2"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="InterPro:IPR022952"
FT                   /db_xref="InterPro:IPR023572"
FT                   /db_xref="InterPro:IPR036820"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFV2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79059.2"
FT                   /translation="MQCGGWMHEEHTADVLVIAYGRTLEEAFENAARGVYEVVTDTSRV
FT                   EPRRRVDASIEGIDLENLLYRFIENLIAYTDSEGLVFGLFRVCKIECNGESCSIVASAW
FT                   GEEFDPSRHEHRTIVKAMTYADMEIKEENGCWRVQFVVDI"
FT   CDS_pept        110845..111534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="APE_0150.1"
FT                   /old_locus_tag="APE0150"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0150.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79061"
FT                   /db_xref="GOA:Q9YFV0"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFV0"
FT                   /protein_id="BAA79061.2"
FT                   /translation="MGKGSIRDKISGEELLRLLRDNLRVDWREYVALVAYETDGNPFAV
FT                   LAAVVLSQNTNDKNSIRAYLKLRQTIGVTPEAILEASYDDLVEAIREAGLPRQKASALK
FT                   ALAEAVVRWGGENYLLKAPPEELREKLMSIRGIGPKTADVFLSLVRKAPGVFAVDTHAA
FT                   RVARRWGLVGEKAGYDEISKALYNYFGPGNSEEAHRLIIALGRTYCKARRPRCRECPLR
FT                   SVCPSAQ"
FT   CDS_pept        111498..112055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0151.1"
FT                   /old_locus_tag="APE0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0151.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79062"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFU9"
FT                   /protein_id="BAA79062.2"
FT                   /translation="MSSEERMSECPVALVVAQPRRHTWALEEAWDLAVSIDPETSRAVE
FT                   TGYPGVILIYSGRAAPLDVARRAIAVELGFIQRVVPAVICGRIRESREAYSMFETALKI
FT                   LPAGVGKVLFISSLRGSSKDMVDVARLSEILARAGLKPVKRGAQEVVDVEGVDDILIIS
FT                   PGIIRKCGLRCIVVYPVHTAVK"
FT   CDS_pept        112111..113343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0152.1"
FT                   /old_locus_tag="APE0152"
FT                   /product="origin recognition complex subunit 2 Orc2"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0152.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79063"
FT                   /db_xref="GOA:Q9YFU8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:1W5S"
FT                   /db_xref="PDB:1W5T"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFU8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79063.2"
FT                   /translation="MLRHGLFKDRRVFDENYIPPELRVRRGEAEALARIYLNRLLSGAG
FT                   LSDVNMIYGSIGRVGIGKTTLAKFTVKRVSEAAAKEGLTVKQAYVNAFNAPNLYTILSL
FT                   IVRQTGYPIQVRGAPALDILKALVDNLYVENHYLLVILDEFQSMLSSPRIAAEDLYTLL
FT                   RVHEEIPSRDGVNRIGFLLVASDVRALSYMREKIPQVESQIGFKLHLPAYKSRELYTIL
FT                   EQRAELGLRDTVWEPRHLELISDVYGEDKGGDGSARRAIVALKMACEMAEAMGRDSLSE
FT                   DLVRKAVSENEAASIQTHELEALSIHELIILRLIAEATLGGMEWINAGLLRQRYEDASL
FT                   TMYNVKPRGYTQYHIYLKHLTSLGLVDAKPSGRGMRGRTTLFRLAPHLPADRLIEVVDN
FT                   IIQAKMASGYE"
FT   CDS_pept        113367..113633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0152a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0152a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E90"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAF34711.1"
FT                   /translation="MVKLEDIISSRGKLKILKVLFRRGQANITLIVRETGLHHRLVSKH
FT                   IEELKTANIVGERRYGRLRIIYINYGEPKARILRDIVKTLDIS"
FT   CDS_pept        complement(113611..114357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0153.1"
FT                   /old_locus_tag="APE0153"
FT                   /product="putative transcriptional regulator, TrmB family"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0153.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79064"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFU7"
FT                   /protein_id="BAA79064.2"
FT                   /translation="MEGKSEEDLVSLLQRSFRLTAYEAKIYLALLKGASSPKEASAMSG
FT                   VPLPRVYDVIRVLESKGLAVPSSEGWYRYVPPRAAAVAEIARIEEESRSRALKVLEAAE
FT                   LLEREIASRERVTEPLYLDSPYQAISLAVDALRDSGFVYITVLNVLHRYESIVETVASE
FT                   AVKLGKEALILISNTAGADLKISVEGVELVRLELPLPDSLVTSGRAIFLFPGGTSGVKG
FT                   VAVSDENYVKLLVDTIRKAVKKYRAS"
FT   CDS_pept        complement(114493..115851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0154"
FT                   /old_locus_tag="APE0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0154"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79065"
FT                   /db_xref="GOA:Q9YFU6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFU6"
FT                   /protein_id="BAA79065.1"
FT                   /translation="MAEKGNTGPLRAWHVIVAMLLITSIAAGFVDLEPTVDGFLAERTI
FT                   LYYRPEGAYIVELFSGLQMSIGGEAARIPGYGVAAACTGDGFTAAVVVMAEPYLAVYTG
FT                   GSSAETAYIGGSFSGLSCSSESAIAASIRGDGTGVLVIYDHRAGSFKMFFLRGLEEELS
FT                   RHYNPSQNYTRNHPSWGNAVPVAPGLIAIVGDEGVELIRLTAASGKLSILGVYSQSGRT
FT                   IAYGSLDTKGLIVDLQGGRAVTLDFGHTVRVIAATAGSEGEITFILEHVGSGIDVGVLG
FT                   EAGDSSYNLTSLRRLSLTKPYSLRGAWPGEGMVWFAASLVGDLGGYRSLAMGIEGFGTG
FT                   IVGDGERHIARLLPSPSESEASVRTTSIMAEKLSPGVEFLKPTVLKSSTIEPIDLKSRS
FT                   FRDTRGYSVENVITALASLAPWAALAIASLNNLPPGCPREDYVRGQPGRISHE"
FT   CDS_pept        complement(115928..116458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0155.1"
FT                   /old_locus_tag="APE0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0155.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79066"
FT                   /db_xref="GOA:Q9YFU5"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFU5"
FT                   /protein_id="BAA79066.2"
FT                   /translation="MAAKCSLLYKASLVGLAVSDIVVTALLVTLTYYLGPGSGLLVAGS
FT                   IFVATLVGLWVVYRDMADMSRAVSMIEEGRDGVSCYRLGEALLWWEGERLLCYSPPYKR
FT                   FTRARLDEVIDTRDPGLSGPGFVCAAPLQIEDVEFREDGTGYKVRGVVAVLTPEGKIAV
FT                   GRGELEYVGEAFN"
FT   CDS_pept        complement(116472..117632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0156.1"
FT                   /old_locus_tag="APE0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0156.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79067"
FT                   /db_xref="GOA:Q9YFU4"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFU4"
FT                   /protein_id="BAA79067.2"
FT                   /translation="MSSVLSFALAAWRRLRGYRDSLEVAGGLLAGNLFDTINMVVISMF
FT                   SNYLVGQRGLLALYPQLSALTGGLLLSLSSRAISNHVLGGAGPEVYLTGLAVSAASGIF
FT                   LTTVFSTATSIALGLEPVMMVPAALITLLGVLLVLTLLTWIIIVMLLRLGVSPDNVMPA
FT                   ILTSIIDMAVLILAIVAFSMVSRMDEGIYLVAVVTFSLALAFSAAAYDFRLTIDTTFSN
FT                   FALQVVEMIAGVLLSATAPVLAATGLLPVLPPLNKLAGSVAGSMASAATTSVSLYGHYL
FT                   DLPSMISTLFKITVGAIPSALYIGVIGYVLASVGEGSVGPQIVLASLLVSIVLSILGSL
FT                   IAWLLVVVSIRAGLDPDAIAMPLATSLVDLLGVVSLSVVAWILLST"
FT   CDS_pept        complement(117705..118445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0157"
FT                   /old_locus_tag="APE0157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0157"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79068"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFU3"
FT                   /protein_id="BAA79068.1"
FT                   /translation="MDRSNEKQAIRERVWRLLEEKGVTLPPGAWGRIPNFRGAREAALR
FT                   LFSLREWQNSSTIKVNPDSPQRWVRLRALEEGKLLLMPTPRLRSGFLLLDPSTIPRNLY
FT                   RVGSTIKGAFRLARPLASIQDLVQHVEKIDFVVEGSVAVNRWGERLGKGEGYGDLEFAI
FT                   LVEAGILDREVAIATTVHDLQVLPHRLPQEEHDVSVDIISTPTRLIHAENRGARPPGIL
FT                   PEKVTPEKLREIPMLREALRLYKR"
FT   CDS_pept        complement(118438..119148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0158.1"
FT                   /old_locus_tag="APE0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0158.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79069"
FT                   /db_xref="GOA:Q9YFU2"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFU2"
FT                   /protein_id="BAA79069.2"
FT                   /translation="MEVWVELKPVYGLEMAAKALKYLSFADKIDIPDQPVGVAFSSPIA
FT                   ASYLSCRVGGERIVAHIRTVDYSVHSLKAIVKTLSSLGVSNIVLLRGDPLGREVGLKPE
FT                   EAYEIAARYRERFGVKLGFILSLRRSVQEMFERLRLNPDFVLVLNSSKHYLWKLEKIRQ
FT                   AYAGEVIAYLVIATEKSVRLMQGKITSAMYTENEVLDLAEKMVSGRLVDGVLVSAPGDD
FT                   AALERVARRVKRYG"
FT   CDS_pept        complement(119248..120096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0159"
FT                   /old_locus_tag="APE0159"
FT                   /product="probable (S)-2,3-Di-O-farnesylgeranylglyceryl
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0159"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79070"
FT                   /db_xref="GOA:Q9YFU1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFU1"
FT                   /protein_id="BAA79070.1"
FT                   /translation="MKAAIEITRPVNSLMVSLAIILSLGIASRWSFQGFTPIDLMAVVV
FT                   AGYCLSSVAMITNDIIDLEIDRINAPHRPLPAGKVSTVEATILSIFLAALGFLAAISVD
FT                   LITTAFYLGGLALSLLYNTLLKRTGLPGNIVVAALVSAPFMYASLEAGGLGGPMSVFST
FT                   MVFLAVLGREVAKGVPDVEGDKAAGVRTVAVVFGKKTAAAVASALYLASAALGYIPLIY
FT                   GYVDPLIYTPFILLLTLLVLREALLIVKRPTRENVLAHKNRVLGYMLIGLIAFALGTLG
FT                   I"
FT   CDS_pept        120221..121858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="APE_0161.1"
FT                   /old_locus_tag="APE0161"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="LysRS"
FT                   /note="lysine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0161.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79072"
FT                   /db_xref="GOA:Q9YFT9"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFT9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79072.2"
FT                   /translation="MPVHWVDKLVAELEAKLQNRGKDEYIFNGGLSVSGLQHIGRLRGE
FT                   VLLGEAVRRELEKRGFRVKQLLTLYTVDPWKGKDEQRREFPDPKAAERYVGWPLDRVPD
FT                   PKGCHASWVDHFWSDFGPYIGVFTDGKIEVVTTRELYKGRLKEFITTMVLPRRDEIRRV
FT                   INKYRGRKPYQEGWIPLEPRCARCGRIDSTEALEILGGERVRYRCSYCGYQGESSIEDS
FT                   KLNWRIEWAGVWWSLGVDFEPYGKDHATPGGSRDSAAELARLLGFEPPEGVWYEWVSLR
FT                   AGGREADMSSSGFTGITPREWLDIAHPQILRFIYFLHPPTRRVVVDLSEIPSYYSQYYR
FT                   AERIYFGIEEASTVEETRYLARTYELSHPSNPPAKPPSQIPYSHAAIVAQVVGPERLWT
FT                   DGLERLKRAGLLGHDEYSIRWAKELLEKAYKWARRYAPKHLKFEIPDSPPEDALRRIEK
FT                   PDLLEKLAEVLESVEEWSEERIKQALVEFGEGMSSSERRRFYRDFYLAIVGRPEGPRAA
FT                   PLLSLMDRGFVVDRLRKAANLSRELKGR"
FT   CDS_pept        complement(121827..122618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0162"
FT                   /old_locus_tag="APE0162"
FT                   /product="DNA polymerase sliding clamp A"
FT                   /note="ApePCNA1"
FT                   /note="PCNA A"
FT                   /note="proliferating cell nuclear antigen homolog A"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0162"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79073"
FT                   /db_xref="GOA:Q9YFT8"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="PDB:6AIG"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFT8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79073.1"
FT                   /translation="MSSEATLDSEFTDYKAMFRYEAKVFKELVDSVSKILDEGLFIITG
FT                   EGLRLRGMDPARVALVDIEIPSSSFFDFYMAGDVERVELGVNMETLKGVVARAKKGDQL
FT                   EVRVREDKVLFIVESVVLRRYLLPNLEVIVDVPEDISLEFDATATVIADVVKKTLRDVE
FT                   LVGDIVEFDAGEDYLSIRSVGPERRRVETRLTRESPALIDLEVKEPATSRYDVGYLKRM
FT                   LGVAKIAESIELSFSTDKPLKMVFKSPDGSRVTYLLAPSTG"
FT   CDS_pept        complement(122824..124152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0163.1"
FT                   /old_locus_tag="APE0163"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0163.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79074"
FT                   /db_xref="GOA:Q9YFT7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFT7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79074.2"
FT                   /translation="MPVLHSIVGGRFVEGVETLSIDTPIDGSRLAYAAMLKAPVSEHGV
FT                   SPSLWEVSPQEPVLPDSLEALEAELSDMDEILVETLVLDTGKTRVEARLEVEASLRLLR
FT                   SSAGLGEERFRGVLVAMPDYTMPLYNTVYSLFYAAGRGMGVLLKPPRKAPLAPALVAAA
FT                   ASRLGMEDSLNLVFTTGASLLGLSRVFRSESIAFTCPSKAAVARAGISASRGRSAAIVS
FT                   AGSVDDVIAKFIMYGRSLHAGQACGSIGWVIAIGRLSRGEVDALVDAAESLRVGDPTDP
FT                   STAMGPLIKPGLAEASERYVNYIEGMGGVVPTGYKRNGRYVWPSVVEGVVKDPIVLSRD
FT                   PRFPVLPIVYVSSPEEAASIAAMTGASEILAFHMDSPGLRTLGERLAGREIYVDPLPGE
FT                   GKLPTPGSFMSTGCLAPVKQREGIILESPYYILAKKERAETYR"
FT   CDS_pept        complement(124412..124954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0166.1"
FT                   /old_locus_tag="APE0166"
FT                   /product="ATP:cobalamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0166.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79077"
FT                   /db_xref="GOA:Q9YFT4"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFT4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79077.2"
FT                   /translation="MGSLYTRTGDSGETWCFALGEGRKPVRVPKDHPLIEFLGTLDEAN
FT                   SLIGLARSFLSGEGLEGSIDNDLKWMQRLLFNIGFTFSSTEPRVGEEDLKKLESMADSY
FT                   YGEPLRRFVLPAGSSKVAAIHAARAAVRRAERRLVTAMRSGVSVDPLILRIVNRASDAL
FT                   FAMAVALARAEGSLEEV"
FT   tRNA            complement(join(125063..125101,125151..125186))
FT                   /locus_tag="APE_tRNA01"
FT                   /old_locus_tag="APEtRNA01"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:125152..125154,aa:Thr,seq:cgt)"
FT                   /note="codon recognized: ACG"
FT   CDS_pept        125249..125635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0167"
FT                   /old_locus_tag="APE0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0167"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79078"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFT3"
FT                   /protein_id="BAA79078.1"
FT                   /translation="MESGSWRPPFSTGKIVGNYGLLKLYLEVAREKGRRDLVDKALISE
FT                   DDVDMLRRLSASPGATAEDFVNALEERFVERVDPEVASEALARAGINVDGDTARRMIAR
FT                   ILAGWLVEMGEEMKLYRLRRSWED"
FT   CDS_pept        complement(125632..126015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0168.1"
FT                   /old_locus_tag="APE0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0168.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79079"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFT2"
FT                   /protein_id="BAA79079.2"
FT                   /translation="MEEGLLFVHMLGKETRRKIIAILLSTRTYRELASELGVTPAAIAK
FT                   YISGATHPSDKTVAKALEIASREEKEEIAIAISEDLAESIRSLVNWIIEERLPGRLLAE
FT                   ALEESVARMRLAGVRRSARLANP"
FT   CDS_pept        complement(126080..127291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agt"
FT                   /locus_tag="APE_0169.1"
FT                   /old_locus_tag="APE0169"
FT                   /product="alanine glyoxylate transaminase"
FT                   /EC_number="2.6.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0169.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79080"
FT                   /db_xref="GOA:Q9YFT1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFT1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79080.2"
FT                   /translation="MVDYDRLFSEITRRFRASDVRELLKLTEGKRVISFAGGLPDPRVF
FT                   PAEELADIARNVVSELGDKALQYSPTPGVSIFRERALSFLERMGLKTSDRQLLVTTGSQ
FT                   EALFLTALSTLSPGDVVIMEEPGYLAAINVFKALGARIVPVPVDDKGLNTGVLAETLDR
FT                   LDAEGVKPKLVYTNPTCNNPNGTTMPLDRRRELLQLASNYDMLVIEDDPYSHIAFEKTG
FT                   EEVPLQALDSEGRVVYVTTFSKILAPGLRLGLTLAPSEVTARIELLKQIVDLHTSTLDQ
FT                   YIAAEALERGIVDKVISRAVSIYRRKRDIMIESLEENMSGVATWTKPIGGFFIFLRING
FT                   PVDMRALMPKAVERGVAYVPGDAFHVTPGAGRNTARLSYSFNTEEEIPEGISILSKLVK
FT                   EVLS"
FT   CDS_pept        complement(127388..128419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0171.1"
FT                   /old_locus_tag="APE0171"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.59"
FT                   /note="GAPDH"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0171.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79082"
FT                   /db_xref="GOA:Q9YFS9"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR006436"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFS9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79082.2"
FT                   /translation="MSVVKVGVNGFGTIGRRVALAITLQKDMKLVGVVKRTPDYAALYA
FT                   ASRGIPIYTPTAKEAEEFEKRGIKVGGTLRELLARVDVVVDATPEGQGAKNKPLYREAG
FT                   VKQVYQGGEKPEVAEASFSTLCNYEESKGRGSLRVVSCNTTGLLRLICTLNREFGVESV
FT                   RAVLVRRGADPKEVKKGPIDSIVLNPPTLPSHHAVDVRTVLPWLDIKTAAVAVPTTFMH
FT                   MHHVTLKLAKPVEKREVLETLASAPRIMLVSSGDTGIKSTSQLVDAARLSRMGYDIPEL
FT                   VVFEESVAVDGREVMLFQAVHQESIVVPENIDAIRAVASSPLTLDETLKATDGSLGLRK
FT                   TLW"
FT   CDS_pept        complement(128432..129679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="APE_0173.1"
FT                   /old_locus_tag="APE0173"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0173.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79084"
FT                   /db_xref="GOA:Q9YFS7"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFS7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79084.2"
FT                   /translation="MPLEYMGGRLATLDDVDVRGKKVIVRFDLNSPVGNGGEILDDSRI
FT                   AEAAGTLRELCDRGAAVVALSHQGRPLESDFVSLERHASLLSRYSGVEVRFVMDVIGPE
FT                   ALRTVASLRPGEAVLLDNTRIISEDFIEAEGTVHARGIMVTRLSKLANMYVNEAFSASH
FT                   RSQASIVGFPYVLPSAGGRVLEKEIRSLNRAVSSGERPKVVVLGGAKLKDAVRIVDYLS
FT                   SSGVADEVLTTGLVGLLFLYARGYRLPRDVTKLLEKKGGEEAIAKARRIVEEGRRVRTP
FT                   IDFVVEVGDKIYIKPADELTEGVPKDIGPSTVEYFRAKMRGARVIVMRGPAGVIEDPRF
FT                   RRGTVELVKAALSSGAYTVFGGGHFRAILRDLPEHLSSKVGHLSTGGGALLYYLSGRPL
FT                   PGVKALVDSARIFNLV"
FT   CDS_pept        129984..130643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0176.1"
FT                   /old_locus_tag="APE0176"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0176.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79087"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFS4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79087.2"
FT                   /translation="MPVTVEWCYHAYILLKAGDVLMAIDPHDGGSLGLPTCRVDADYIL
FT                   VTHDHFDHNAVEVARGKRTKEVLKRFYGSKNLGPFTVTGVKVYHDKAGGTLRGEVAAYR
FT                   VEVEGLSLVHLGDIGHVITSSSHPELSRPDVLFVPVGGTFTVNAAEAWKIVENLRPRIA
FT                   VPIHYWMPGSHLPIDPLDRFLQVARAGRQPIEGRVLELSPEKLPEKTTIYYFKVQS"
FT   CDS_pept        complement(130640..131800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA"
FT                   /locus_tag="APE_0177"
FT                   /old_locus_tag="APE0177"
FT                   /product="molybdopterin biosynthesis protein MoeA"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0177"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79088"
FT                   /db_xref="GOA:Q9YFS3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFS3"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79088.1"
FT                   /translation="MNPNALLGVEEARKRIEFLKLDYRLHTEIIPSSQSVGRILAEDLE
FT                   SPNDTPEEPLAAMDGYAVDSTSAKPGARLRLKDRGPVASGEAVPVDTGDPLPPGADAVV
FT                   RREAARVEDGYIYVSAGVSKWENVFRPGEFVARGSRLASRGDVISPYLAALIMQAGVKS
FT                   VKVYRIKSIVMPVGSELLHPETMTGDGSLDYIGPMVTGLLRGWSEPRLVPPVPDGREEL
FT                   EEAINRALDEADILVTIGGSSVGRRDSLKALVASMGQLVVPGFGASVVKRGGLAVVRNR
FT                   IVTMLPGGCVSAAISLHETLFRALKALTGKPLLRSLTLPLVRDYRLGRRMPSAVLFKIV
FT                   DGGLQPLEWGIALCRELAKADAYAILTPGVYSKGSPVNVNMLRKPV"
FT   CDS_pept        complement(131790..132212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobB"
FT                   /locus_tag="APE_0178.1"
FT                   /old_locus_tag="APE0178"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein MobB"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0178.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79089"
FT                   /db_xref="GOA:Q9YFS2"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFS2"
FT                   /protein_id="BAA79089.2"
FT                   /translation="MPCIVQIVGPSGSGKTSLIVSVVRQLSGRGIKVAVVKHTHHDIDT
FT                   PGKDSWRFLEEAGASYAAVVKGRGERVAVFTRDTGLHAVLEDLARKVDIIVVEGFKNLR
FT                   LGGLKIDLSTKRPGRIEESIIEFVEECLKEGVGSEP"
FT   CDS_pept        complement(132240..133085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobA"
FT                   /locus_tag="APE_0179"
FT                   /old_locus_tag="APE0179"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein MobA"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0179"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79090"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFS1"
FT                   /protein_id="BAA79090.1"
FT                   /translation="MNPIPADVAAVVLAGGVGRRFGRPKALAMMDGISLVERAVEALSS
FT                   GPADVYVSVSPALERPVARLVGSRRVIVDLVEQAPCEGPLRAFLTAASTLVSYSNLVFM
FT                   PVDAPWASWRDLEPIYNASKAIGSGASYFSGEGIVHPLFLAARRKSLLTAAWTACWGRA
FT                   EKRASAILRSLDPLILLGSSETRSPLALATVNTPQDLWRPSRVPAPAEGYILLEGHSIL
FT                   YKISSTMNSYYSALALEAEYKLYRRLGLLRLASHVLKDAAALNVSTSLIQQESMAGGLG
FT                   "
FT   CDS_pept        133178..133381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl38e"
FT                   /locus_tag="APE_0179a"
FT                   /old_locus_tag="APES003"
FT                   /product="50S ribosomal protein L38e"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0179a"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79092"
FT                   /db_xref="GOA:Q9YFR9"
FT                   /db_xref="InterPro:IPR002675"
FT                   /db_xref="InterPro:IPR038464"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFR9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79092.1"
FT                   /translation="MPVELKSFDEFVKVVERAVECRVKRGKDVVKIKARTKRYLYTLKV
FT                   PPEKEAEVLEQVKAKCKNLVEL"
FT   CDS_pept        complement(133391..134653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0181"
FT                   /old_locus_tag="APE0181"
FT                   /product="putative exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0181"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79093"
FT                   /db_xref="GOA:Q9YFR8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFR8"
FT                   /protein_id="BAA79093.1"
FT                   /translation="MARIRILGSGREVGRAAILVESGGRGLLLDYGVNFDENDRPVFPG
FT                   DVRPRDLDGLVLTHSHLDHIGAAPYLYVSQGPKVFGTRVTLHVSRLLLYDMIKLNGAYL
FT                   PYDERSVEDMLGTAEYIDYGREYEAGRFAFKTFYSGHIPGSTAVLVEVDGRRILYTSDV
FT                   NVIETKLVGPARLEGAKADVVIVESTYGDSDHPPRSVSEERFYNAVMDVVSQGGTVLVP
FT                   AFSVSRGQEIAMILAERGFEYPVWLDGMIRQVAEIYAANPRFILNPGLLMKVMSEFRIV
FT                   SGWQDRRRAFKKPGVIIASAGMLKGGPSLYYARKMATNKKNGIFMVSYQAPGTPGRMIL
FT                   EEGVFGEERIPVLARVEWFDFSSHIDQSGIIKLLRSVNGVEKVVLVHGDPKAQEALKTR
FT                   IREELGIREVETPGNMDVLEV"
FT   CDS_pept        134836..135162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0182.1"
FT                   /old_locus_tag="APE0182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0182.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79094"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFR7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79094.2"
FT                   /translation="MPVNVDRLKDAVEVLGNRVRIRVYVKPEGRERRLRLEEGELVFYT
FT                   DEPPLEGRANASLINFLARGLKVSVKNIEIVHGARSRSKVVEIRDVADPDALLERLASI
FT                   VDEG"
FT   CDS_pept        135205..136005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0183.1"
FT                   /old_locus_tag="APE0183"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0183.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79095"
FT                   /db_xref="GOA:Q9YFR6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFR6"
FT                   /protein_id="BAA79095.2"
FT                   /translation="MTLAPLDLSLADMALRILMGVAAAALASLSGVGGGVFFVPIFLFI
FT                   VGLPPNIAVGSSKVVVAIVSIVSGLTYLRQGTTRLSRAAPLMVSMIPGAALGAYLVAYI
FT                   DPRLLEVILGLFITYYSLRLLLVTARKALAREAKPVEEEGSRGPRPGGRYLMLATGVAA
FT                   GLFAGLTGTGGGAILVPMLTLLRIAKLKEAVAISMLSISLGAVVSAAIHVWTGVVDFGG
FT                   AAPFALGALIGSILGPMAASRLSTDALRPIVALVLLLVALRLLF"
FT   CDS_pept        complement(135956..137212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0184.1"
FT                   /old_locus_tag="APE0184"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0184.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79096"
FT                   /db_xref="GOA:Q9YFR5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFR5"
FT                   /protein_id="BAA79096.2"
FT                   /translation="MKSIGGVQAPLLVLAALNGLSFGVIVTVLAPYMYSAGFSGTEWGL
FT                   LTSTATVTSIIFTLLSGPLSDALGARRVVAAGYIVKAASFTLLAVPSTVFMAAGFTLSG
FT                   VSMGISWSATTALVARSGRDEMLHRSFTFFMASNMVGGALGSLMGVIPPLLSSITSLTL
FT                   LEAYRATILLVAPLSLLQAGIALAVREEVSAEGRASIGPGELLRGFREAVSDRRFRLLI
FT                   LFNMVIGLGASMSIHNIAYYFAAKYGVTSAEIGVVNALEQVSMALVAVGASRIAERVGS
FT                   TLKVYIALTSLSVPLLVAMTLVDSYVVAAAIYVVRTVLMNAANPLLEALTMRVVPRERR
FT                   GSASSILSLSFTLPATAGRAIGGALLDINLELPLRLTAAIYTLALAHLYMRRRFLEEGR
FT                   AWGSRRVAGELLEEARAPQ"
FT   CDS_pept        137399..137965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0187"
FT                   /old_locus_tag="APE0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0187"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79099"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFR2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79099.1"
FT                   /translation="MTRYLDISLGIVRDYYEAAPVKVVFVKDHPRLPTPGGIINARRGD
FT                   EVELPRWQARMLREKGYVEYKEKIVDIDYVNLVHYHEVKKSAANSLLGVPSDFYLRVKE
FT                   LVEDLDRRIRENPGYMLFQDRENVERAIMQISERRLVKMMRLVLSGGGEEVRERLTVEE
FT                   NLVYSMAEEVVKGWKEYVKSLVGRR"
FT   CDS_pept        137973..140066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0188.1"
FT                   /old_locus_tag="APE0188"
FT                   /product="minichromosome maintenance protein"
FT                   /note="DNA replication licensing factor"
FT                   /note="MCM"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0188.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79100"
FT                   /db_xref="GOA:Q9YFR1"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFR1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79100.2"
FT                   /translation="MAEEMLSGEETLAVGERFKTFLENFRTEEGKLKYVEAIRRMINYE
FT                   ETSLEVEFKDLYRYDPLLSEILLEKPREFLKEASEALKEIVAQESPEYAQGRVFTPRFT
FT                   GLFDTERIRDIGSDHVGKLVQINGIVTRMHPRATRMVRARFRHDRCGAEFWWPANEDEV
FT                   LGERIERPSICPVCGEGGGKFTLVRDKSLYIDWQKIMVQERPEDVPGGQIPRSIEVHLS
FT                   RDLVEKVRPGDRVKIVGVVGLQSFSSSSTLYSLYMEANSILLEEKILEEVSITREDEEK
FT                   ILQLSRDPWIKEKIIASIAPTIYGHWDLKEAIALLLFGGVPKQRPDGTRTRGDIHVLFV
FT                   GDPGVAKSQLLQSTAQVAPRVVYTTGKGSTAAGLTAAVLRDPRTGEYFLEAGALVLADG
FT                   GIAVIDEFDKMSKEDRGVIHEAMEQQTVSIAKAGIKATLSARASLLAAGNPKFGYYDPS
FT                   RSFVDNVDLPAPIISRFDLIFVVRDVIERSRDEMLASYVLETHTNVELFKPEIDPDLLR
FT                   KYIAFARKHVKPRLTPQAKKLLKDFYVEMRSSALHHSSQEGAKPVPITTRQLEALIRLT
FT                   EAHARMSLKQEATEEDAIAAIRIMTSVLQSIGLDLETGEIDIGIIMTGASFRSRKIMSE
FT                   VLDLIKSIVEEERGGQGCVRASEIVRRLGEKNIPEEKVRDAIDKLYRQGLIIEIRTECY
FT                   KAV"
FT   CDS_pept        140110..142317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hjm"
FT                   /locus_tag="APE_0191.1"
FT                   /old_locus_tag="APE0191"
FT                   /product="holliday junction migration helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0191.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79103"
FT                   /db_xref="GOA:Q9YFQ8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFQ8"
FT                   /protein_id="BAA79103.2"
FT                   /translation="MSKGLYDIPSWATTETRTLAKLAGVERLFEPQYMALQAGVEKGEN
FT                   LVVAAPTGSGKTFIALVAIVNSLARAGGRAFYLVPLKSVAYEKYTSFSILSRMGLKLKI
FT                   SVGDFREGPPEAPVVIATYEKFDSLLRVSPSLARNVSVLIVDEIHSVSDPKRGPILESI
FT                   VSRMLASAGEAQLVGLSATVPNAGEIAEWIGGKIVESSWRPVPLREYVFKEYKLYSPTG
FT                   GLREVPRVYGLYDLDLAAEAIEDGGQALVFTYSRRRAVTLAKRAAKRLGRRLSSREARV
FT                   YSAEASRAEGAPRSVAEELASLIAAGIAYHHAGLPPSLRKTVEEAFRAGAVKVVYSTPT
FT                   LAAGVNLPARRVVIDSYYRYEAGFREPIRVAEYKQMAGRAGRPGLDEFGEAIIVAERLD
FT                   RPEDLISGYIRAPPERVESRLAGLRGLRHFILGIVAPEGEVSIGSIEKVSGLTLYSLQR
FT                   GLPRETIARAVEDLSAWGLVEVKGWRIAATSLGREVAAVYLDPESVPVFREEVKHLSFD
FT                   NEFDILYLISTMPDMVRLPATRREEERLLEAILDASPRMLSSVDWLGPEEMAAVKTAVV
FT                   LKLWIDEASEDTIYGEWGVHTGDLLNMVSTAEWIASGLSRIAPYLGLNSKVSHILSVIA
FT                   RRIKHGVKPELLQLVEIPGVGRVRARILFEAGYRSIEDLATARAEDLMRLPLIGPSTAR
FT                   QILEFLGRVDEAREAEAREMLARKGLLSYLEGDAVAGEEGE"
FT   CDS_pept        complement(142270..143373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0193.1"
FT                   /old_locus_tag="APE0193"
FT                   /product="L-lysine 6-dehydrogenase"
FT                   /EC_number="1.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0193.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79105"
FT                   /db_xref="GOA:Q9YFQ6"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFQ6"
FT                   /protein_id="BAA79105.2"
FT                   /translation="MVKIAVLGLGRVGLRAAYNLASRGFDVLGLDASNDAVSRARSLGL
FT                   EARLYDVEGRKAGEYLRGQRVVAAFIALPYPVASRAVAHLSSAGIPVVVASIKPLRIDP
FT                   GVVRAPILTEVGVSPGLSNVILYSMAAETGGGVSARVYVGSFGAREDGLLSHASTWRVE
FT                   EMLEQYVTPAKLIQDGSEAVADPLDPSLWMEYSDPEHGVLECFPSQGLAGFISRRGSLF
FT                   KELMECSLRRRGHLKVVLTMRGLGLLDSTPLKVSGCIVRPFDMAVKLVETRYPPDVGDV
FT                   AVFTVEARRGGRWETLARASLRHGGGWSASSKMVGGASSAFAEVFAAEGLSEEEPGIIY
FT                   PEDLYELGLAEKLLSLLPSHGVSLEVG"
FT   CDS_pept        complement(143635..143898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0193a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0193a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34712"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E89"
FT                   /protein_id="BAF34712.1"
FT                   /translation="MSEAGVFKVTVGEKEIVIDEKILEILRRYRTTEMSLDQLAAALGL
FT                   DSWEEAYEFVKNIPAWILSIEPSQWKTMSRMKGVKEEMAVEK"
FT   CDS_pept        144240..145007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0197.1"
FT                   /old_locus_tag="APE0197"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0197.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79109"
FT                   /db_xref="GOA:Q9YFQ2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017271"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFQ2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79109.2"
FT                   /translation="MSHHRGVFSESPVDSDYASRLVAIRIAGDIIYSRDFGEALRKWRE
FT                   YFEVSQSEIAREMGVTASVISDYEKSRRTPGAVFIKRFVDSLISIDAKRGWKKTKDLAM
FT                   LAGTVPGAIVDMREFEKPLTVGELSSVVEGVILGFKDAARSVYGYTLVDSVKAILSLSG
FT                   LQFTVLFGLNPQRAIVFTKSTTGRSPMVAVRTSPLKPAVVIVHGPGRNVDRLAIEIAKA
FT                   DRVPLVVSQLDSEEELASRLRSLTMQRRFTPHP"
FT   CDS_pept        complement(144991..145344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0198.1"
FT                   /old_locus_tag="APE0198"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0198.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79110"
FT                   /db_xref="GOA:Q9YFQ1"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR005231"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFQ1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79110.2"
FT                   /translation="MLPVNPRDLEKMMRRLGIKVEQLSADEARIVLGSGETMVFRSPTV
FT                   IVMRAKGQPPMVYLVGDYTVEKPREETAAEITEEDVALVAEQAGVSMEEARKALEESGG
FT                   DIAEAILRLKGEE"
FT   CDS_pept        145484..146704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0199.1"
FT                   /old_locus_tag="APE0199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0199.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79111"
FT                   /db_xref="GOA:Q9YFQ0"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFQ0"
FT                   /protein_id="BAA79111.2"
FT                   /translation="MRRLSYADPRPALWVVSLLIALAAGVYTGLSAYDTASFFDSVEPR
FT                   YVSDEIYYVDTARRLLQNVFQVDIDYYSYSGKTSEDYYNAEHPPLGKYIIALSMLLCGD
FT                   RPLCWRLPSVVEAGLIPVILWAGLALAYRGVLGPVAGAAAALAAASDPVLRVMGSVAML
FT                   DIHQAFFTALAIALAANRRFIPAISAAGLAASVKMSGGAIVLATATVAASWAQGSIWRR
FT                   LAVFTAGLLIGGSVYIALYAPLVLHFGPMWVIEETINALKWHTTSRPPGPPASSVLGWI
FT                   INSNPFYLSLEGRVMAAVTNTVVHATALGFAAIALLAELLERRGRPSWPGVAHVYMLFI
FT                   LILYTAVYLAGNRTLYSFYSVQLTPIAAAVIGEATAAMLTWRCRADKHAPSPSTEGYAP
FT                   EASPKGE"
FT   CDS_pept        146789..147379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0200"
FT                   /old_locus_tag="APE0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0200"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79112"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFP9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79112.1"
FT                   /translation="MSGENGKGCRPSRDFLRYIANRVIARYAAKLPASVVEDIRDMLGR
FT                   GEDKYRFSIYGGDPRNIVKYFDSEEWRDLVEYAANTGALSMLVEILDALAAEYRRECPE
FT                   VAEAAEREVERLKAGEEKLGRREELSLERIYRMLSLAGYRVESKDGSLEVDEGLIKLII
FT                   KLEGQTLEYTICKSGRSKTLEGVLSKLSKIREL"
FT   CDS_pept        complement(147327..148433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0201.1"
FT                   /old_locus_tag="APE0201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0201.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79113"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFP8"
FT                   /protein_id="BAA79113.2"
FT                   /translation="MGIEGLTAVSIGGLGVSGATLAYLLAREGFRVEAFDVARGYRKAC
FT                   GDALTLKPFTEEIARATRSVVTLVTRYIIAVNGEVVQDLSLKPPPWAIVDKALLVSRLR
FT                   EMAEAEGAELKAGSWPGPVGGRLSVDARGPLADTVKDAVFLYRVYSKAEWEPDTVYLDF
FT                   NVRDRGVYWVFPADGEGRLVNIGAGFEGVWSGREVEMRIARLHKTLLGSTLEPVDRRGA
FT                   PMQLFAPLRLYHEGVFKVGEAGGFLLRTGGEGNRPGMLSALHLARAIASAGLEDESKIL
FT                   AYYRLYSAGLADEVRVSKILLSIVRGSSIREASRLLKSLPPSFWERFVRAQVTSTYLIR
FT                   LLTHPSVAFGVARALLSYSASRAPPQAS"
FT   CDS_pept        148526..148954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0202.1"
FT                   /old_locus_tag="APE0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0202.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79114"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFP7"
FT                   /protein_id="BAA79114.2"
FT                   /translation="MVRVKLERSVSSSGRHEELKIAYVVSRSGVRPLRIGPGAKPTKPT
FT                   YARGSAYEMEVSLSEGEYLVAIRLNRNFLGMLKGEIRVIDWRGREVLRLVLRKRKLRLS
FT                   EGDPSLAWTAWAALKAAGLDKLVRKSQVNNLTDIEASS"
FT   CDS_pept        complement(149164..149958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0203.1"
FT                   /old_locus_tag="APE0203"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0203.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79115"
FT                   /db_xref="GOA:Q9YFP6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFP6"
FT                   /protein_id="BAA79115.2"
FT                   /translation="MNPAITPILLGLVAGITVTFGALTYIVVGRRLGRRGQGVLNALAG
FT                   GVLAYLALETGHESAAYVEQFATRETLDSFLAGLMVTSIALLGTWLLLSYVERGYSTLV
FT                   RAPPGLMVSLTVASALGLHNLGEGLAIAASLIEGKVSLAILFAVGFAIHNYTEGFPIAA
FT                   PLAGEKKRTGLRTIIGLSLLAGLPVVPGAMVYYLGSNLPGLAIATLYTVAAASIVYAML
FT                   HINLSALSRLGGLSSPSFWSSLFLGIALAYVTESIILIAGLH"
FT   tRNA            complement(join(150239..150282,150327..150360))
FT                   /locus_tag="APE_tRNA02"
FT                   /old_locus_tag="APEtRNA02"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:150279..150281,aa:Pro,seq:cgg)"
FT                   /note="codon recognized: CCG"
FT   CDS_pept        complement(150413..151075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kptA"
FT                   /locus_tag="APE_0204.1"
FT                   /old_locus_tag="APE0204"
FT                   /product="RNA 2'-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0204.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79116"
FT                   /db_xref="GOA:Q9YFP5"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="PDB:1WFX"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFP5"
FT                   /protein_id="BAA79116.2"
FT                   /translation="MAEELPELALCCDGTVVEGRSNCRCKARAVLPGGMRVRLSKTLAG
FT                   ILRHHPGRYGVRLTREGWARVSEVVEGLRKAGWSWVEEWHIVGVALHDPKGRYELRNGE
FT                   IRARYGHSIPVNVEPLPGEPPPILYHGTTEEALPLIMERGIMRGRRLKVHLTSSLEDAV
FT                   STGRRHGNLVAVLLVDVECLRRRGLKVERMSKTVYTVDWVPPECIAEVRRESLGRSL"
FT   CDS_pept        151135..151524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0207"
FT                   /old_locus_tag="APE0207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0207"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79119"
FT                   /db_xref="InterPro:IPR009563"
FT                   /db_xref="InterPro:IPR022954"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFP2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79119.1"
FT                   /translation="MGGEGPGSDDIVKKMAQLMMQGAVMLDKTCPADGLPLFKLKTGDV
FT                   VCPVHGKVVIVASDEEARDVEVEEIIREVRYRAARNVMKGLEEDNVDTVSKWLGVLETA
FT                   ERILAIRRGSRQGQGSVRGEGRESK"
FT   CDS_pept        151606..152493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0208"
FT                   /old_locus_tag="APE0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0208"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79120"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFP1"
FT                   /protein_id="BAA79120.1"
FT                   /translation="MQGLTDCIDALDIARAVRVEGVSARLAGEGRGEASGEKRHKIEVL
FT                   VKDPSSPSIDEMPLLSALRVAFAKSGQLLVLRPYEKEAAPREDVLAGLLRSLVEEGKPF
FT                   VAIVPSLLAVGLASRLPARVIDALESLSVVVEAKVAVRNLVYLPVPEVNDVIEIVGKKN
FT                   SAASYERIRRLEEAAGRYGIKVRGHVLLNSNMEILEYIVSGGVDGLSMRVPVTKLALYI
FT                   LAISRCLDIPITPVTLEETSLHTIYFHGLGSREAEAFIEALRSPLTRPSEEEVARLVER
FT                   GAAKLVEILARPRV"
FT   CDS_pept        complement(152483..153625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0209.1"
FT                   /old_locus_tag="APE0209"
FT                   /product="probable peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0209.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79121"
FT                   /db_xref="GOA:Q9YFP0"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFP0"
FT                   /protein_id="BAA79121.2"
FT                   /translation="MAGIEIAVAAGIALAWIALYLIYGRGRREGRVSILPFGIIVRIGV
FT                   TGEPLGEGRLRGVLRLYGYLAIAVMMAALALFYYLALQAAKAKFLVPPGEGGEAAGGFI
FT                   PLIPGVTIPWEDLVYVAVALGVGVVAHELGHAVVAVAEGIRVKNAGIAILLFIPAAFVE
FT                   LDEEQLMKARLVSRLKVFSAGVTANILIALLTLLIAMTAPVAEPSGVKILGVEEGSPAD
FT                   AAGLGPGMVIVEVNGEPVKSLEDLRRIFEKIGVTDPASNVEFTVRVKKEGGELLDLKVV
FT                   KEAGRSTIGVRVAEFYDSPLATIMNALFLLNLGVALVNAAPLLLPLPGAAIMSDGGHVA
FT                   VHVGERLLGPSGRLLGAGLGVATLILVLGLVTIEPIDLTP"
FT   CDS_pept        complement(153667..154503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0211.1"
FT                   /old_locus_tag="APE0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0211.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79123"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFN8"
FT                   /protein_id="BAA79123.2"
FT                   /translation="MAICRVLIVSPPTVDVVEIGGSIVRRPGGPALYAGYAAGKLGCRA
FT                   YAVGPVGYTTLDTAVVERRLGVERLGYRVVGEGYVYRHKYKAGGQRVSTLIGRPEPLDP
FT                   ARVLRVLSAGAYNVVLISPLHGEDDGGLASYIHNNFSAITAVDLQGYYRGYASVWTPPT
FT                   ARIGSLAHISSDDASDPPREPMANIIVYTRGEAGGEVLSPSGSLTIPPPPKLVEDPTGA
FT                   GDIFTMVFAIMLFRGAPPGPAAEEAAAKTPEILESIRGDEGFQYSVPHSPSEAFWI"
FT   CDS_pept        154581..155789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0212.1"
FT                   /old_locus_tag="APE0212"
FT                   /product="probable peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0212.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79124"
FT                   /db_xref="GOA:Q9YFN7"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFN7"
FT                   /protein_id="BAA79124.2"
FT                   /translation="MEDLEHGVASNGLRYGFYRVESESAAICIAARGGSSFEPPGKYGI
FT                   AHLTEHMIFRGNEYLQDGELDRAVELSGGEANAYTTRELILLCAEFVSDSLARVAEKLF
FT                   LAVSARRLVEGEFERERAVVEAEVKGLISSPESRIYRLAHASAWGDSHLGRPIEGYPET
FT                   VANISKADVEEYKASVFSPERMSLAIVGRISRLEALRVVKLFSQLEPGGKVREPETPEP
FT                   RTTFLREERGIEAAYAALTLPLPPRSGLANVLARLRGVVFNLEAGATSILFKEVREERG
FT                   LAYGFNVDVHITSWGSSMSLIVLEGNRDRVGELFDAMTRSLERALRGGYPESEWREGRR
FT                   RLYRFYTRREAISNMERADALSAVILFHEKPFTLEDLVNQTLSSEWSLEEFLRLPRGLA
FT                   LIV"
FT   CDS_pept        complement(155786..156478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0213.1"
FT                   /old_locus_tag="APE0213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0213.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79125"
FT                   /db_xref="GOA:Q9YFN6"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR009185"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFN6"
FT                   /protein_id="BAA79125.2"
FT                   /translation="MEVEYSPEHWLLLREKRRKALEIVRALSRTVHPGLAVVHGSVARG
FT                   DVHPGSDVDVAIVEPVPPGLVEEALEASGFTVYKRIIVMATPRSTPKAYLVLDPPEERV
FT                   VSLPLARLQPREREFYMWGGEVDAAGLERGVRSPGVTKRLILVVPTPRGHVEEPVLGNE
FT                   GRVAEVLGISLETVRERVRVLTRRRELGRTGVYIKVELPPEEPFEEAVRRLSASNPFFR
FT                   RMMSDRSR"
FT   CDS_pept        complement(156511..157101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0214.1"
FT                   /old_locus_tag="APE0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0214.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79126"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFN5"
FT                   /protein_id="BAA79126.2"
FT                   /translation="MKKQVLKVELEGEAAEKISRLAERLGVEPARLLGTLADVTSTYWR
FT                   EIAEWAENLRVRRHNKHVSVFEELYYYGVSLWRDIVAPLLERLNAKGRFELEGIDFDPD
FT                   EGLLEVEMIALEGSDLKADRLVVTWSPKGVHMEVYYYLEEDEEPPRPSRQLDFEWSYLP
FT                   DEHAIVISHSAETLSGLPPIYRVDREADLLRKL"
FT   CDS_pept        complement(157098..157667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0216.1"
FT                   /old_locus_tag="APE0216"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0216.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79128"
FT                   /db_xref="GOA:Q9YFN3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFN3"
FT                   /protein_id="BAA79128.2"
FT                   /translation="MSDRSLEGKGAVIREKYEATCSGYDELYRAEQYEKFFVALKRVRP
FT                   QGRVLDAGCGTGLLLEYMASYGSLDAVDLFTCLDYSPCMLSIARFRIGVLCGNGSCIAL
FT                   EGNVEKLPFGSGVFDTVYSFTVLDLVDDLWRAVKELIRVSRGPVVVSMLKRLPYKDELL
FT                   AAGAQILGVTSKDVIMRIDVLRGRVD"
FT   CDS_pept        complement(157766..158482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl2p"
FT                   /locus_tag="APE_0218"
FT                   /old_locus_tag="APE0218"
FT                   /product="50S ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0218"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79130"
FT                   /db_xref="GOA:Q9YFN1"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="InterPro:IPR023672"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFN1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79130.1"
FT                   /translation="MGKRLRQQRAGRGTPTYRSRAHIHPGPAKYPPLSGDTLRGKVVEL
FT                   IHDPGRYVPLARVVREDGVEFLMPAAEGMYVGQIIEIGPAAKPEAGNILPLGKIPEGTE
FT                   VFNVELRPGDGGKLARQAGSYALVVGRAGAKTILRLPSGKDKEVPNDSRATIGIPAGAG
FT                   RIEKPIMKAGFAYHKWKVKARKWPRVRGVAMNAVDHPFGGGRHQHKGRPSTVARTAPPG
FT                   RKVGHIAARRTGRRKR"
FT   CDS_pept        complement(158495..159880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0219"
FT                   /old_locus_tag="APE0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0219"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79131"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFN0"
FT                   /protein_id="BAA79131.1"
FT                   /translation="MPGAIDIVTIIIMSAAAGLLYRKTLSNRAAILSRRAGKLLRVEGE
FT                   EGSRRPVVLLARDNPENVEGLGDRLYSLAMRTPAPVSIFYSYIPVEKSRLVETLEEEIK
FT                   RVEFKYSTTRLGRYRSALALLESLYKEAVATGSPRLGRLGAVVWIEEGADDSKAIQFKS
FT                   MLEAEVGVKFDVVAGDWSPASLAEAGARHLNPRFRPEGSIPRGGEILLGVSAETGGPVA
FT                   LRWPRDLEAHMLVVGPTGRGKTVLLAGLAVQLALLSEVEGDPLGVVVVDPKGDLAELLE
FT                   PLTTFLLEPRDTGQLPVPGATIPPVSPLTVYSLRRLEGSDRNAAAQAVASSLVEYALSP
FT                   GGRGRLVLIVDEAWRLSRSTSFFEGIAREGRSRGLYGVFATQSPGDLPEAIEFNAGVVA
FT                   AFGGKARGYVESVSRLGVGGGLVELGVGEAVVRMPGGRLQTVRIPPFNEYLKKARGTNG
FT                   VEG"
FT   CDS_pept        complement(159901..161259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0220"
FT                   /old_locus_tag="APE0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0220"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79132"
FT                   /db_xref="GOA:Q9YFM9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFM9"
FT                   /protein_id="BAA79132.1"
FT                   /translation="MEGGDLQLLAFKLAMLGFYLGVLIYAAPIPASSIKRWASTLVEDS
FT                   LIAALLALTAAALIAVAGYLQLLIGGSWPQLDAWLFDAVVFAASLKALSSLVTSLPDPL
FT                   EALKPLASAAASVMDELSWAVTLLAATVLGLKYLLGYSQILLSLGVLLYAVPFRVAKPA
FT                   GAWLIAFVIVFNAALPALPLFVESIGDPPAVAGAEGVWVGRITVTSSSGVVEAGLLRIH
FT                   SGGEEVASYVVKGGVAYSSLVKIPRVQAPLGLVSFTLEYMGVTFKPDPPALDTSTAGTS
FT                   IELHVPHIAFMGGESVMVYGSKQPARVTEGEEGVVASWEGLKDGDYVEIAWLEGCKPQY
FT                   SVREGDVRGEGSWTWEGLKGEYVYVEPSGEGRIVVWVEKWGDCDADAGLERIAKDYSET
FT                   LVSLLDYITLDVLKMIIVYYITLPGMYLSILLVATTGLARLLGGGARLRLKIM"
FT   CDS_pept        complement(161265..161528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0220a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0220a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34713"
FT                   /db_xref="GOA:Q05E88"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E88"
FT                   /protein_id="BAF34713.1"
FT                   /translation="MAADIVQMVEDLTGKLTALAWALFLLSWSIGWTLRGSPIPSSRIK
FT                   RVGNSLIEDSMWAALWLALGTTVFAVIVRLAGIVNEVLLGGG"
FT   CDS_pept        complement(161632..162558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0222.1"
FT                   /old_locus_tag="APE0222"
FT                   /product="putative carboxyvinyl-carboxyphosphonate
FT                   phosphorylmutase"
FT                   /EC_number="2.7.8.23"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0222.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79134"
FT                   /db_xref="GOA:Q9YFM7"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFM7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79134.2"
FT                   /translation="MAFLYREPLERPGLVLRELIEKRDIVVAPGVYNPAVALLAERMGF
FT                   EALYLSGAAITGSLAMPDLGLITLSELAMFTSYITRVVRVPVIVDADTGFGEAINVERT
FT                   VRELERAGAAAIQIEDQVMPKKCGHLQGKALISPEDMVKKIIAAVGARRDALIVARTDA
FT                   RGVEGFEKAVERAQLYVEAGADIIFPEALTSLEEFREFARRVKAPLLANMTEFGKTPYI
FT                   TVDQFREAGYKIVIFPVTTFRASLKASETVLREIMEKGTQKDILDKLYTRTEFYDLIGY
FT                   HDYEKRDAEVSRKAEELLARHNNSRTG"
FT   CDS_pept        162954..163766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0226.1"
FT                   /old_locus_tag="APE0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0226.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79138"
FT                   /db_xref="InterPro:IPR003750"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFM3"
FT                   /protein_id="BAA79138.2"
FT                   /translation="MALPSSILRVEPTLLLKTLKAGQIGRVAAIYRVDEIAVFEDPDSS
FT                   PRLSRLLQLLLNYQATPPHLKKRVFPLRRELKYASLMPPLKIPSHTVPAEPKVGAILDG
FT                   YVESCSGKSCRVFLGSMGYGVLRGRARPGDVVTVRIGEISGGRIVLEKASWGELYYGFS
FT                   VSRFKRLEEAVTSFRRRGYRVVATDKNGLCPPESWKILAEIPSAKTLVVFGGPYKGVLE
FT                   YTNPYLYDGVVNVIPRQGTETVRTEEALLATLEAISVLESLRQSSGQE"
FT   CDS_pept        164048..165082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl3p"
FT                   /locus_tag="APE_0227"
FT                   /old_locus_tag="APE0227"
FT                   /product="50S ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0227"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79139"
FT                   /db_xref="GOA:Q9YFM2"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFM2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79139.1"
FT                   /translation="MGARKKRAPRRGSLGFSPRKRASRLVPRVKRWPEVDIGKPVPLAF
FT                   LGYRAGMTHVFMVDDRPGRPTSGKEIFVPVTIVETPPMFVAAVRLYGYDPNRGRYSLGE
FT                   AWAQPPPELELQRRISTLGSFDTDKMLKSLEERLDKAEDVRLIAASQPKLAGGLSKKKP
FT                   DLLEIKVGGVSDVTKLFDYAKDVLGNLIAVNDVFEEGQLVDVIAVTKGKGFQGVIKRWG
FT                   VKELPRWHKHRKGSRRIGARSHGRSTFWETPQAGQTGFHRRTEYNKRILMIDDDGYKVT
FT                   PAGGFLRYGVVRSTFVMLSGSIPGTPKRPIVMRWAIRPPEWYLKLGVRKPEITYISLAS
FT                   KQGV"
FT   CDS_pept        165113..165931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl4p"
FT                   /locus_tag="APE_0228.1"
FT                   /old_locus_tag="APE0228"
FT                   /product="50S ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0228.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79140"
FT                   /db_xref="GOA:Q9YFM1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013000"
FT                   /db_xref="InterPro:IPR019970"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFM1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79140.2"
FT                   /translation="MAYTYMTLYMEQEKIVPVYDERGGEKDSVVLPQIFRFPVRKDLIR
FT                   RAFLSEFTARLQPKGRDPMAGKRTSAVSLGVGRGVARVPRIKGSLRAALVNMARGGRAA
FT                   HPPRVEKVLKEYINKKEKRLATISAISATSREDLVRQRGHRFSAETLPIVLDSSVLAKI
FT                   STAREARSLLESVGVYEDVLRAKEGKRYNAGKGKMRGRRYKVPKSVLFVLEDPRSPLAL
FT                   AVKGMPGVDVVTPTLLSVLHLAPGGHPGRLTIYTTEALKLLSRRFEVTLP"
FT   CDS_pept        165928..166188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl23p"
FT                   /locus_tag="APE_0228a.1"
FT                   /old_locus_tag="APES004"
FT                   /product="50S ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0228a.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79141"
FT                   /db_xref="GOA:Q9YFM0"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="InterPro:IPR019985"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFM0"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79141.2"
FT                   /translation="MKPEEVIIRVYVTEKTTRMLEEENTLTFIVRREATKNDVKRAVEQ
FT                   LFGVKVEKVRTLITPRGYKKAYVKLAPEYKALDVATKLGAV"
FT   CDS_pept        complement(166380..167309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0230.1"
FT                   /old_locus_tag="APE0230"
FT                   /product="MRP/NBP35 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0230.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79143"
FT                   /db_xref="GOA:Q9YFL8"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFL8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79143.2"
FT                   /translation="MSTQEGGRASKGFRVSRSEYKAIAERMKTIQEQQMKIVRNMRRIR
FT                   YKIAVISTKGGVGKSFVTASLAAALAAEGRRVGVFDADISGPSVHKMLGLQTGMGMPSQ
FT                   LDGTVKPVEVPPGIKVASIGLLLPMDEVPLIWRGAIKTSAIRELLAYVDWGELDYLLID
FT                   LPPGTGDEVLTITQIIPNITGFLVVTIPSEIAKSVVKKAVSFAKRIEAPVIGIVENMSY
FT                   FRCSDGSIHYIFGRGAAEEIASQYGIELLGKIPIDPAIRESNDKGKIFFLENPESEASR
FT                   EFLKIARRIIEIVEKLGPKPPAWGPQME"
FT   CDS_pept        complement(167424..168287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0231"
FT                   /old_locus_tag="APE0231"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79144"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFL7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79144.1"
FT                   /translation="MASRVVSYMTRDVYTVSPDDTLAHARKLMLTHDISRLPVVEGSKL
FT                   RGIITITDIADALVRKYPSRPANSIYVREVMARDVVTIEGTKSVKTAASLMLKHNIGGV
FT                   PVVAPDGTLEGIITRTDLTRYYSEKMKGVNLVKEFMREIYAKARREHSIFYVLKLMEID
FT                   ATGKVLILDGGKLVGVITKRDIAFLATPVSVHGAPKYVKIKKPLVYKDRIGSTRVYLVP
FT                   LAEDVMTPNPITVEPEEDLAKAADIMVKEGVGILPVVDGDNVLGVVTKVEVLQAIVSSR
FT                   RVRRRL"
FT   CDS_pept        complement(168287..169309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0233"
FT                   /old_locus_tag="APE0233"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0233"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79146"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFL5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79146.1"
FT                   /translation="MSRRGGAPSRPPRPPIRYVATAPKPSRVVTRSRPEGVRWLRADGT
FT                   PNWSQRVRRLPGDAKELASRPAVSVHKSAPILSAAEKIASHRVRGLVVIKGSGDAVLEG
FT                   ILLATDLVNYLGGGDYFQIVENRHRDSIYSALRKEVVATIMNRHPIAVSVSDDLDTILR
FT                   IMVGEGIGFLPVLYDDGTLHGVITERNILGRIADIPFDKKVGDYMTATIVGVDPEAPLK
FT                   EAMRSMVTYGFRRLLVISSSTGEIKGVITAKDIVAYFGEHEAFKNAPSGKVSEAISIPV
FT                   YMVMSPEVYTIDEKASVADAARRMVELGVDSLIVVDGGEAKGIITERDVLVASVVEGER
FT                   "
FT   CDS_pept        complement(169346..170182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0234"
FT                   /old_locus_tag="APE0234"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0234"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79147"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFL4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79147.1"
FT                   /translation="MERLAQPSRFLQRKLFEVNLLKPVTVEKEAPIGEIRRILRDTGSR
FT                   IVLVVNGEGRLEGVIYRSSVILVTSRKSEAKALDIMEEPAVVLKPSYSLEEAVFSMLKF
FT                   DEWYAPVVNDANRLVGVLGLETPIRLLLEAGFYRGYTASDAMTRDVEYVLEGDSLTRVW
FT                   EIMVERRYAGVPVVDQRMVVRGIVTQYDLIRKGYTRLGLESEAPPHRVRVESVMTRSVI
FT                   YVAESDNLEDVARIMLDRGVGRVPVVKSRDSRVLTGIIDREDLVRLYFKSRGRASL"
FT   CDS_pept        complement(170246..171175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="APE_0235.1"
FT                   /old_locus_tag="APE0235"
FT                   /product="putative thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0235.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79148"
FT                   /db_xref="GOA:Q9YFL3"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFL3"
FT                   /protein_id="BAA79148.2"
FT                   /translation="MNGFARWMDKLKVLSSEAGSKACWGYDACPAGDGIIASIDGYSMD
FT                   SSRLPWMSLGDWGWKSVVAAASDVAASGGAPFHVMYSLGLDSVERAVDVARGVGEAAVW
FT                   MGATVGKSDFNTSKSPWIDVAVLGKAEKPLGRFGAKPGMTLVQVGASGYGLLSHLTLQG
FT                   RLSRDDLPGPVVEYTRRPKPPLRIGPELSSCEAAASIDNSDGLGASLHLLGVESGVSVV
FT                   IDDILVDRHVEKVLDELGLEKWAVLQSWEDYNIVAVGGDGSIDCILRWCRRLNIECATV
FT                   GYTSSDGAGRVLIEGGRREFRVSGWTWL"
FT   CDS_pept        complement(171336..172085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobA"
FT                   /locus_tag="APE_0236.1"
FT                   /old_locus_tag="APE0236"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="SUMT"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0236.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79149"
FT                   /db_xref="GOA:Q9YFL2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFL2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79149.2"
FT                   /translation="MARCRGKVVIVGGGPGDPGLITVKGMKALEEADAILYDRLAPKGL
FT                   VEKLQTPALKIYVGKKPGEGMSQEEINRLMEILACRGMTVARLKGGDPYTYGRGEEECM
FT                   YLMEKGVECIVIPGVPSYIAASALHGIPLTSRGISSSFAVITGKEAPGKPAGKRVKLED
FT                   IARSVDTLVILMGASTSAELAERLIKVLPPETPVAIASSVSTPEAETLVTDLRGLRELG
FT                   RQGRVKSPAVIIVGEVVKLRDRLYKEA"
FT   CDS_pept        complement(172120..172755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0237.1"
FT                   /old_locus_tag="APE0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0237.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79150"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFL1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79150.2"
FT                   /translation="MELYIVVAGYSVRRGGSCPRGVRAAEAWRSVVSEAAESSDATVSR
FT                   AYLNISGPGHLSLVAAFTEAGGLGRLRLELSRWGCVEEAVWWPAYYKESPYARSKTAEE
FT                   VVEALKNSKFRFLVAYPMKKSPTWYLEPEEVRRRAMGEHIRIAMERTRENPVLSVTTYA
FT                   FGIADYEFLVLYEVDSIPAWIETVEALRAAEARKWIIREEPVLLGLRL"
FT   CDS_pept        complement(173022..173447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0238"
FT                   /old_locus_tag="APE0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0238"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79151"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFL0"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79151.1"
FT                   /translation="MSQLVKKYEAEEEVIQRVRRKILEEFEKMKVVIEDAEISVYTALV
FT                   DDDVVRLVLIALDEAKQPLSWRDLKKIFSGIVGEDRLRKILSSLKARNIIAELTHTRYS
FT                   LPQYVPVEEIPKIKNPGIIPVIERIHGKRLQSYEEVQ"
FT   CDS_pept        complement(173560..173886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0239"
FT                   /old_locus_tag="APE0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0239"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79152"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFK9"
FT                   /protein_id="BAA79152.1"
FT                   /translation="MPVFPTSISKLNITVGGVPVESGVSRRIASPVLYRELVTLSRKAL
FT                   EIDSEIALLGSEEEDVIDYIVLTAARRIVASDLAEILEYLSGVGEEDEIRADATTTRET
FT                   ASIA"
FT   CDS_pept        complement(174025..174555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0240"
FT                   /old_locus_tag="APE0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0240"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79153"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFK8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79153.1"
FT                   /translation="MLLKNEQRVKVDVDNSKVLVSGRRYEASHTLLVGTSGLSAEIEPG
FT                   SVRVSAYFSQHPEVEYVNEDLVKVYSAGSRYEVDTLGEKVAKVESGSNRVELQGDIISI
FT                   KFEVDSEIVTLKLPKGGRLKSAKLKVRAEGDVSLNVITFPFTMGILTARKSKATVTVKG
FT                   DVIELVVEPLKQK"
FT   CDS_pept        174775..175065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0240a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0240a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34714"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E87"
FT                   /protein_id="BAF34714.1"
FT                   /translation="MAGEEIPEDVFEDLELAKSEVEKELERARGKRKRRYPSNSDIAEA
FT                   IKELAGYARVDPQSFPERVREKLEEQGFYTGLVTDERIWRVYETLLRKGEI"
FT   CDS_pept        175118..175429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0242.1"
FT                   /old_locus_tag="APE0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0242.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79155"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFK6"
FT                   /protein_id="BAA79155.2"
FT                   /translation="MGECYFCLSKASHSCRLCGRPVCDTHGGGGVCVACREAICAVCGR
FT                   ELAVSYCSGCGRLGCVDCLVQYDPVRRFCRDCLARGASEFKPEALEPLKKVVRRVFGS"
FT   CDS_pept        complement(175437..175883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0243"
FT                   /old_locus_tag="APE0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0243"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79156"
FT                   /db_xref="GOA:Q9YFK5"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFK5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79156.1"
FT                   /translation="METKVPGPGSQHGIYVYNPEDGGWRLHRVDGGALDPKELGDGVVV
FT                   VYFDNALCPACRLQDRYWLEVVSKYSGDSRVKFVVVLCDWFSQNCSSKAAAESFNHYRI
FT                   GASPTIAVFAVKNGEVVYKEYLEGVRPSNIIQLYIDRALKAYTS"
FT   CDS_pept        complement(176357..176968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="APE_0244.1"
FT                   /old_locus_tag="APE0244"
FT                   /product="pyridoxal 5'-phosphate biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0244.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79157"
FT                   /db_xref="GOA:Q9YFK4"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFK4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79157.2"
FT                   /translation="MRIGVLGYQGGVYEHVYMLRRTFDRLGVHGEAVVVKKPEDLKGLD
FT                   GVIIPGGESTTIGILAKRLGVLEPLREQVLNGLPAMGTCAGAIILAGKVRDKVVGEKSQ
FT                   PLLGVMRVEVVRNFFGRQRESFEADLEIEGLDGRFRGVFIRSPAITAAESPARIISWLD
FT                   YNGQRVGVAAVQGPLLATSFHPELTGDTRLHELWLRLVKR"
FT   CDS_pept        complement(176965..178026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxS"
FT                   /locus_tag="APE_0246.1"
FT                   /old_locus_tag="APE0246"
FT                   /product="pyridoxal 5'-phosphate biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0246.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79159"
FT                   /db_xref="GOA:Q9YFK2"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFK2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79159.2"
FT                   /translation="MIPKYSPFSDSVRLYEVGFNEIVDFFYRLAEAGDKLREEGVWLAY
FT                   GPEKLPEALEKPVNGTVAVKLGFPIYQKGGVVMDVTNVEQAGIAEDAGAVAVMVLDKLP
FT                   YDVRKAGGVARMADVKVIEQVMSSITIPVMAKVRIGHYYEAMILESIGVDMIDESEVLT
FT                   PVDEKHHINKWLFKVPFVNGARSLAEALRRIAEGASMIRTKGEAGTGNVAEAVRHMKLI
FT                   MGDIWRLRGLSAEERLRVAREYGVPHQLVDLTARLGRLPVVNFAAGGIATPADAALMMW
FT                   LGADGVFVGSGIFKSSDPSERAAAIVLATSMWDDPEAVAEAQRMVSEAKSMMGIDIRKL
FT                   SPEELLQVRGAEA"
FT   CDS_pept        complement(178125..178979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0248.1"
FT                   /old_locus_tag="APE0248"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0248.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79161"
FT                   /db_xref="GOA:Q9YFK0"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFK0"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79161.2"
FT                   /translation="MGEGGILTIAHTPDADDAFMFYGIVAGAVEIRGFRGVRHVIEDIE
FT                   TLNRWLVEEGRDVDASAVSAHAYAYIVDRYFLLRTGASMGEGYGPVVVSKSESVRLEGS
FT                   RIAVPGRYTTAGLILTIALRGRFTPVYARFDEIPAMVEDGRVDAGLLIHEEQIAYSRRG
FT                   LTVVLDLWDWWARVTGGLPMPLGVDVFSRRLGRGAAEAFRDALRLSIEYAYQHFDEALD
FT                   YAMRYSRVKDRELVARFIKMYVNERTMDMGDDGVEAHRTLYRLARESGVLKKAVELRRD
FT                   DIV"
FT   CDS_pept        179131..180279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0249.1"
FT                   /old_locus_tag="APE0249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0249.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79162"
FT                   /db_xref="GOA:Q9YFJ9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFJ9"
FT                   /protein_id="BAA79162.2"
FT                   /translation="MSKLAGIAEDSVLERILDSADELGLGDTLHRALEGRASARDIVEL
FT                   YSAPAPLLGAVARRVTDLLTGRRVGYIVNMIMNYTNICVVGCTFCSFYRKPKHPEAYKL
FT                   EAREAAAQVVEAWRKYRIRQVLFQGGVDPAIPIEYYEEAFRAIKSETGGEVAIHGLSVV
FT                   EIEWLSKVSRMSVGEVVERLRDAGMDSVPGAGAEILSDRVRRIISPLKSSADTWIRTME
FT                   TIMEKGLPISATMVYGHVETLEERAEHLLKLLELQRRKGRIMAFIAWNFEPENNELGRK
FT                   IPYPAGGTELLKTVAIARIVFRGEIRWIQAGWLTAGVKLGQATLEYGANDWGGTLYGEK
FT                   VLPEAGVPLPKLVRRSIERLIWEAGYEPVERDNWYRPVSPSG"
FT   CDS_pept        180303..181481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0252"
FT                   /old_locus_tag="APE0252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0252"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79165"
FT                   /db_xref="GOA:Q9YFJ6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFJ6"
FT                   /protein_id="BAA79165.1"
FT                   /translation="MGLIPPKWLERMVEAYRDPSLERAVYGEVLTRSDIERLLSETPLH
FT                   PMAAAADYYARVIKKGVGSYIVNIYLAYTNVCVTRCTFCDFYVPPERRSSGYTHPPEHL
FT                   GRVAGLARKRLGVREVHMVGGNDPELPLEYYEEAIREIKRVAPGVVLKAFTAEEIGFIA
FT                   KATGNTPKEVLARFREAGLDALPGGGAEVLSEEVRKRIAPLKISSDEYLEIHRLAHSMG
FT                   IRSNITLLYAHIEEPRHVAEHLYRIRRLQEETGGFISFIPIRFNPGKTPLSRHPEYVKK
FT                   GDRGGLYDLRIVAASRLALLGAIDNIMAYWVSMGEKLAQAALSHGANDIGGTFYNESVI
FT                   SAASSLRKRKGMSPARLVFNIATAGWTPMERDTFYNYYPPRAEPPRLPWMQG"
FT   CDS_pept        181536..182243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0254"
FT                   /old_locus_tag="APE0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0254"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79167"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFJ4"
FT                   /protein_id="BAA79167.1"
FT                   /translation="MVYDLALPRHSYALPLIDEALSRGLTVVELQPPEAYDALVEGRVR
FT                   AALIPLALARGAKICPGPMVWSLSATMSVAIYSFSVRRLDDCAAVAVSGESRTSLVYLR
FT                   EVREKLQAPWSIVQAERGCVTLECLLSRADCALLLGDEALRARTRLPPIEDLGRLVKRV
FT                   LGISPVYAVTASIEDCPSGLPRGEPAVRRRHIEELCRRTGLGLRDALMYYTVLNLSYSP
FT                   EHLENALHVFDRE"
FT   CDS_pept        complement(182321..183073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0255.1"
FT                   /old_locus_tag="APE0255"
FT                   /product="putative sugar-phosphate nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0255.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79168"
FT                   /db_xref="GOA:Q9YFJ3"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFJ3"
FT                   /protein_id="BAA79168.2"
FT                   /translation="MSTPRTALILAGGKGRRFRPYTDLIPKPMIPLGRSEKPLLEYVVK
FT                   MLALQGVENIVLLVGYKWRYIYNYFGRGEKLGVKIDYSIDDERYSGTGGSVLKALEEGR
FT                   VSDEDFLVWYGDIIAEVGLASMYSLHRQHDASATLAVAERYQVPVGVVKAGREGVIEDV
FT                   EEKPWIGVNVFIGVAIFRKEAFREAAEGLGTSFDIMGDMMPILVRKSKAVAYIYDGPWF
FT                   DVGSLERYEKLREDVISRLERKLFPESI"
FT   CDS_pept        complement(183160..183717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0256"
FT                   /old_locus_tag="APE0256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0256"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79169"
FT                   /db_xref="InterPro:IPR007164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFJ2"
FT                   /protein_id="BAA79169.1"
FT                   /translation="MSVALSIPLLSLPEDMREALAAAAGPVYSGDRFRRQLLQTPCSGV
FT                   ACIGDYVSQACIATLSTAWTGPLILVVDGKTRRESWRDMVVPQGFRVHRVRSPPGSLSL
FT                   EAYTTICKLMEEYGRHVVFVEGEEDLIALAALDCGIDWTVVYGLPGVGGVVVHRCLRKP
FT                   GLENSSVLAFKPGTGVHHQSSP"
FT   CDS_pept        complement(183720..183938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE2"
FT                   /locus_tag="APE_0256a.1"
FT                   /old_locus_tag="APES005"
FT                   /product="DNA-directed RNA polymerase subunit E"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0256a.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79170"
FT                   /db_xref="GOA:Q9YFJ1"
FT                   /db_xref="InterPro:IPR007178"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="InterPro:IPR038589"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFJ1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79170.2"
FT                   /translation="MARRTSLVACKNCGTLVPRGSKVCPECGSTQFTENWSGMLVIIDP
FT                   ENSAIARELGIEKPVRKAILIGKKVMI"
FT   CDS_pept        complement(183945..184505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE1"
FT                   /locus_tag="APE_0257"
FT                   /old_locus_tag="APE0257"
FT                   /product="DNA-directed RNA polymerase subunit E"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0257"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79171"
FT                   /db_xref="GOA:Q9YFJ0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFJ0"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79171.1"
FT                   /translation="MYYEYVVEEWIGMEPASIYSSEDLDKAALEHLRRLEGRIDEEMGV
FT                   IVAVLDAKIVGDGIIPPVSGDPSIYYPVRYRVLAFKPVQLEIVRGVVTRADDFGLVVNL
FT                   GPLDGKVHRNQIMDEGVELLPDRSGFVGLASKREIRVGDVVRARVVHVSRPSRTAQIIG
FT                   IGLTMRQPYLGKEEWVAPEAKKG"
FT   CDS_pept        complement(184574..184744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0257a"
FT                   /old_locus_tag="APES006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0257a"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79172"
FT                   /db_xref="GOA:Q9YFI9"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFI9"
FT                   /protein_id="BAA79172.1"
FT                   /translation="MGMGWTAITLGEDLAGEISYLCLGCGRCDEVCPVEIPLSSIISKL
FT                   KARAASRVEEV"
FT   CDS_pept        complement(184846..185778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0258.1"
FT                   /old_locus_tag="APE0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0258.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79173"
FT                   /db_xref="GOA:Q9YFI8"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFI8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79173.2"
FT                   /translation="MGGSLDDVIKEVSRALGDKDFQEGLMKSGLNNQRKVAEILSSHPE
FT                   ILEAAKKVTEVKRESVKRLGELVERAVESLRRVGANPYYAETAEDAREIVGKIVGSGSI
FT                   VVMSKSMAAEEIGLREHLESMGNEVWETDLGQLLVMLEGVKPMHNVAPAVHMTRERAAR
FT                   IIREKLGIEVDERDVEGMVAAVREFLREKFFKARVGITGANSMSADTGTIVLVENEGNI
FT                   RLVSSLPPVHVALVPIDKIVPSVWDAVNVALVQAAFAGFWMPVYISLITGPSATGDIEQ
FT                   IKVLGAHGPREVHVVLLDNGRMKAASHPF"
FT   CDS_pept        complement(185843..186763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="APE_0260.1"
FT                   /old_locus_tag="APE0260"
FT                   /product="probable dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0260.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79175"
FT                   /db_xref="GOA:Q9YFI6"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFI6"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79175.2"
FT                   /translation="MYSQPELSISIAGLRLQRPVGNASGILGWEPREARLVEEGGGGFF
FT                   VAKSVTYQPRKGYPQPHLYPVAGGIVNAVGLANPGFREASKMLAQTVEEASIPVIASIA
FT                   GGAPGEWVEMASTLEEAGVSAVELNLSCPHFAGGGLELGQDPAAVASVVSAVASTLRIP
FT                   VIAKLGYSDRLVDAASKALEAGARGLTLINSMRAMKIDVYAKKPVLGNRVGGLSGKPIH
FT                   PIAVRAVYEVYGETRADIFAAGGVESWEDAVEFYLAGAKAVQVGAAFITIGPHVLRSIV
FT                   EGVRRYLWVEGFRSLQDIVGYAHRA"
FT   CDS_pept        complement(186735..188012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="APE_0261.1"
FT                   /old_locus_tag="APE0261"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="DHOase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0261.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79176"
FT                   /db_xref="GOA:Q9YFI5"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFI5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79176.2"
FT                   /translation="MAGWTVCVDFLYTGDKMLEDACAVISGERVERVHTGGFRGQPDLD
FT                   LRGRSSLALPGVIDMHVHLRGLKLSYKEDEVSGTAAAASGCVTLVADMPNTQPPLRTPE
FT                   ALREKLASLEAGAKVDYTVYAGVPRSYGEAVEMASMGIAGFKIYPEDLVNLDSIKNVLE
FT                   AAEEAGILVVLHPESHDMFAGPDYGWLRRVARPCHAEAASVELLHDAARECGCKPRVHI
FT                   THASCPATVVESKKRGFTVDVTPHHLFLSEEEVAGPTHSWGKVNPPLRGVGERSLLTQL
FT                   TIEGLVDAIASDHAPHSTWEKWMHPAIAPPGFPWLEWWPGFTAARLMRAVGLERFYSMV
FT                   SQTPSTILGVGDRCLWDGCPATISVLQLERTRVYHKGYTKALYTPVLGMESFDCAATVI
FT                   RGKIAYTAWEGVRGGATGVLATRVVH"
FT   CDS_pept        188063..188755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0262"
FT                   /old_locus_tag="APE0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0262"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79177"
FT                   /db_xref="GOA:Q9YFI4"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFI4"
FT                   /protein_id="BAA79177.1"
FT                   /translation="MLGPKGWCALEIIGHRANSGRIAIFYSMVGIKAVEVDVSLKSGKP
FT                   MALHGRPSVRRATPIGRLWGWIDYKLFYRDPLYKPMPLANWLERLWSMGFTKVVIDVKS
FT                   GGIDPTLLASEVERGWPGQVIYTSENHRYLRRLREEASAVVYTTYSILPVDVADPALKA
FT                   GAEGVSIRFDLAIEDNVIRALRQSGLKVVVWTVNTEDQAKTVEKLGVDAIVSDRPDKVL
FT                   RALDKREK"
FT   CDS_pept        complement(188799..190091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0263.1"
FT                   /old_locus_tag="APE0263"
FT                   /product="pernisine"
FT                   /EC_number="3.4.21.-"
FT                   /note="subtilisin-like serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0263.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79178"
FT                   /db_xref="GOA:Q9YFI3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034202"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFI3"
FT                   /protein_id="BAA79178.2"
FT                   /translation="MGTKIAAIAIALIFILPLFPVYTGSAAGASTVVIAKINPEEFNPK
FT                   AVEALQGKVIYVADLAPVAIISIPGKAVGLLSKLPGVVSVSEDGVVQAMAKPPWAGGGN
FT                   KSQPAEVLPWGVDYIDAELVWPDGVTGWVDVNGDGDGEIEVAVIDTGVDKDHPDLAGNI
FT                   VWGISVLNGRISSNYQDRNGHGTHVTGTVAAIDNDIGVIGVAHSVEIYAVKALGNGGYG
FT                   SWSDLIIAIDLAVKGPDGVIDADGDGVVAGDPDDDAPEVISMSLGGSSPPPELHDVIKA
FT                   AYNLGITIVAAAGNDGADSPSYPAAYPEVIAVGAIDENGNVPSWSNRNPEVAAPGVNIL
FT                   STYPDDTYEELSGTSMATPHVSGTVALIQAARLAAGLPLLPPGSESDTTPDTVRGVLHT
FT                   TATDAGDPGYDSLYGYGIIDAYDAVQTAVSS"
FT   CDS_pept        complement(190586..191218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0264.1"
FT                   /old_locus_tag="APE0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0264.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79179"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFI2"
FT                   /protein_id="BAA79179.2"
FT                   /translation="MDRDVIGPTECDEYREQRNSKINDEWNLLIEDKNVFANTYIIVST
FT                   AVDLYREALSAYQNGAYMAAILMSGVALEALVYDLVAALRGYVKCYEGNIYEAELDSNV
FT                   YKWVRLDSALQELKNSGIINKPLERRFYRAREMRNLVAHYAQKRQKRLRESIAEIIKAR
FT                   EDRKTYAIIKGLEKGLWATEEEALNTLKETAWILKALIERAYKEFCY"
FT   CDS_pept        191705..192070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0265"
FT                   /old_locus_tag="APE0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0265"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79180"
FT                   /db_xref="GOA:Q9YFI1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFI1"
FT                   /protein_id="BAA79180.1"
FT                   /translation="MGADTRLPLTELKREVNKLLYKSKILGVLTSGTITLVFYFYSHLL
FT                   AYTYIGIPNSEQLIIVTMITVRNYAATVGLWAESFDTIFNLAIGLILSLLSLVPPLAIL
FT                   IRHVAMLRRIGKRIAQP"
FT   tRNA            complement(192691..192778)
FT                   /locus_tag="APE_tRNA03"
FT                   /old_locus_tag="APEtRNA03"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:192741..192743,aa:Ser,seq:gct)"
FT                   /note="codon recognized: AGC"
FT   CDS_pept        complement(193024..193455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0267"
FT                   /old_locus_tag="APE0267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0267"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79182"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFH9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79182.1"
FT                   /translation="MPVFKRYMRSPRLKAKHVMSTPPVTIEVGRSIAEAARLMAERGVG
FT                   SLIVVDKQGLVKGILTERDIINSLASGKACAEGKVEDIMSRNPIVASPDDDLEIIIEKM
FT                   RDMNIRHIPVIDEDGRPLGMISVRDIIDLGVSALKLFVE"
FT   CDS_pept        193544..195373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aor"
FT                   /locus_tag="APE_0266.1"
FT                   /old_locus_tag="APE0266"
FT                   /product="tungsten-containing aldehyde ferredoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0266.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79181"
FT                   /db_xref="GOA:Q9YFI0"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFI0"
FT                   /protein_id="BAA79181.2"
FT                   /translation="MSNCPGGYNCRVALVNLNKLRIEAVDLDPEALEYFPGGRALGVAL
FT                   LYNLLGRYDSPLVLATSPLVGSGFVMANRLTIVFKSPLTGTIAWANTGGYVSPALKKAG
FT                   FDALVIVGRSREPHYLLIEDGSVDLLPAEDLWGLDAVEVALMLRRRHGDVRVLSIGPAG
FT                   ERGVSYATVINDTGRSSGVRHGAGAVMGLKRLKAIALKAKGVGSKAKPSDRSTLLRISR
FT                   EIASRIMASSLLNREKGLLAVYGTPVAMEALGPAEAVPHLNYRNPVLERWEALSGRIMS
FT                   KTILAGRLTCSSCPVACRRDTVGVSLSFRTEGPDYAQISSLGSNTGLISLEGVGYLTSL
FT                   SYRLGLDPIEAGNILAMYAEITELEDLGREGLVWGDLEAMEKLLVSTAYRRGVGDLLAG
FT                   GARVVAEKLKRPEVRTDVKGVTIQNADPRVEKAWGVINSVEAFGGAAHIWVYGGIVASF
FT                   KTLGVNVAVDWSFNPETTAKAVYEHQLLVAAADTLQVCAFSQYAAGWRDYARALSAVTG
FT                   VKWSVEKLRGAAETLLDLERLLNQQLGIEPTEDVLPPKFTENPVPKGKHKGETADVSSH
FT                   IEEYYSLRNLKNGKIGSERMREATSKAKAARIA"
FT   misc_RNA        complement(195771..196118)
FT                   /locus_tag="APE_srpRNA01"
FT                   /product="RNA component of signal recognition particle"
FT   CDS_pept        196170..196424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0266a.1"
FT                   /old_locus_tag="APES007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0266a.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79185"
FT                   /db_xref="GOA:Q9YFH6"
FT                   /db_xref="InterPro:IPR002849"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFH6"
FT                   /protein_id="BAA79185.2"
FT                   /translation="MAEWGWLVAAGFLLIFLGVFLVFIGVFASAVQGGGRVEGGGVVVV
FT                   GPIPIVFGSSERMFLLSAIIGLVFMILAIALVLLARKGV"
FT   CDS_pept        complement(196429..196611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0266b"
FT                   /old_locus_tag="APES008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0266b"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79186"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFH5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79186.1"
FT                   /translation="MARIDLESFLREKSDILKSSSAHLLGEAKSNVIQAYKRAVEELEK
FT                   IKREGVEQAVETLSK"
FT   CDS_pept        complement(196677..197462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="APE_0270.1"
FT                   /old_locus_tag="APE0270"
FT                   /product="molybdate ABC transporter, permease protein ModB"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0270.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79187"
FT                   /db_xref="GOA:Q9YFH4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFH4"
FT                   /protein_id="BAA79187.2"
FT                   /translation="MLRVYGVPTALSIALGLASLAIVASPIPMAASRDLIDLFLEERFR
FT                   RSLVLSLGSSTISSVLAVTLATAPAYAMARQEGRLTRLISQLHLLLLSIPPVGLGTAAL
FT                   ILFTRYPPLNSISETLGLFFSPKAVILAQLLVTTPIAVSMLTGVFSMVPRELEEAAEAY
FT                   GAGRLQILIRIVLPLSLPGILSALAVTFFRALGEFGATLVLAGNIPGRTETLPLALYNA
FT                   ISLADVETASAIYTLVLAVGLVTLGVHTLLYTRLVKRTG"
FT   CDS_pept        complement(197456..198250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="APE_0272.1"
FT                   /old_locus_tag="APE0272"
FT                   /product="molybdate ABC transporter, molybdate-binding
FT                   protein ModA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0272.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79189"
FT                   /db_xref="GOA:Q9YFH2"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFH2"
FT                   /protein_id="BAA79189.2"
FT                   /translation="MSVPKLVFAALLLLSFSLVLAAILGVFMSDDAVEVLVFADRTLQA
FT                   PLEEVLSSFSRERGVNVSYVYGSSGFVLAQLELRGNGDLYVSDGWEFAVKGVEEGLLDK
FT                   EYFTVVGCIRLALIVEKGNPKGVSSLRDALERDDVTVALGNPEHVTAGVLAWRLLEELG
FT                   LEEAAVKGIGDGRVVLVDSASQAAYYVATGLADAAVTFNVYTVLMGDKVEEVYDGAVAS
FT                   VKAPVVVALPVNRGPLAEDLFRFVVEHSYVFADYGVEVGGSC"
FT   tRNA            198449..198526
FT                   /locus_tag="APE_tRNA04"
FT                   /old_locus_tag="APEtRNA04"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:198484..198486,aa:Arg,seq:ccg)"
FT                   /note="codon recognized: CGG"
FT   CDS_pept        complement(198657..199091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0273"
FT                   /old_locus_tag="APE0273"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0273"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79190"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFH1"
FT                   /protein_id="BAA79190.1"
FT                   /translation="MRIFVDTSIILAFLAGQDDRAKDLMRKVERHEITGYINPLVIDEV
FT                   IHGYLRLATGLSARRIRKLLARRDERLIKMIKGEVWPVLKLFTTLPLMAEPGEIIEFIE
FT                   EYGLMPADALIALTCKQHELDTIATLDEDFKRIPWLKVVP"
FT   CDS_pept        complement(199069..199290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0273a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0273a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34715"
FT                   /db_xref="InterPro:IPR008203"
FT                   /db_xref="InterPro:IPR024069"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E86"
FT                   /protein_id="BAF34715.1"
FT                   /translation="MSKVIRVKYEKGVLKPLEPLDLQEGEEVQVIIQPGEPIAEKYYGI
FT                   ARKHRPNLDKKEFLEVLEEIEDEDIRGH"
FT   CDS_pept        complement(199327..199677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0274"
FT                   /old_locus_tag="APE0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0274"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79191"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFH0"
FT                   /protein_id="BAA79191.1"
FT                   /translation="MIANTTSREILQHRSRCPKPFVREFPEFVTLRYPVFDPIRSIHTS
FT                   RWVFYKKLGKDLFYMDEFTYTLRTYTLTELVEMAENVGWRLEAAYHNLGTLEPPHPEGS
FT                   PINTVFRNKVTA"
FT   CDS_pept        complement(199916..200131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0274a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0274a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34716"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E85"
FT                   /protein_id="BAF34716.1"
FT                   /translation="MDDWVWEVFVEKAELFMAIMERVWDRGRREAEDLARVLEKHGIPR
FT                   GSTILEPGCGIGRVAIPLAKLGYRVT"
FT   CDS_pept        complement(200817..201218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0275.1"
FT                   /old_locus_tag="APE0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0275.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79192"
FT                   /db_xref="GOA:Q9YFG9"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFG9"
FT                   /protein_id="BAA79192.2"
FT                   /translation="MKAALRIQSRLITSYGEHVSIGREVFYSFPDPERLISLSLDRLRR
FT                   IGLTRMKAQAIKNIAMTEYEGRLPSVEEIEQAEELSSIVKELTRLKGVGPWTAELAIAQ
FT                   VHPLFPLGPRTDLAVRRGFKNYWGYRMRP"
FT   CDS_pept        complement(201925..202152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0275a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0275a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34717"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E84"
FT                   /protein_id="BAF34717.1"
FT                   /translation="MPSEIRLKYDRSSDALYIRVKESRIVDSEEIAPGIIVDYDEHGEI
FT                   VGIEILGFSKKKIDLHRLVTEGPEAMVLEA"
FT   CDS_pept        complement(202422..202748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0275b.1"
FT                   /old_locus_tag="APES009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0275b.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79228"
FT                   /db_xref="GOA:Q9YFG8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFG8"
FT                   /protein_id="BAA79228.2"
FT                   /translation="MDIEGIADNTSKKAALNIAEKHGFNVILPDNHLTKLSLTYDIIKR
FT                   DAESIDMETAIVYHLANKFHIPAIAILGVSDYKAKNKVEFVTYEEELKDEIFEIGLELT
FT                   LEVK"
FT   CDS_pept        complement(203152..203670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0276.1"
FT                   /old_locus_tag="APE0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0276.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79229"
FT                   /db_xref="InterPro:IPR021799"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFG7"
FT                   /protein_id="BAA79229.2"
FT                   /translation="MQRSNEDEERLLVVSNSSIIIALARVCRLDLLEKLFGEVLVPETV
FT                   WAEITVAGKPGSEKVVRAGFIRVEEVVDRRLVSLFEEFVDTGEAEAIVLAFERNAGLLL
FT                   MDDRDARNLAKKLGLQVMGTLGVIALAKYKGLTSKAKPIIDKLIESGFWISRRTLEEFL
FT                   RKLGESRNP"
FT   CDS_pept        complement(203657..203926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0276a"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0276a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34718"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58322"
FT                   /protein_id="BAF34718.1"
FT                   /translation="MAGIGSRRIVIEVPEGLRVPPGELEKRLRIELALRLYEKGIASLG
FT                   QARKIAGLSKWDFLELLAREGIPLHYSEEELKEDLEVAKKLAEK"
FT   CDS_pept        complement(204280..204756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0278"
FT                   /old_locus_tag="APE0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0278"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79231"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFG5"
FT                   /protein_id="BAA79231.1"
FT                   /translation="MDKDEEKDGEALVLDTNIILASVLRHGSYTRQVVIYLIDVLGIKA
FT                   FTSEKALHEIDEHLEELAKRKKVSVEELRAAIRILLLNVNMVEKGTYNAYMEKAGECVK
FT                   DLADADFAALALHLSEKYKNVILLTWNKNDYIENCLKAYGVILYTPSDLRVPVN"
FT   CDS_pept        complement(204720..204920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0278a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0278a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34719"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E82"
FT                   /protein_id="BAF34719.1"
FT                   /translation="MSTEDAVVRVRLPRWIVEEARKRGLGEDAIARAAVKLALLEEILS
FT                   KHGLEEDDLEWIRMRRRMARR"
FT   CDS_pept        complement(205301..205759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0279.1"
FT                   /old_locus_tag="APE0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0279.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79232"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFG4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79232.2"
FT                   /translation="MHKGGLVVDASLAADLFAAKDKARAQIAEKVVECIERHSISVYAP
FT                   RLFLVEVAGVLVRYLAPSIVERVLDAFSSKVILVGDEAYFRIAVEIALATGSRGADSYY
FT                   LGLAKTLNLPVATSDKVQAQNARKAGIKSFYILSNNELEELMKYMGCK"
FT   CDS_pept        complement(205752..205952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0279a.1"
FT                   /old_locus_tag="APES010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0279a.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79233"
FT                   /db_xref="InterPro:IPR008203"
FT                   /db_xref="InterPro:IPR024069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFG3"
FT                   /protein_id="BAA79233.2"
FT                   /translation="MSKVIRVRYEKGVLKPLEPVNLEDGEEVDIIIRENLAELARRIRR
FT                   RLSQEREEPSEILSRERSRLA"
FT   CDS_pept        206858..208840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0283.1"
FT                   /old_locus_tag="APE0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0283.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79237"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFF9"
FT                   /protein_id="BAA79237.2"
FT                   /translation="MSRELIGLGAGILIRLLLKNLKKKGQHIEERAPPQLTREQIDQYI
FT                   VDTTIDEAYEQLQAEYDRAYRELLKREKEAEDPHIKKLIQNIKEYHELFRKDNEMRPPW
FT                   MLTAILLNEALKHGVKDRDKIYQYILKASWEYAKEIAQALPAKKYQGRYTRAYADQMRN
FT                   PFISIIEIEAMIREANRDDPKWKKYTQMFDLYWNKIPDDIYNRADSQHHEVTKYLQLLE
FT                   EALREAERESGVEPFWHKTPEEILGIGPGEGPAPAGEPILAYPDRYPTLAQKVLLKTLV
FT                   LGEFLREGGGVHRDLYRALRNLLDSPLTTNHWYPFLAEWFENLEKGRHVSPLTQLLQKL
FT                   PVNPELKQRAYRYLAQIEQGKSISEIPEEERKAFREVIERLKNEIWRNPDRFVPIVEEL
FT                   TYATGMNIKDAAKTLIGVLDDFAKIYSGEKSPRQAGIERDATQVLHVIKNLRDRGNYVD
FT                   PYHVTETLINIIEQHIQDPLLREAYKRILEHYQRTHGEIPRDLRYLERVVEEERELEEK
FT                   LKGLERENRKLSEGDIRRTAMLYRTLMLLTPHPSLEDIKRFYSRLAERLKVKVGEESFL
FT                   PVHGPVAEDVASSFAAIRRAKPEERERVVRREISGFEPLFHAAPHIKEGVMSVLAATRS
FT                   NIVSGEKHEEFIRHLERTQVRRPLE"
FT   CDS_pept        complement(209347..209469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0283a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0283a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34720"
FT                   /db_xref="InterPro:IPR008203"
FT                   /db_xref="InterPro:IPR024069"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E81"
FT                   /protein_id="BAF34720.1"
FT                   /translation="MEIGISKAIRVKYEKGVLKPLEPLDLEEGEEVVVTVNATL"
FT   CDS_pept        209991..210578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0287"
FT                   /old_locus_tag="APE0287"
FT                   /product="protogloblin ApPgb"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0287"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79242"
FT                   /db_xref="GOA:Q9YFF4"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012102"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFF4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79242.1"
FT                   /translation="MTPSDIPGYDYGRVEKSPITDLEFDLLKKTVMLGEKDVMYLKKAC
FT                   DVLKDQVDEILDLWYGWVASNEHLIYYFSNPDTGEPIKEYLERVRARFGAWILDTTCRD
FT                   YNREWLDYQYEVGLRHHRSKKGVTDGVRTVPHIPLRYLIAFIYPITATIKPFLAKKGGS
FT                   PEDIEGMYNAWFKSVVLQVAIWSHPYTKENDW"
FT   CDS_pept        210667..211257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0288"
FT                   /old_locus_tag="APE0288"
FT                   /product="putative transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0288"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79243"
FT                   /db_xref="GOA:Q9YFF3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFF3"
FT                   /protein_id="BAA79243.1"
FT                   /translation="MHEDDVSIKIVSAIERIARAYRILIARESYKHGLTPLQASILLYI
FT                   YNSPPNHRTISSLVRELGVKQPTISDSVRALISKGLVTYEPHRSDRRVKILKLTPKGVE
FT                   IAESLKSWQTVAAEAVDLSRGEREALLELLLKYMASLYRYGVIEVARTCFTCTYLEAKN
FT                   RGEGVSYYCSLLKRELGRSGLRVDCPEHSPKRI"
FT   CDS_pept        complement(211409..211954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0290.1"
FT                   /old_locus_tag="APE0290"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0290.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79245"
FT                   /db_xref="GOA:Q9YFF1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFF1"
FT                   /protein_id="BAA79245.2"
FT                   /translation="MDEKGLRLSGGVRRLIPVRLEEAKALSDELRIMILEMLHERPMSV
FT                   EEIVRSLRERGIMKTANTIRYHLSILKDSGLVDLTRVGRTYKYVAKSRYYAYTGDPEAD
FT                   KLIEEMAEEVKDDVKRIVEKLIATRGDELVAIAEKLKPCEFCVTKHFVEQVIFEIIKKS
FT                   LGSVLAETTLAKNTDKEL"
FT   CDS_pept        complement(212077..212292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0290a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0290a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34721"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E80"
FT                   /protein_id="BAF34721.1"
FT                   /translation="MLKAKRSSLFGVLKGLGPIRFADRATFVIDSEGRIAKVIRGFMNA
FT                   ERHVVEALEEVKKLAQDDSGYNTASS"
FT   CDS_pept        complement(212234..212566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0291"
FT                   /old_locus_tag="APE0291"
FT                   /product="truncated thiol peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0291"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79246"
FT                   /db_xref="GOA:Q9YFF0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFF0"
FT                   /protein_id="BAA79246.1"
FT                   /translation="MLSVGDPAPDIEIQLIDGSTIRLSQLRGRSVVLYFYPKAFTPGCT
FT                   REAIGFNGLYEEFKKLGAEVIGVSMDPPGRNRRFAQNYGVRFRLASDVEGEAFKSFWGA
FT                   QRPRTD"
FT   CDS_pept        complement(212733..213011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0291a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0291a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34722"
FT                   /db_xref="GOA:Q05E79"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E79"
FT                   /protein_id="BAF34722.1"
FT                   /translation="MNPLWAIALVAAIAQLVLAILLAANYGRISHTPVGKAMVVLAALF
FT                   LVQGVIATATYYRLASEGYGMELAAPLAAITVASLAGLSILYTISRT"
FT   CDS_pept        complement(213008..213313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0293"
FT                   /old_locus_tag="APE0293"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0293"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79248"
FT                   /db_xref="GOA:Q9YFE8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFE8"
FT                   /protein_id="BAA79248.1"
FT                   /translation="MPSGVDGVGLLVRWLIEGSRGGVTRARILMLLRERPRNAHQLSQE
FT                   LGLNYRTVLHHLEVLARHGLIARLYEGYGAPYALTNLAERHWSVIEDSIRRVGVRL"
FT   CDS_pept        213569..214009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0294.1"
FT                   /old_locus_tag="APE0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0294.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79249"
FT                   /db_xref="GOA:Q9YFE7"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFE7"
FT                   /protein_id="BAA79249.2"
FT                   /translation="MASVSTRYALVGLLIAVIAIVAIAYLYLGGGGYGGQETTSPGEEA
FT                   TGAGGSTVVKVELYEWGIKIDKTMFKAGEKVVFEVVNKGSYTHAFEIENDDIGFEVETK
FT                   NLAPGESTKLEVVFPQPGEYEVYCPIDGHRDFGMEALITVSG"
FT   CDS_pept        complement(214107..214838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0295"
FT                   /old_locus_tag="APE0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0295"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79250"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFE6"
FT                   /protein_id="BAA79250.1"
FT                   /translation="MKRREKSLGEKGWTARSMPLRDLARTLGSILRNKMGIGPWSGVGI
FT                   SMQKSLSKNILLIVEADSSEVKIKGTVEKRLSLKGYRSIGGDVRLGFSERNGRLVAKLR
FT                   LDSASAIVEAPLEALAVIADSSGIAIEALDAPLDYVSVKADSSGVKGRSKIKPGGGVYV
FT                   EADSSGVKLAIAPATRGEYWIDVDAKSSGVTIEFEGDKTYYVEEQVARLSRLEVKKDAG
FT                   TPGGNRVRVNVKAVSSSVKIV"
FT   CDS_pept        complement(214835..215152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0295a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0295a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34723"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E78"
FT                   /protein_id="BAF34723.1"
FT                   /translation="MQRTRRIVAAVILAARVLGLTVRLGLMYLRLRMRLGLWKTMSKIQ
FT                   FKRRTRSLPKGLAGELVVEYERYIDGITLPSLAGLAGGPHLELVKPFGWERRRRRGVSV
FT                   A"
FT   CDS_pept        complement(215139..215558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0297"
FT                   /old_locus_tag="APE0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0297"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79252"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFE4"
FT                   /protein_id="BAA79252.1"
FT                   /translation="MSFEERLERIERLLAEVLQRLRRIEEMAEAGEQEARMAAEMAMAF
FT                   TLPIHEALSTARRVARAVSRLDKGLGDDGIAKAIVEALAVNGPLTLRGLEREVRRLRGT
FT                   ASRRVIRERLRALERLGIVEVERRGRRLVIKLATD"
FT   CDS_pept        complement(215617..216021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0299.1"
FT                   /old_locus_tag="APE0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0299.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79254"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFE2"
FT                   /protein_id="BAA79254.2"
FT                   /translation="MDEEKRREAREAVKEAFPVSEEAGGVEVEVSHEHEDSRSDVEELR
FT                   EVLTAISEFIKNLEEPLGNILKTALSVMDGSKLGEEVAAFYRNLRDSGMPDEMVEELTR
FT                   EYFRMRMESLNIARIIRELAKGELSQAGEK"
FT   CDS_pept        complement(216356..217615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0300.1"
FT                   /old_locus_tag="APE0300"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0300.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79255"
FT                   /db_xref="GOA:Q9YFE1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFE1"
FT                   /protein_id="BAA79255.2"
FT                   /translation="MLALALHDVRVYFPITTFYLKKVIGYVKAVDGVSLSLKKGEILGV
FT                   VGESGSGKTTLAKTIIGLHRPFTGHVFIDIDKGELEEAVSIYEALKRGENVQREDIKRY
FT                   RKIIKTHDPYYMDRSNYKKFRRKVQMVQQDPYSSLNPRMKVGEIIGEPVRVHGIEKSSE
FT                   GVKRRVIEVLEAVGLGKEFADRYPYELSGGQRQRVAIARALALNPKILVLDEPTSALDV
FT                   SIQAQILRLLRELWKKYGLTYLLITHDISVVRYMSSSVVVMYSGKIMESAPKHILFTNP
FT                   LHPYTKLLLSAVPIPDPRSRRIKEFKDIGEPPNPAKPPVGCRFVTRCPIASREICGFSV
FT                   EDHADSDVEIIDVTKIGDTIRIRVSKNAENLAKKLRETNSTIINEIVVKGKLVEIRLHT
FT                   DLEPKLRELGEGHAVACHKV"
FT   CDS_pept        complement(217622..218590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0301.1"
FT                   /old_locus_tag="APE0301"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0301.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79256"
FT                   /db_xref="GOA:Q9YFE0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFE0"
FT                   /protein_id="BAA79256.2"
FT                   /translation="MSEIVLSIRDLTVNYYTRQGVVNALDGVELDVYQGEILAIVGESG
FT                   CGKSTLARSIARILPSNAVIEKGSIILNLGSGNTVDLVRLSEDELVKIRGKIVSMIFQD
FT                   PSAALSPVHKVKKQVTDHVSGEKRRVEKIAQEILKKLMMPAPHMILEKYPHELSGGMKQ
FT                   RIVIAASLITRPRIIIADEPTTALDVTVQAQILKMLSRLREELETTIILITHNLAVAAE
FT                   IADRIAVMYAGHVVEVADVFSLFERPLHPYTKGLLKSIPKPHVDEEIEPIRGEPPSLAD
FT                   PPPGCRFHPRCPYVMDVCMRIKPRLEERAPGRLVACHLEER"
FT   CDS_pept        complement(218587..219492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0302.1"
FT                   /old_locus_tag="APE0302"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0302.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79257"
FT                   /db_xref="GOA:Q9YFD9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFD9"
FT                   /protein_id="BAA79257.2"
FT                   /translation="MPLLIVKSLYEKFESLILELYSNPLSRMGLIIITGFILIAVAAPL
FT                   LAPPNYPDPYKIPKVYSSEPLPPSSKHPFGTSGPPGYYDIYYGVIWGTRISLRISLIVV
FT                   GVAVAIGVVVGSISAYFGGIIDNILMRITEVFLSLPGLILAMAIASMMERSLQNMILAL
FT                   IAVWWPAYARIVRAEVLRVKNEPYVEAAKILGLNTYRIIARHILPNSIYTVLVIASMDL
FT                   GLVVLVASGLGFLGLGAQPGTAEWGIMISEGRNWLLQGAWWPVFFPGIAIFLWVLGWSL
FT                   LGDGLRDVLDPRTRKRGVLV"
FT   CDS_pept        complement(219506..220534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0303"
FT                   /old_locus_tag="APE0303"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0303"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79258"
FT                   /db_xref="GOA:Q9YFD8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFD8"
FT                   /protein_id="BAA79258.1"
FT                   /translation="MLIKYIIYRFLSAIPTLFGLSILVFILTRLVGDPAAIYIHPDMTP
FT                   EDVQRVRELYHFDDPLYVQYIYWLKGVLQGDLGYSVTANMPVTEAIKSFLPATLELALY
FT                   AFTLSIIVGVYLGTKAAANKDKLIDHLTRLLALSGYSMPVFWLALMLLYLFYNVLDFVG
FT                   PGRLSLEVRFKYMPPYGDFKFYTGLLTIDALLNRNIEVFIDAVKHLIPPVLTQTYIHIA
FT                   IFIRVLRSSMIEEMNKEYVDFALSKGLRREVVLKDYVRRNSYISLVNVAGLQFVGLMSG
FT                   VVLTETVFNWPGLGRFAANAAIQLDPAAVVGFTLFVGTLFIVVNLAVDILLAYLDPRIR
FT                   YE"
FT   CDS_pept        complement(220551..222950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0304.1"
FT                   /old_locus_tag="APE0304"
FT                   /product="ABC transporter, substrate-binding protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0304.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79259"
FT                   /db_xref="GOA:Q9YFD7"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFD7"
FT                   /protein_id="BAA79259.2"
FT                   /translation="MSNSRSIGVRIAIAALIIVFIIVAAWQLFTTPGGGETASPTTTET
FT                   VASPTEAPKETIAPEVNNPPYAIARASSLFAKVGEVIEFDGTLSKDPDGKIVEYVWDFG
FT                   DGTTAFGAKVSHAYELPGSYIVVLTVKDDKGAVDTNDETLLYITVEIGDIPQSPDSPPV
FT                   AVISSDKDIVTPGEEVSFDGSSSWAWVEKKEDDKVSIVKSVEAITEYVWDFGDGTTATG
FT                   KSVTHTFEKPGSYPVKLTVKAVNGKTASAIKTIRVVEEKKGPAIQLKHPDTIIVARIGE
FT                   PQGLDPAFAHDTASAEIIDNVYERLVWTTKNFKEIKPWLAERWEIKDNGTTYIFYIRKG
FT                   VKFHNGEELTAYDVEYSFKRLLVLDLPQGHVRQIKPFLIDEWDPDQIDQAIRAIDKYTV
FT                   VFKLKKPFAPFLRILASDYAFVIINKKWAIEHGDWDPSLPKSEWSKFRGKINDYIMRNP
FT                   MGTGPYKMVEWVPGQRIVLERFEDYWQGPAPTKRVVIMFVPELSTRLLMLKNGDVDIAD
FT                   IPVSYKSQVENVPGITIFTGAATNVVEFIQFNFNISKIPEGDTIWPDFFTDVNVRKAFA
FT                   YAFPYEEFIEKAYQGLAIRARACVPPGWPGYVEAYNYEYDPEKAAEYFKKAWGGRVWEE
FT                   GFVITAFYNAGNEQRRIALELLAESLQKINPKFKLRVQALDWPVYLEKMENFELPLFAI
FT                   GDWINYLDPHIAVEQQLASYSLFQSLGGGYSNPKVDELIKQAALETDPQKREELYKQIQ
FT                   LIALREDVPQIYTVYPTVFVVMRDWIQGYFYNPFYGGIWYYALTKG"
FT   CDS_pept        223391..224818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0306.1"
FT                   /old_locus_tag="APE0306"
FT                   /product="putative carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0306.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79261"
FT                   /db_xref="GOA:Q9YFD5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFD5"
FT                   /protein_id="BAA79261.2"
FT                   /translation="MGDSLLCSVDVGTSGIRLSLYGEDLGLVARYTEELTLYYSGNRVE
FT                   QDALILAANVRDMLGKAARSGCNVVGLSIYRGSVVAWRNGKPLSDVITWMDSRGLEEYS
FT                   KLPLGARLVSKSPVLGKALKPGSPALVMRRLWLNHPGARIWSIDGFLSDMLTGEFTSDP
FT                   GQAALTGLVSPYSLKPLSLVIRLLGLRGLELPRLRLHNEPLTRVGGVLVGPMVADQQAA
FT                   SIGLGCLRPGCVKATLGTGLFLDAPVEGKPPLFTGDLIPVVNLALPGRVYYGLEGFAAG
FT                   VGMVFDAFARVLGGFSVLEEKALEPADPAPVVPVLAGLRTPYRPLLRGAVLGVSPGFTA
FT                   ASLAKGLIIGTLLTVLSIYRELARRMGGFGELRIGGGLSRLGLLASSIASAVGVKVYRS
FT                   VDYNDSARGAALVAGYASDLISREELLNPPVSLVEVEPLEELSLSGVDAWLGLVDALAS
FT                   EDFSRRLEEIRRSSFRR"
FT   CDS_pept        224734..226164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eapA"
FT                   /locus_tag="APE_0308.1"
FT                   /old_locus_tag="APE0308"
FT                   /product="alkyldihydroxyacetonephosphate synthase"
FT                   /EC_number="2.5.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0308.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79263"
FT                   /db_xref="GOA:Q9YFD3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFD3"
FT                   /protein_id="BAA79263.2"
FT                   /translation="MARLGGCPGLGRLLEKVRGDPEVELSEVGPPEFDVPQFSRWPLPL
FT                   DMWPLWPLLVEKGFRPRAYVAKPRSRGAVERIVEAAAEAGACLVPRGGGSNVVGASPPL
FT                   GCCLILDLRMLDKILWFSGEDLVVHVEAGAVVSKVEEWLNRRGYTLGYHPQSQSLATVG
FT                   GSIAMLGSGALAPGLGNIEDMVLWLETVIPGLGTVTLGSRNSPRGWEGPGVKHLFIGSE
FT                   GSLGVVVSAGLRVRPLPEFTGALAYRLPGFREGLEAARRLTLWRGARLLRLLDPSEASM
FT                   LYGVDGAVLMVEVEAPDRGLLEAMEGYVEKVASASGGSRVEGVYEKWARARYMYDEHVR
FT                   QLWSAGLWVDTIDTAAPWSRVEDLNRRLLEDLAGIPGVVAVMSHAGHFYSGGASLYHTV
FT                   VMERRLDTYWRVWSRVAEAVRQLGASITHQHGWGLLRKPYLGFLGGNYRVFCRVKNTLD
FT                   PGNVLNPNGISSRCSRVG"
FT   CDS_pept        226157..227260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0309.1"
FT                   /old_locus_tag="APE0309"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0309.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79264"
FT                   /db_xref="GOA:Q9YFD2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFD2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79264.2"
FT                   /translation="MDRFDTVVVGAGVVGLFTAIQLAWRGYSVAVVEELDRVMGGVSSR
FT                   SANVIHVLQTPFSSLKSRLCVEGNRLHFVLSRELGYSIVEAPLILAYSEEYKAPLAATV
FT                   SRLLPRLVPKPSADDAGPEIRFEHLRGPRLRDLEPGLSDRVKGGVVVYGYGVVDYRSLA
FT                   SSLERRVKRLGELFLSSPLRRVEERGGYILLHAGEATLAAKAVVNAAGLMSHVVARLFA
FT                   DKVPSQTPLKGVMSIHRGPRLRSIVAPLELRRGETKGGGAIPQSDGSLLLGPNNAGPTK
FT                   LGDESYTKEDLDGLRSRFQPLLAEPVGEPYRVVVGLRPVAPGRDFKVARGKGSVVHMVG
FT                   IESPGLTAAPSLAAVAASMIDSILRSK"
FT   CDS_pept        227383..228213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcl"
FT                   /locus_tag="APE_0311"
FT                   /old_locus_tag="APE0311"
FT                   /product="malyl-CoA lyase"
FT                   /EC_number="4.1.3.24"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79266"
FT                   /db_xref="GOA:Q9YFD0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFD0"
FT                   /protein_id="BAA79266.1"
FT                   /translation="MWRSMLYVPGVDERKIRKSTRVEADAVILDLEDSVPQGRKDEARS
FT                   IVERLLRELEWSGDVCVRVNTPASRDGIRDLDAVSRWDRVSCLLVPKAEARLDTVYKAT
FT                   GRSVVAIVETARGLLRVEEVASSEGLVALNWGPADLAASLGASVEPLDSGVYTPILRLL
FT                   IASAARSYGLEPVDKVYFRVRELEGLRRECLEAKAIGFSGKTVIHPSHVPIVNEAFTPS
FT                   REEVERARRVVEAYEEAVRKGLGAVAVEDELVDAVHYRLALNLLRRASRYVPRR"
FT   CDS_pept        228321..228815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0313.1"
FT                   /old_locus_tag="APE0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0313.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79268"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFC8"
FT                   /protein_id="BAA79268.2"
FT                   /translation="MEIVLRPIGFVSHGLPDSTVRENIGGVEGFIEVLPEYAPGLDGLA
FT                   GFSHIIVIAYLHKSKGRALRVRPRGLLRLGFRLEDLPEVGVFATDSPSRPNPLALTIAR
FT                   LLDIEGRRLRVSGLDLYDGTPVLDIKPYTPSRRVEDLSLPSWYKELLEEASRRDPRVRE
FT                   V"
FT   CDS_pept        228879..229709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0314.1"
FT                   /old_locus_tag="APE0314"
FT                   /product="D-aminopeptidase DppA"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0314.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79269"
FT                   /db_xref="GOA:Q9YFC7"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="InterPro:IPR036177"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFC7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79269.2"
FT                   /translation="MGARFFVSVDAEGMPYSPSRVMMMPRDPLYGELRRIMTRVTNIVV
FT                   EEVFASGAEGVVVADSHGSMVNLDPFEIDDRVELVRGFPRPLAMVYGARGCAAALFIGY
FT                   HGSPQSGGVLGHTYAGRIVQRVRVHGSEAATEYLLNTYALGEMGVPVVLVAGDSVLEDE
FT                   VRRHTPWAVFVPLKKPASSLADVTPPWQRVEKSLRSAVREAVAARSLERAEPLKPAEPW
FT                   IEVELKRPWHADVAELFPCVERLDGVTVRLSCSSFVDNYKLLEGIVIASYSLER"
FT   CDS_pept        complement(229719..230375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0316.1"
FT                   /old_locus_tag="APE0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0316.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79271"
FT                   /db_xref="GOA:Q9YFC5"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFC5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79271.2"
FT                   /translation="MGDVTARSYREVVSAVEEKVASLRGGRLFIFLGGDHSITYATLRA
FT                   LRSFYRGRLGLVYLDAHPDLYDEYEGDRYSHACTLRRIVEEGFVDPRDVILAGVRAATP
FT                   SQLDFAEKAGITVLGVEEAEDLAAYLKEGMPYYISYDLDVLDPAYAPGVGNPEPGGLST
FT                   REMVRIIKSLPEDVLAFDVVEASPPHDPSGLTLFTAAKIIRETLARARPPGWGEV"
FT   CDS_pept        complement(230611..232005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0317.1"
FT                   /old_locus_tag="APE0317"
FT                   /product="phospho-sugar mutase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0317.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79272"
FT                   /db_xref="GOA:Q9YFC4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFC4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79272.2"
FT                   /translation="MSRRRLFGTDGVRGVIGSELTPEFVLRLARAIGAYFGRGSRILVG
FT                   RDTRSGGELFEGLVAAGLAFEGVEVHLAGTLPTPALQLYVRDHGYDAGVMVTASHNPPE
FT                   YNGIKVVGGDGVEVPRDVEEGIEALFWEGKFSTVEWRSVAGQPKRVHDAVDYYVNRVVE
FT                   NVSAFTQRGGGERVVVDCGGGATSFTTVEILKRLGARPIPLSCKPDPLFSSRDPEPTPD
FT                   TLGPAASLVRSSGAVFGVGHDADGDRAIVIDDRGRVVWGDRSGALLAGFVAEVGLAKGP
FT                   LKVYTGVSSSIVVEDYLRPRGIEVVWTPVGAPIIARAILTQGGIAAFEENGGYMHPPHQ
FT                   YVRDGGMKAALLLAMLRATGESLSSLLDRLPSYHPIKTKIPASREEALCAVEAVKQEFQ
FT                   GERMVTIDGVKVIGEGYWVLVRPSGTEPVVRIMLEARSEEEARALFERVLRAVKEKCGI
FT                   PSGGRT"
FT   CDS_pept        complement(232223..232765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0319"
FT                   /old_locus_tag="APE0319"
FT                   /product="protease I"
FT                   /EC_number="3.2.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0319"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79274"
FT                   /db_xref="GOA:Q9YFC2"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFC2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79274.1"
FT                   /translation="MPRALIISADGFEDVELLYPYYRLVEAGFETLVAAPSRGEIKGKM
FT                   GYKVEAKLSFEEVKPEEFDVLVIPGGRAPERVRLHEAALNIVRHFFEKNKPVATICHGP
FT                   QVLISAGVVKGRRLTSYWGVKDDVIAAGGNWVDEPVVVDGNLVSSRYPPDIPYWMREFM
FT                   RLLEARGLLAPTPVPKA"
FT   CDS_pept        complement(232913..233245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0320.1"
FT                   /old_locus_tag="APE0320"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0320.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79275"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFC1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79275.2"
FT                   /translation="MSSLANFVRVAIDQDTCISCGACIEVCPYDALEFDENMKARLIWE
FT                   KCQDDFSCIESCPVNCIYKVEEAPEELKTEKAGWYRLGRELNEEEKKAFEEWRQKYGVK
FT                   VDPVQA"
FT   CDS_pept        233419..233799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0321.1"
FT                   /old_locus_tag="APE0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0321.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79276"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFC0"
FT                   /protein_id="BAA79276.2"
FT                   /translation="MSGLGEFLEEVVREASRRGFSVEKRSSRGVVLRYEDTPLALEVAT
FT                   AGGSIVIDAVSLGDVEDIFEDYEDSVEELRNKVEELLDEVESLGDLVSGLARKFGFNVE
FT                   ARYRRSLLDFRDALEDYIETMY"
FT   CDS_pept        complement(233796..235661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0322.1"
FT                   /old_locus_tag="APE0322"
FT                   /product="putative DNA repair helicase Rad3"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0322.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79277"
FT                   /db_xref="GOA:Q9YFB9"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFB9"
FT                   /protein_id="BAA79277.2"
FT                   /translation="MSGGSIVFPYGSWRKGQRELAEEVRRSVSEGELLLASAPTGFGKT
FT                   AAVIYGLLSAGAERVLYLVRTVNEIDPVVRELKRFGARFTFLFSARRMCPLMTAEGSLP
FT                   SVEDFWGNCRIARAKGVCSYYEELSRLDEAEVAQYVRSRPVISAYRLAWDIAKFKGACP
FT                   FFALKGLVEDSQFIVATYPYLFKEDIFRSFLEPYDYGDFVAVVDEAHSLLNIHSLHEYR
FT                   VSQRDLDLALKEVREYASSARDFIAWLESVLKKASRLKVSRITLLDKQPFLEGLDDLSV
FT                   VEDVVETIRARKAEEALSLSGPSGIGRVKTMASRIYSWLSVLVRDDSYLFAEKDEGGVL
FT                   WLIATPLDPSRVVKEPLEKVKAAVLLSGTMPSTKLYMEVLGVSRSFKFVDVNLMYGARG
FT                   FGRFFTIVAADVTTAYRSRGDSMYRLIASRIAMADRLLPGLKLAVYPSYEVMYRVVERL
FT                   PADVETIVETRGISLDEVEAKILARDPGEKIIINAVAGGKLVEGVEFVDYEGRNLLSTV
FT                   IVVGVPFPQPDDYTRKHLEVMASRIGVSNARKLVYLVNPMIKVRQALGRGIRGPEDRAL
FT                   YILMDYRYLRRDLKEVLGMPYHRVVKGAEDFEEAVKAARSRVFGG"
FT   CDS_pept        235836..236171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0325"
FT                   /old_locus_tag="APE0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79280"
FT                   /db_xref="GOA:Q9YFB6"
FT                   /db_xref="InterPro:IPR040493"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFB6"
FT                   /protein_id="BAA79280.1"
FT                   /translation="MLLAVVVGAILHLILLFILPVIGNILAGAVAGVIAGGLSRGAIAG
FT                   LASGAIASLAASALFFLGALALSWIPPLAFIAGLAGVLVMIVLLILLGLTGLIGGLIGG
FT                   ALREALD"
FT   tRNA            complement(join(236316..236346,236383..236428))
FT                   /locus_tag="APE_tRNA05"
FT                   /old_locus_tag="APEtRNA05"
FT                   /product="tRNA-Lys"
FT                   /anticodon="(pos:236392..236394,aa:Lys,seq:ctt)"
FT                   /note="codon recognized: AAG"
FT   CDS_pept        complement(236514..237863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0326.1"
FT                   /old_locus_tag="APE0326"
FT                   /product="TATA box-binding protein-interacting protein
FT                   TIP49"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0326.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79281"
FT                   /db_xref="GOA:Q9YFB5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041048"
FT                   /db_xref="InterPro:IPR042487"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFB5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79281.2"
FT                   /translation="MSGEIRAEVVRGFGASRHSHITGLGLDADGRARKIGGGLVGQEEA
FT                   REAAGVIVEMVREGRLGGRGILIVGPPGTGKTALAIAIARELGEDTPFVALNAGELFRG
FT                   DSGKLEMLLQAFRKAIGVRVRERREVVEGVVTSISVSKRRTPFSPYPVIAGARITLETK
FT                   DESRTFTVGPEVAEQLVALGVRRGDVIVIDLETGVVRVVGRGKGRGQSFDIDVVREVEL
FT                   PEGPVRKVKEFVRTLTLHDIDASIAAQRVAFTGLLSMFEAERGVTSEDRKKTDELVKKW
FT                   VGEGKAEIVAGVIFIDDAHLLDMESFSFLSKAMESDLAPIIVLATNRGVAKIRGTDIES
FT                   PHGIPRDLLDRLLIITTRPYTRDEIKEIIRIRADEEEVLLSENALERLADIGSEKSLRY
FT                   AIQLLEPAMIVAKRRGSRRVEAEHVEEAERLFADIKRSIQLVEKYRDLMM"
FT   CDS_pept        complement(238201..238698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0329.1"
FT                   /old_locus_tag="APE0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0329.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79284"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFB2"
FT                   /protein_id="BAA79284.2"
FT                   /translation="MSSERQLMRREEVIEWIKTRIRDLEEEISYYKTILAIVEKGSTAS
FT                   SLPGEKMEEVKVGRRRVARLYKGETHVRVVLEWPMALPEEIEAYLRSVEEELRSVQART
FT                   GDIAGEDLATLDIRKLPDGTVEEIVFKGLYTTVEHLKAKSALKYAAESMYQINRAMERE
FT                   EV"
FT   CDS_pept        complement(238786..239790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0330.1"
FT                   /old_locus_tag="APE0330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0330.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79285"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFB1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79285.2"
FT                   /translation="MPSGEKPFSVVNVWIPIQSLGSVNVTVFKKDAGEVDLVDAGMYSA
FT                   RSVHDLLAKIKSRIRGKIRDVDKIVITHFHVDHMSGAAILREVFEPTVFIGIGELELPL
FT                   RSGSPDVFVDNILTLYREHGVPEPVLESIRRSHPVFRTVLAYRAFSSLDLKPIYPGDIL
FT                   RLGEASYRALPAPGHTPGHIVLESLDGTHAIVGDTLLERITPSVILYDEEHDPLGSYLR
FT                   TLEMLAQKKYLVAYPGHGNPIISPAERARELIEHHRRRLSEVLELLKRRGSATAYEVAV
FT                   GMRWRTRYTSWEEYPPVEKFFAIGEALAHLKRLYEEMKVEVIERGGVKRFRIL"
FT   CDS_pept        239967..240503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="APE_0333.1"
FT                   /old_locus_tag="APE0333"
FT                   /product="dUTP diphosphatase"
FT                   /EC_number="3.6.1.23"
FT                   /note="dUTPase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0333.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79288"
FT                   /db_xref="GOA:Q9YFA8"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YFA8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79288.2"
FT                   /translation="MILSDRDIRALLAIGDLVVEPLSGDTVRENGLDLRLGRGFCRFKR
FT                   SDRVLDPRAPGSPGEFYECGEGDEIIVGPGEHMLLHTQEYIRLPGYVAGLVNLRSTWAR
FT                   TGIYIPATVVDAGFEGQLTIEVVGSGFPVKLYPGDRFLHLVLVKLQSPAMNPYRGRYQG
FT                   QRGVRLPKLFAKNTG"
FT   CDS_pept        complement(240475..240819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0334"
FT                   /old_locus_tag="APE0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0334"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79289"
FT                   /db_xref="GOA:Q9YFA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFA7"
FT                   /protein_id="BAA79289.1"
FT                   /translation="MVSRGVLEALVIGAVAFAVLSLLLPPPLSIVLPPLASAIVSLFST
FT                   RLRPLVSACSSLIGYVLVAAASAPLLDAMRLQVGIAGLAGLLPFLYYPLLASTASLAVS
FT                   EVSRYFSRRA"
FT   CDS_pept        complement(240826..243381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0336.1"
FT                   /old_locus_tag="APE0336"
FT                   /product="penicillin acylase II precursor"
FT                   /EC_number="3.5.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0336.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79291"
FT                   /db_xref="GOA:Q9YFA5"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFA5"
FT                   /protein_id="BAA79291.2"
FT                   /translation="MTQWARSGATVVSALLTIILLSVPLVNPLAASLLDPKNGIIGGLG
FT                   LDPPSGELSLPEDIPGEAKVYFDDEGVPYIHASSDEAAFYAAGWVHASLRLFQMDVFRR
FT                   VGLGELSGLVGEAGLEADRRAAILGLRSVVDAEWRHIQNNPEFGEIVRIVEAYTAGVNG
FT                   YISYALKTGRLPVEYRVLGVKPSPWLPQDTLAMAKVLALMLSYSEDDLILDRLVRKWGP
FT                   EVIADFDIVGRSLNMPHASCDMAVDWGDVTGLEGPYNPLLSVEERREPLHESEPLDLGY
FT                   NPDPEIIAAVVDRVLYMLSWNAASNNWVVSGSLTVSGNPLLANDPHLSLTAPGIWLPIV
FT                   ISSPSYSLAGVTIPGVPLVVIGRNSHVAWGFTNVGSDFTDFYRYQWVDENRYFYKGRIF
FT                   GVEKSSIEAYVWDPLARSYRVQEISVARTIHGPVIEWQGEKFAVSYTSARPTFEMIFLW
FT                   LLNKASSVRDALSAQRYFYGPPQNMVVADSAGNIAYSPVGAYPERATLPTIETGYGPIV
FT                   NTGFLPFDGSAGEGEWRGFKPYSSLPVLFNPPQGFVATANSKPFEDGCWDGLGWDYADR
FT                   FRTERIYTLLQERSAEEPLDAGDMRDIQLDVEDLGLKTLVSLMVRVASGDGGHVLERYM
FT                   DMLAEWAENPQMNVDDYKPTLALLASWYFARDFWESLYGSEEHWRFIKLEYAEKALKAY
FT                   LRGEDWVFNYFPEGTLEGMVNRSVERAVKTSETFFASPNPEAWVYGEMHYYNPEHLLSE
FT                   ALGFGECPAPGGPFTVNVAPPSSVSETRGAPVEAGPSVRLIADLSTTMLYMSLPGGSSG
FT                   VPLSSFYDNLYWGYCRGEYHILTVGGEPPGGAKIVFRGG"
FT   CDS_pept        complement(243483..244481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0337.1"
FT                   /old_locus_tag="APE0337"
FT                   /product="dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0337.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79292"
FT                   /db_xref="GOA:Q9YFA4"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFA4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79292.2"
FT                   /translation="MATPPVVDLHEDISFYYASMGAGQPLGGYAEDLEGRQADLPKYSR
FT                   ANVRIVFAAVFPESNVYQGGEGYPTPSSSRLLLLDQVKTYYALSSIHGVEIIESWRSAQ
FT                   EVLEAPRWRLGLLLHLEGADALADILDLELLHRLGFRSLGLTWNHDNRWAASCKTRRDY
FT                   GLTQSGEDLVKKAAELGVIIDLAHASDKTVADAASASPKPVIVSHANFRWKVDSPRNVG
FT                   EEAVEAVVSKGGVIGYSLISTLITRGRHPTLHDVASQMAEFVEVYGHRHLAIGTDYHGL
FT                   LDIRPPTGLESIDRLPRLLEALADAGLSDRQIEAIAYGNIARVIREVLPES"
FT   CDS_pept        244578..245948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0338.1"
FT                   /old_locus_tag="APE0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0338.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79293"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFA3"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79293.2"
FT                   /translation="MPPLPRELESFILEKMSRYRMPSLTLSAFKGGDVFQASYGYSSIE
FT                   KGSPASVDTAYGIGSITKSFTALAVLALEEEGKLSLDDPVGNHLGIDLEVEGQPITLEH
FT                   LLTHTSGVPATAYAEALLRGFLGVGGYWKPYSRPWDAVLYLKRAIDKGWAVSKPGRRFF
FT                   YLNEGYVALGIVVERSSGYSYEEYIRRLVFEKLGMTSSGFIGERLEHAATPYKPGDRLE
FT                   PVPLPAGITADGGIMSTARDMLRYVESLARGEFRGYAERMEKPRVRVPWQALGGEAYGY
FT                   GLIIYPDFMGGRLASHGGSLLAYTAWMGYSTRLDSGVVLLSNTTGYPLAAMGMAVLSVL
FT                   SGGSHLDPKPVRALEIVERLEGYYEGFDSSIAFNIRRVGTGLLVEPVGGVGSPMALSPR
FT                   EIPGPGELEAGEGSVVFVSPYMGGVLEVEFNWSGERVEALLERYRLVKRGPARMPGV"
FT   CDS_pept        complement(245945..247036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0339.1"
FT                   /old_locus_tag="APE0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0339.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79294"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFA2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79294.2"
FT                   /translation="MVNMRRSLAERFKEAPGSAEAERYRRRHTVDIARRIGYIRPENVE
FT                   LERGSTRRVVSFFNSTLRLAREGLEVYGRVVVGYYKYVSLVASLRIGLEDISSGRCSRC
FT                   EEKHTARPEVLPGDWIDFWGAEDPRYTSVNSHDVLTYTGRTLAYYSSSVGQTFPVVAVR
FT                   RAPNGEWVKEAYITLEPDEAPLATSIKNAFILSHRGILLAFYRVHDVSGRFHLLAGISD
FT                   GLPEGPISPLAPKSVWRIMDPAPFEEKIGWATPVNGYKGGSLLVLLHGVDTEQQVYRVL
FT                   AAELDLEGRELVLKAVTPEYIMEPSTLEERFGDRPYTIFPCGAWLVDGEIIVSYGAADT
FT                   ATGLASIPLDVLEERLDKGRTGY"
FT   CDS_pept        complement(247047..249266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0340.1"
FT                   /old_locus_tag="APE0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0340.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79295"
FT                   /db_xref="InterPro:IPR028212"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YFA1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79295.2"
FT                   /translation="MSTAWWNRGLLRVIQFNIEDPYGFYADAISAEDLVSLAKKARANT
FT                   LVVFARDAWGRVFYRGSRLYPRHRRARLDVAELVKAAKREGLRVVIMTDHTANRYIYRR
FT                   HPGWAQRTRSGEVIVLEHYPVKEKVRDPQWPQICINSPAMESYFIPEAEEALKATDADG
FT                   VLLDSFRYLPDPQRACYCRYCRLRFRLERGLDLPSVDDMEDEAFREAWEWRYHVIVDSI
FT                   RRLRDTVKGTKEDAMFFYNSHPVGWAGRGTIVAERARDYLDAVFAEASETDVLTVMMLP
FT                   MVTKLSQAAVGEGKPVLVSRNLFYNLRTVQSATPLAVKQGIRSIVASGGHPMATIFSSQ
FT                   YFEDSRAIDALAEVYEELERVEDKIVGSEPIRYMGILYSSETHEKVYWNAPHYYTSEIE
FT                   GMAMIAFHRHLPYEFLSMKDIHKAGRYKVLVAAETDVLSDEEEAALEDYVERGGFLVVT
FT                   HSLGRMYPDFTYRHSLAMEETLKVRYEGVFYFGYVFVDLEEAYSEYWDGLPKAVVLGDF
FT                   STTFTRERTEPRLGELVRARPVEGARVLAWGRLGRSAYGYEYTLGRSTPAPDSKLNMAA
FT                   ITLGGRGSGKTLYYSVRLGAHYSRLGHPDYAELLLRPLKKEAPPPDAWSDAPDTVQTEF
FT                   FRKGDTVGAHLVNLTFNERILSTITGPSKQSLPAYHPSYNVHPPRVLVPVGPFKVRLPR
FT                   PDGERLNVYDALTGKSLDYVVDGDGVLVNIRALGEYMILIAEPRS"
FT   CDS_pept        complement(249451..250500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0342.1"
FT                   /old_locus_tag="APE0342"
FT                   /product="acyl coenzyme A thioester hydrolase"
FT                   /EC_number="3.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0342.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79297"
FT                   /db_xref="GOA:Q9YF99"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF99"
FT                   /protein_id="BAA79297.2"
FT                   /translation="MGDNCSRIFNVSDTVVNTLHIVMQSHANPLGILHGGNMIRWLVDA
FT                   GTLAASKVVVGYPLLAGIDFIYLGKPVGVGETIAVFAWSPYAGRSSVEVGLAAYSLGRP
FT                   GGQGLERVSAAHMTFVNVKPHEGVLRPHPHGSCIEAVDREEERLLEASMKMREARVERL
FT                   RGRELLRQTVYSLRESGTEPFEVESYRIVNPIDSVAYDVMHAGAMLYIVDELGAVAALR
FT                   SSAGIVVTGFVGPADFVAPMRVGEVLRMWARTSYVGRSSVEVLIRSASGFMGGGEARLT
FT                   SEAYLTYISLDSSGRPLEINAPRGWEPEEQALRRAEWRRRLIRSIDSGETALEPPRRFL
FT                   EMLMRGRVG"
FT   CDS_pept        complement(250616..251092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl15p"
FT                   /locus_tag="APE_0343"
FT                   /old_locus_tag="APE0343"
FT                   /product="50S ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0343"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79298"
FT                   /db_xref="GOA:Q9YF98"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR027386"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF98"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79298.1"
FT                   /translation="MVVRRRKKSRKLRGRTRTMSWGRIGQHRKSGSKGGYGAAGLGKHE
FT                   WTWTIKYAPTWYGKKGFNPPRIRAGLEVTTINVGQLDEIAALLEAQGKAEKEDGKIVVN
FT                   LEKLGIHKLLGEGRVARPLKVITPLASELAIKKIEEAGGEVIVTRATREEAEES"
FT   CDS_pept        complement(251106..251585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl30p"
FT                   /locus_tag="APE_0345.1"
FT                   /old_locus_tag="APE0345"
FT                   /product="50S ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0345.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79300"
FT                   /db_xref="GOA:Q9YF96"
FT                   /db_xref="InterPro:IPR005997"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR023106"
FT                   /db_xref="InterPro:IPR035808"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="InterPro:IPR039699"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF96"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79300.2"
FT                   /translation="MPLYAVIRIRGTVDVPPDIDKTLYLLRLRRRYTASIYHDSLPGLR
FT                   DMLRTVEAWTTYGEIEERVLEELLRKRGRIVGDKPLTDKWVEENLGLSGLGELAEKLVS
FT                   GELHYHRLEEKGVKPFFRLHPPRGGFKKSIKRMFRDGGELGYRGSAINELILKML"
FT   CDS_pept        complement(251631..252287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps5p"
FT                   /locus_tag="APE_0346"
FT                   /old_locus_tag="APE0346"
FT                   /product="30S ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0346"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79301"
FT                   /db_xref="GOA:Q9YF95"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF95"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79301.1"
FT                   /translation="MSQREAGQVDLEAWQPRTRVGRLVKEGKIKSIDEIFRRNLPILET
FT                   EIVDYLLPGLDHEVIDVSIVQKMTDAGRITRFRAVVVVGNKDGYVGLGKGKARQFRFAI
FT                   EKAIRNAKLNIIPVRRGCGSWECTCGEAHSVPFTVRGKSGSVEVILKPAPKGTGLVAGD
FT                   VAKVVLRLAGISDVWTFTKGETRTSYNFARATYLALRNTYRFVTPADWAEARLRL"
FT   CDS_pept        complement(252316..252960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl18p"
FT                   /locus_tag="APE_0347"
FT                   /old_locus_tag="APE0347"
FT                   /product="50S ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0347"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79302"
FT                   /db_xref="GOA:Q9YF94"
FT                   /db_xref="InterPro:IPR005485"
FT                   /db_xref="InterPro:IPR025607"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF94"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79302.1"
FT                   /translation="MGRGPRYRVPLRRRREGKTNYYRRFRLVKSGKPRMAVRISNEYLW
FT                   VQFLEARIEGDRVIAAAHSRELIKKFGWKGDGNNTCAAYLTGYLAGLRALEKGVREAVL
FT                   DVGLHKPVKGSRVFAALKGALDAGVEIPHSEEILPGDERVRCEHIAQWAEALKEENAEL
FT                   YQRQFSRYLDRGLNPEELPGHVEEVKKAIEEAYKHVAEETAAEGEEVEVKA"
FT   CDS_pept        complement(252981..253448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl19e"
FT                   /locus_tag="APE_0348"
FT                   /old_locus_tag="APE0348"
FT                   /product="50S ribosomal protein L19e"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0348"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79303"
FT                   /db_xref="GOA:Q9YF93"
FT                   /db_xref="InterPro:IPR000196"
FT                   /db_xref="InterPro:IPR015972"
FT                   /db_xref="InterPro:IPR023638"
FT                   /db_xref="InterPro:IPR033936"
FT                   /db_xref="InterPro:IPR035970"
FT                   /db_xref="InterPro:IPR039547"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF93"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79303.1"
FT                   /translation="MDYRFQRRLAAEILGVGESRIWISPDPELREEIEGAVTKADVRAL
FT                   IKRGVIKVLPEKGNAGHASKVRHLQRRKGRRRGMGRRKGVATARLDPKERWMHRIRKIR
FT                   RYLRYLRDKQVIDRKTYRRLYMLAKGGTFRDLASLKRYMADRGLVPEEKIR"
FT   CDS_pept        complement(253469..253906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl32e"
FT                   /locus_tag="APE_0349"
FT                   /old_locus_tag="APE0349"
FT                   /product="50S ribosomal protein L32e"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0349"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79304"
FT                   /db_xref="GOA:Q9YF92"
FT                   /db_xref="InterPro:IPR001515"
FT                   /db_xref="InterPro:IPR018263"
FT                   /db_xref="InterPro:IPR023654"
FT                   /db_xref="InterPro:IPR036351"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF92"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79304.1"
FT                   /translation="MAGGEPQSLEEAFAARRNVLAARRARERLRRLIASKSRHRFLRYL
FT                   SWRFWKFERRDYWRKPKGNDNKMRLQLKGYPPIVKVGYRTPKAIRGMHPSGLEPVIVSS
FT                   AKDLERLSPERHIVYIASGVGLRKKQEIRRAALERGFRVAN"
FT   CDS_pept        complement(253906..254454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl6p"
FT                   /locus_tag="APE_0350"
FT                   /old_locus_tag="APE0350"
FT                   /product="50S ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0350"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79305"
FT                   /db_xref="GOA:Q9YF91"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002359"
FT                   /db_xref="InterPro:IPR019907"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF91"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79305.1"
FT                   /translation="MAKDVHVVERVEVPEGVTVSIDGMRVKVSGPKGEVERDFSHARGV
FT                   LIRLEDNSVVVESFFAKARQRALVGAIAGHIRNMIKGVQGGFRYKLKIMYSHFPINVKV
FT                   EGDKFIISNFLGEKGLRIARIMPGVKVQVKGSDVIVEGIDVEKVAQTAANIELATKVKD
FT                   KDRRKFMDGIYIYEREVIA"
FT   CDS_pept        complement(254575..254976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps8p"
FT                   /locus_tag="APE_0352.1"
FT                   /old_locus_tag="APE0352"
FT                   /product="30S ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0352.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79307"
FT                   /db_xref="GOA:Q9YF89"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF89"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79307.2"
FT                   /translation="MVMLDTLANAMAAIKNAEMRGKGEAIIMPSSKLIANVLRILEKEG
FT                   YIGGFEYIDDGRWGKFRVKLLGRINDIGVVKPRTPVSYRELAKMPEHLRKYLASRDVGL
FT                   LILSTPQGVMTHREALKRKIGGIVIAYVY"
FT   CDS_pept        complement(254993..255157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps14p"
FT                   /locus_tag="APE_0352a"
FT                   /product="30S ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0352a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34724"
FT                   /db_xref="GOA:P58731"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023676"
FT                   /db_xref="InterPro:IPR039744"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58731"
FT                   /protein_id="BAF34724.1"
FT                   /translation="MAKIRPPKPKRMGRGAQRCQRCGTRDAVIQKYGLYLCRQCFREIA
FT                   PTLGFRKNR"
FT   CDS_pept        complement(255178..255756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl5p"
FT                   /locus_tag="APE_0354.1"
FT                   /old_locus_tag="APE0354"
FT                   /product="50S ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0354.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79309"
FT                   /db_xref="GOA:Q9YF87"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR022804"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF87"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79309.2"
FT                   /translation="MSAKAQSLPIPPERVSEILDEWKRSPMRRPRIVKVTVNISIGQSG
FT                   ERLQRAAEVLEELTGQKPVFRKAKRTIRAFGVRKGENIAVMVTLRGEKALNFLKRALDA
FT                   VGHRIKTSSIDEHGNVSFGIEEHILIPGVKYDPRVGILGMDVAITIQRPGHRIVERRRQ
FT                   RRGHIPRRHRVTREETMVLLNQLFGVTFV"
FT   CDS_pept        complement(255753..256514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps4e"
FT                   /locus_tag="APE_0356.1"
FT                   /old_locus_tag="APE0356"
FT                   /product="30S ribosomal protein S4e"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0356.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79311"
FT                   /db_xref="GOA:Q9YF85"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR038237"
FT                   /db_xref="InterPro:IPR041982"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF85"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79311.2"
FT                   /translation="MARMGGQRRLKALAAPRFWPILRKEYKWAVKPRPGPHPAEKSLPL
FT                   LLIVRNVLGYAQTAREARKLISEGHFRVDGVVRKDYKFPVGFMDVIEVVDTGEKFRMLP
FT                   YPVKFFKLHPIPEEEGDLKPVRIENKTTVKGGHVQLNLHDGRNILVRVKDPRNPVEDVY
FT                   RTMDTLLITVPGQEIKGHIKFGEGAIAIIVGGRNVGRVGVVKSVQKGWGRKRTLVTLED
FT                   ASGNLFQTSLDYVFVIGLDRPVISLPEGAWK"
FT   CDS_pept        complement(256558..256956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl24p"
FT                   /locus_tag="APE_0358"
FT                   /old_locus_tag="APE0358"
FT                   /product="50S ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0358"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79313"
FT                   /db_xref="GOA:Q9YF83"
FT                   /db_xref="InterPro:IPR005756"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF83"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79313.1"
FT                   /translation="MPVLTRSRQPRKQRRALYRAPLHARQKLVSATLSPELREKYGVRS
FT                   LPVRKGDKVRVMRGDFKGHEGKVVKVDLRRLRIYIDGVTVTKADGTPVFRPIHPSNVMI
FT                   VELDLSDEYRKKMIERRAAGRRGGGNSE"
FT   CDS_pept        complement(256976..257398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl14p"
FT                   /locus_tag="APE_0359"
FT                   /old_locus_tag="APE0359"
FT                   /product="50S ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0359"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79314"
FT                   /db_xref="GOA:Q9YF82"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR019971"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF82"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79314.1"
FT                   /translation="MAKKKKYGVVVSRYGVNTGLQVGSYVPVADNSGAKEVMIISVPQV
FT                   KTRLRRLPSAGVGDLVVVSVKKGTPQMRRQVVYAVVVRQRRPFRRPDGTWVSFEDNAVV
FT                   IVNPDGTPRGSEVRGPIAREAAERWPRVAKIATMIV"
FT   CDS_pept        complement(257411..257755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps17p"
FT                   /locus_tag="APE_0360.1"
FT                   /old_locus_tag="APE0360"
FT                   /product="30S ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0360.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79315"
FT                   /db_xref="GOA:Q9YF81"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019978"
FT                   /db_xref="InterPro:IPR028333"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF81"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79315.2"
FT                   /translation="MPKFKQVKNLKIPGVEPPEKVCSDPNCPWHGTLRVRGVLLEGVVA
FT                   KARARRMVVVQHVYLYYDKKYNRYERRSKKIHAHLPDCISVKEGDVVVIGETMPISKTV
FT                   KFTVLGVKRR"
FT   CDS_pept        complement(257725..258057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnp1"
FT                   /locus_tag="APE_0362"
FT                   /old_locus_tag="APE0362"
FT                   /product="ribonuclease P protein component 1"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0362"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79317"
FT                   /db_xref="GOA:Q9YF79"
FT                   /db_xref="InterPro:IPR002730"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR023538"
FT                   /db_xref="InterPro:IPR036980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF79"
FT                   /protein_id="BAA79317.1"
FT                   /translation="MKGRRPSHRRQLIPPLLTGLRVKVLAHSDPSLEGLEGWVVVEEAR
FT                   SLRILTLEGRVSTVLKDLAVIEVEAPGGEYIRISGRVLIGNPLDRVKEYRWRVSRRCRS
FT                   SSRLKT"
FT   CDS_pept        complement(258038..258253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl29p"
FT                   /locus_tag="APE_0362a"
FT                   /product="50S ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0362a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34725"
FT                   /db_xref="GOA:P58085"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58085"
FT                   /protein_id="BAF34725.1"
FT                   /translation="MGKFKMRSKDLRGMSVEELEKTLRELRIKLMGLRYKAKVGLLENP
FT                   GELREARRNVARILTVLREKREGEKA"
FT   CDS_pept        complement(258273..259013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps3p"
FT                   /locus_tag="APE_0363"
FT                   /old_locus_tag="APE0363"
FT                   /product="30S ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0363"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79318"
FT                   /db_xref="GOA:Q9YF78"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR027488"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF78"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79318.1"
FT                   /translation="MPTKVVKHFLNQGLLRTKIDEWLAQNFYEAGYSRVKVVQTSLGTN
FT                   ITIWAERPALIIGRRGATIRRLQEVFQTVFGLPNPRIRVEQPENPMLDARVQAFRIARS
FT                   IERGIHFRRVAFAAINRIMSNGALGVEITISGKLTSERARFEKFKAGKVYKSGHKVDEL
FT                   VDRASAYARLPKGVIGVDVIIVKPGKPGDHVRIKSEEEVKDVVDAIRSEIESLGLQEET
FT                   ASTLREHMEAARPGEEHEEDREES"
FT   CDS_pept        complement(259018..259488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl22p"
FT                   /locus_tag="APE_0365"
FT                   /old_locus_tag="APE0365"
FT                   /product="50S ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0365"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79320"
FT                   /db_xref="GOA:Q9YF76"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF76"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79320.1"
FT                   /translation="MPRWGYSVKLRDESEVAKAVLRNVPVHPKIMAEVARAISGMRVDE
FT                   ARRYLRAVIEKREAVPFRRAHGKQAHRRGLADKWGWPVGRYPVKAARYMLKLLDNVEAN
FT                   AANKNLDVERLKIIHVAAHKGITLKRWMPRAWGRATPRNRVHSHIEIMVREV"
FT   CDS_pept        complement(259515..259949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps19p"
FT                   /locus_tag="APE_0367.1"
FT                   /old_locus_tag="APE0367"
FT                   /product="30S ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0367.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79322"
FT                   /db_xref="GOA:Q9YF74"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF74"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79322.2"
FT                   /translation="MAFEMRPEWKKFRYRGRTLEELLKMDIEELARLFPARQRRSLLRG
FT                   LTPAQQKLLLKVRKIRRRLEEGRLKRPPVIRTHVRDMVILPEMVGLTIAVYNGKEFIPV
FT                   KIVPEMIGHYLGEFSPTTRIVQHGEPGLKATRSSLHVASK"
FT   CDS_pept        complement(260050..262029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0370"
FT                   /old_locus_tag="APE0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0370"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79325"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF71"
FT                   /protein_id="BAA79325.1"
FT                   /translation="MSRGLRLEEIASGLPAAAEALRRQGHRLGTSELVDIIRLARSYAD
FT                   LEGRDFLAEDELEMVVDAVVKHRRLSHAIVEELRRASSSSRFRERVERLESEIMAGLQA
FT                   MGAKPGWRVSKKKVSRRGREAIAAYMMLRSVGAIQGRPGRERVADAQSLRSLAYTLARQ
FT                   GVESLREAYLSKPSRGGRERRLMEAESGLAPRLAELDEKGLVELGWASMRKGNARLLKD
FT                   VGVELARRARTGSLSRVRDAYKIMRRAGALDRETLSLMIASDPSLASAPEADANTIARA
FT                   VGIAGHERGGEILAKRLREAGPGEAETLVSKVPPEALWAVKSHSLDGWKGELVDAASKA
FT                   AASLRSALRYMEGGGEGWRELGYSMALEAISRASRIGEAASMGGLSRGAVFGMAETAIA
FT                   ILELESSRPSDPERVYSILSRLSLPAAVKVLRSLYSKASVEEREVLVRSMERLLYKYSV
FT                   RHGLRLLPKTVLSQRRSPRVDVRRSIYQSIRSGRPSIVYRERLRAGRLSLALDVSSSMI
FT                   DYSSWAIAVASLFLSNISRLVIFSHASTILEGPLSRREVARSLLSVEFRGYTDISTALE
FT                   KAAHPGVKKIVAVSDLQQTVDSQPLQLVVRSLHRSGYRIAFITPPSARPEDVEAAREAG
FT                   ARVVTAWTPRQAALGVLRHILRRP"
FT   CDS_pept        complement(262022..262897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0372.1"
FT                   /old_locus_tag="APE0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0372.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79327"
FT                   /db_xref="GOA:Q9YF69"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF69"
FT                   /protein_id="BAA79327.2"
FT                   /translation="MESSVGRVRSPEAAVKLLENRYKLVVDKRVVTLVYAAFLNGRPVL
FT                   FEGPPGTGKTEIGEALLELWAGRKPFILPCSEGYDEYKVIGDFHPQMAMKHGFNEESFV
FT                   PRPLLAALILDTGVLVDEIRRSSEEFQNMLLDIIDKRRIVVPEIRRVFKARGTGFQLIM
FT                   TSNPEDIAQNELSDAFLRRVVRVRFDYPPRHVEERIVRLRTEEKPLLGAEVMEVIMRVV
FT                   SRLRTSNISHKPGTSESVAWARMAQSIAALKGRDRVSLEDLAEAAEAVLVKRVDDEDVV
FT                   REVLGEALNV"
FT   CDS_pept        complement(263050..263760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0373"
FT                   /old_locus_tag="APE0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0373"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79328"
FT                   /db_xref="GOA:Q9YF68"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF68"
FT                   /protein_id="BAA79328.1"
FT                   /translation="MGARRGEGGDSAEAGRRFRIAPSRLRTFVYCPRLYFFETHMPAER
FT                   GLTERVRMILGTVYHAAAALLDRIRGSRAEEPVEASIGGYLIAGRPDSWRMDDGEVLVV
FT                   ERKSGRGPKVGVWLSDLLQAVAYAIALSRRSNARAARVKIVYLRGGSGEYSVGEDLVYT
FT                   AMRAMEDMRLAAEGILPYPHRSPRKCAICPYREECYSLDESLPEEAREALVEPGSWVAG
FT                   LESVYRGRGGGQEF"
FT   CDS_pept        complement(263700..266894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="APE_0374"
FT                   /old_locus_tag="APE0374"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="IleRS"
FT                   /note="isoleucine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0374"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79329"
FT                   /db_xref="GOA:Q9YF67"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF67"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79329.1"
FT                   /translation="MGSVPRVLEGERYDQFALESFVKSYWEENSIYRKVKEKSSRAPRK
FT                   FYFLDGPPYASAKSIHIGTAWNKVVKDVVLRFYRMTGYNVWDKPGYDTHGLPIEVKIEQ
FT                   SLGVRVKREIEEKVGVENFIAACKRFVDENMEAMTRQFKEIGVFMDWENPYVTYRDEYI
FT                   ESGWWLVKKAWEKGLLYKGYRVLHWCPRCETTLADYEVSEYRELEDPSIYVKFPVEGRE
FT                   GEYLLVWTTTPWTLPANAFVMAHPDMEYVKVRVGRDTLILAKARLDHVMREAGVSEYEV
FT                   LEVLKGSQLEGLRYRHPLEDVVDAQRELSKWHKVVMAPEAVTPHEGSGLVHSAPGHGTI
FT                   DYEIAQRIGAPVVSLVDERGFMTEAAGKYSGLYFRGEANKAIVEDLRARGALFHAATIV
FT                   HRYPVCWRCKTPLLLRATTQWFVAVTRLKNQLMREAEKVEWQPGWAKTRFMNMLRELRD
FT                   WVISRQRYWGIPLPVWRCSSCGYEHVVGSVEELESMGGRRPENLHRPWVDRVELKCPRC
FT                   GGSMKRVPDVLDVWFDSGIAFYASLGYPRDRETWERLKPVDFIVEGHDQIRGWFFSLLR
FT                   SGVIGFGETPYRRVLVHGFALDEQGREMHKSLGNYVDFEELIAKVPRDVVRFWVLQNTV
FT                   WEDLRFSWKGLDLMRRDFNVIWNVYAFASIYMGLDRFDPRRTSLSSVEDSLEVEDRWIL
FT                   SRLASLKRRYLTAMEDLRIHDAARALRSFIIEDVSHWYLRIIRRRVWEEVDTPSKRAAY
FT                   ATLYKVLWEWLLMAAPLIPYTAEYLYIKVFREAEERPEESIHMLDMPEPEDHLIDSTLE
FT                   EDMEKARMVLEAILSARNEAGLKLRRPVRRVIIAASNPGVEGSLRRLEGLIRLMANAKE
FT                   IEFAPASALEATRIYRVEPDYGRLGPKYKRDMPKVLRLIEEKGGEIGRVLAEKGVYEGE
FT                   YEGLPVKLTLEDVSLKAEYPEWLKVRDTPLGLVAVDTRLTKEEVLEGLARDIVRRIQAM
FT                   RKEAGYSVEDYVEVWIQGGEDVVEAVNALKEYIKRETRALKLEVGEPPSGVEVLREWEL
FT                   DGEKVVIALKRAAASG"
FT   CDS_pept        complement(266975..267232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0374a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0374a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34726"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E75"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAF34726.1"
FT                   /translation="MTAGIKLYRVYYSTYSDDVHRSIVEELKKKFGAEVRDHGSRVVRE
FT                   FRFVEVLLGEPGREAEIEQVVKSRGDSVFGVKVEWVDTTR"
FT   CDS_pept        267395..267823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0381.1"
FT                   /old_locus_tag="APE0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0381.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79336"
FT                   /db_xref="GOA:Q9YF60"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF60"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79336.2"
FT                   /translation="MKRLSALVKVDSKGRVTIPQSIRSALGIEPGMVVLLIGDVNKREL
FT                   IATPITSRSESIYVIDATLRDRPGALAAVTEVLARHKIDIVASKCASIVRGEEGGCTII
FT                   ADFSRADIDPEDLKRELERLDVVFHVIMRRLEAGLEEI"
FT   CDS_pept        267935..268624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0382"
FT                   /old_locus_tag="APE0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0382"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79337"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF59"
FT                   /protein_id="BAA79337.1"
FT                   /translation="MWIVLWPGLTGLPDSLVLLARVGGCSVLYDTGSGEPGSIVALAAN
FT                   LASAGVKPWSINVAIVSHAHVPSSGGARWLHDNHRVTIAARRPDSRWIEEGDPVKTAAV
FT                   DYGLPTKPVPIGLELEREGRMPGECEGVEVLFTPGHTPGSVSVSLDTGDATVLAVSDAL
FT                   GRLKRDWGSSEREWMESLDKISSRDPDYLCTSVTCMDRRAAKAFLDEIREKGPVWDVEN
FT                   SSGDGPG"
FT   CDS_pept        268733..269209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0383.1"
FT                   /old_locus_tag="APE0383"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0383.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79338"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF58"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79338.2"
FT                   /translation="MGLEEGYDDVLVRDIMSSPPITTLPMTSVKEAAKIMLENRVGSLI
FT                   VVNERNTLLGILTKTDIIREVVAKGLDPESVRVGDIMTRNPYYVYTDDSVERAASLMGE
FT                   HNIGHLPVLDPETEKPVGIVTKTDIVKLAPNYINVIYSLKQEIDRRERLKRIRK"
FT   CDS_pept        269349..270458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0384"
FT                   /old_locus_tag="APE0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0384"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79339"
FT                   /db_xref="GOA:Q9YF57"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF57"
FT                   /protein_id="BAA79339.1"
FT                   /translation="MRLAFGLLMASLTAALAVAESSAVGVLEYLLPVEEHRVIAKAVLS
FT                   AVAMAGSFWGLVVASTRFRSPSGRRLVLAVVGVATPAILLGLEGLLGGGLSSLASVMAV
FT                   SVALGMASFALSSSIYSQVDYVEWRRVLAEYYIVSSVGSSLLIFASLASGQPIIVAGSI
FT                   AVFALLSAQHVLDVPLSFASLKVVDNFSSAVFSALHGRLDRLRVDEVLRLSSAAGVLAA
FT                   LKIPVIQGASYYLGEATPLVYSLGYALGVTLASTSASTLPASTAALASTLLAMYTGGSL
FT                   PWLALFIVGLGYGWAVFTLVMYVLDREPKKVRIATVSVVAWSTAASLAVFAVTSVMGTS
FT                   PYMPALAILVLGLVLSAATRLKNAGVRWE"
FT   CDS_pept        complement(270465..272096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0385.1"
FT                   /old_locus_tag="APE0385"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0385.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79340"
FT                   /db_xref="GOA:Q9YF56"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR034184"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF56"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79340.2"
FT                   /translation="MPLEPAFGEVSMAYGLNHYLVDKPLRDTLRYFTSKEPDLAGLGEY
FT                   VGTELYEVAYRVDRLSWPVHVMWSVRGERSDTVLVDPALRRAVDRLMYEYGVNRHPYVG
FT                   GSWHEHFAGINLVGDPGVGCILTITMQTAYALWKYGGEELKHYYRRLAGLDRPPMIGAT
FT                   WFTEIQGGSDLGANETVARKAGDGVWLLTGYKYFASGAGLADIALVTARPEGAPAGAKG
FT                   LSLFAVPRYRRGGGLNYSVRRLKDKSGTIAVPTGEVELQDSEAYLIGDADKGIYYTLED
FT                   LMISRIANSAGAVGIARKAYLEAYNYAKHRRAFGKRIIEHPLVRRDLLEMEVLIEESLA
FT                   LTHKAVDLFEKSTGDRPPYSMTYHYARLMTHIAKNMTAQAAARVTMLAMELFGGIGFLR
FT                   EYAVERWHREALITPIWEGTSNIQALDMLEAMWKKGAHKPLLEDLRALAGDAYDKGLAS
FT                   KAVEAAEETVRRLASMSPSQAEFNAKYALEDLGHASSTVILENMAAVLGEERYHYVAEI
FT                   VYNSLLQRRPVYNPGEEVLGEIIAVE"
FT   CDS_pept        complement(272277..272759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0389"
FT                   /old_locus_tag="APE0389"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0389"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79344"
FT                   /db_xref="GOA:Q9YF52"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF52"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79344.1"
FT                   /translation="MAVGRDVVLRHAVESDEAEIVDMIVRQKIFNEELNPLFKTVEDIR
FT                   AEAERYFRETLSDDKSFIIVAQHGEGLAGFIRVELVDRRFYKPRIKAVITDIYVKPRYR
FT                   RRAIGQLLTQKAAEEARRRGAGMMSALYPITNYVAKRFYSQLGFREFQIEVYRELH"
FT   CDS_pept        complement(272766..273245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0390"
FT                   /old_locus_tag="APE0390"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0390"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79345"
FT                   /db_xref="GOA:Q9YF51"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF51"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79345.1"
FT                   /translation="MYERGVHVRPPRPGDKEVLAELIYRFYMLNEEFDPLWTLKDDAKE
FT                   AAAAEAEKIVAGGGGEIVLVAQVAEEVVGYIRGYIREMPLLANGRMAVVKEIYVKPQAR
FT                   RLGLGSLLLERFSEEARRLGARAVAGEFPAQNAIAHRFYERLGFRSFMYTMIKEV"
FT   CDS_pept        complement(273269..274609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0392"
FT                   /old_locus_tag="APE0392"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.38"
FT                   /note="malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0392"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79347"
FT                   /db_xref="GOA:Q9YF49"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF49"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79347.1"
FT                   /translation="MAGDSSSDDIGGARIIEIYRRYGGKIEVMPKVPVSGVEDFAIWYT
FT                   PGVAEASIRINKDPDESFELTSRWNMVAIVTDATRVLGLGKLLPEAAYPVMEGKALIFK
FT                   LFGGVDAVPIVHRRREPGAFASLVKDLEPSFGGVNLEDIESPKCFYLLDFLRMELEIPV
FT                   WHDDQQGTAAASLAGLINAFKIVGKNLRESRIVLLGAGAANIALYRFLKAYGVNPRNIV
FT                   VVDSKGVLHPEREDMDRLLFSNRYKYEIALETEGGGLAPGSSLEEALRGADALVAASRP
FT                   GPGVVKKEWIRGMSRDPIVFALANPTPEIWPWEARDAGARVVATGRSDLPNQVNNALVF
FT                   PGVFRGALDVRSRAITDGMAIAAAEEIARYTEEEIGIEEDRILPPITDWQVHYRVAAAV
FT                   AWAASREKVARKPRTYAEELENARAIIETTRRKYGALLSAGLIERLV"
FT   CDS_pept        complement(274664..276331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkK"
FT                   /locus_tag="APE_0396.1"
FT                   /old_locus_tag="APE0396"
FT                   /product="medium-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0396.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79351"
FT                   /db_xref="GOA:Q9YF45"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF45"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79351.2"
FT                   /translation="MALPEKTPWRPGYSLTIHKIYQYALYMWSDLEIVSRTTKGLERYT
FT                   FSDAARRIESLANALRALGVSGLDRVATMDWNTHWHYETYFAAPMMGAVLHPLNVRLAP
FT                   NEIAYIMNHAEDKVLIVHSDFLKLAEAILPHAPSVEHVVIVDAESHPDRIAGRRLHNYE
FT                   DLIKEHGGRFEWPELDENRPAAMGYTSGTTGLPKGVYHSHRMIVVHALSGALALATRGR
FT                   RRVTGDDTLLHIVPMFHVLAWGLPYMATLTGMKQVFPGRLDPKVLLDLIVGEKVTVTAG
FT                   VPTILYMLLSHPESGKYDLSGLLFVNGGQALPKGLADAARKRGIEVIVGYGMTETAPIL
FT                   TLANVPQKYMDRSEELSLTTGWPVPLVELMVADPETLEPVPKDGKTMGEIVVRTPWVTP
FT                   EYYKDPEKTEKAWRGGWFHTGDIAVWTPEGYIQIVDRDKDIIKSGGEWISSLRLESLIS
FT                   QHPGVAQVAVIGARHPKWGERPVAIIVPKPGWQDKLTTEEVREWLAKNFVEKGEIPKWW
FT                   LPDKIVLVDDLPKTSVGKINKRSLREKFANILEQEPQQ"
FT   CDS_pept        complement(276419..276826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0399.1"
FT                   /old_locus_tag="APE0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0399.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79354"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF42"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79354.2"
FT                   /translation="MLHGEPGEEGIPGHAGRGVSGAFQRRLSEMGCQFEAEGDVTRIHV
FT                   AGGLVEVKDEPGVGPIVEASIPLPVDPSTVGESLEGMKALLGLMTMLGRPLSYQLDDSL
FT                   PGFPILRVKAVFETLEDAYSSLTAALERLGC"
FT   CDS_pept        complement(276832..277509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="APE_0401.1"
FT                   /old_locus_tag="APE0401"
FT                   /product="uridylate kinase"
FT                   /note="UMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0401.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79356"
FT                   /db_xref="GOA:Q9YF40"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR011818"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF40"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79356.2"
FT                   /translation="MESVVVKISGSLVHPPRLDYLTRLRDVLWGLVDGGFRVAVVVGGG
FT                   GLARSYIDVLRRAGVSEALLDEMGIESSRLNASLLAKLLYPRSQPYPLASLREVLEVFM
FT                   TGLIPVSGGFQPGQSTNAVAAVIAEALGARTLLNCLKGVEGVYSDEPSTPGARLLRRLT
FT                   YRQLEDILVKVSSQRAGSYTLWDMVALSVARRSGLRIVFFDCSDPANIWGALKGEKGSI
FT                   VEG"
FT   CDS_pept        277739..277987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0401a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0401a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34727"
FT                   /db_xref="GOA:Q05E74"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E74"
FT                   /protein_id="BAF34727.1"
FT                   /translation="MALEDLVAVYSQAKELVWQGGFDVSYYLVVFGIALLSVVGAFTLG
FT                   LVGYRLLNAAVNTDTAGLLKITFILASVLLVVGVLLP"
FT   CDS_pept        complement(278016..278651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="APE_0402.1"
FT                   /old_locus_tag="APE0402"
FT                   /product="V-type ATP synthase subunit D"
FT                   /EC_number="3.6.3.14"
FT                   /note="Sul-ATPase gamma chain"
FT                   /note="alternative gene symbol: atpG"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0402.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79358"
FT                   /db_xref="GOA:Q9YF38"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF38"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79358.2"
FT                   /translation="MAVDPRKVLPTKINLIRLRRELAMLRRIRRVMEEKREVILHYITS
FT                   MAAEYVRYQREVYSELERIYQNYYLGVAAEGIERARAFTAPAEGSLEVDVSTRTLFAVK
FT                   TPVFSLREETVPPLPLPAGSDPKLVQSILDMRSILDKLLKLAEYEETLQRLISELKDTQ
FT                   RLINALDYVILPSYQNAIKFIKLVLEDRMREDFVRLKIIKRKMEAKTQ"
FT   CDS_pept        complement(278711..280102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aptB"
FT                   /locus_tag="APE_0404.1"
FT                   /old_locus_tag="APE0404"
FT                   /product="V-type ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0404.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79360"
FT                   /db_xref="GOA:Q9YF36"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005724"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF36"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79360.2"
FT                   /translation="MALGVREYRNISEIKGPLLVVEGVSRVAYDEIVEVETAAGEKRRG
FT                   RVLEVGMGYAVVQVFEGTTGISPTGTVVRFMGRPLEIPVTEDMLGRIMNGLGEPIDGGP
FT                   KIDADERRDVNGAPLNPAERAYPEDFIQTGVSAIDGMNTLVRGQKLPIFSGAGLPHNRL
FT                   AAQIARQATVRGEEEEFAVVFSAIGIKYDDFLFFKKFFEETGALGRVAMFVNLADEPAM
FT                   IRLITPRAALTLAEYLAYERDMHVLVIITDMTNYAEALREISAAREEVPGRQGYPGYLY
FT                   SDLASIYERAGRVKGKKGSITQMPILTMPNDDITHPIPDLTGYITEGQIVLSRELHNRG
FT                   IYPPINVLMSLSRLMKEGIGPGKTREDHAEVSNQLYASYSRGVELRSLTAVVGEESLSE
FT                   RDRRYLKFADLFEQRFLKQGERENRSIEETLDIAWEILSVLPEEELVNIKEETIKKYHP
FT                   KYRAG"
FT   CDS_pept        complement(280144..281937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="APE_0405.1"
FT                   /old_locus_tag="APE0405"
FT                   /product="V-type ATP synthase subunits A"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0405.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79361"
FT                   /db_xref="GOA:Q9YF35"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005726"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF35"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79361.2"
FT                   /translation="MAVKGSIVRISGPLVVAEGMSGAQMYEMVYVGEDRLIGEITRIRG
FT                   DRAFIQVYESTSGLKPGEPVVGTGAPLSVELGPGLLGTIYDGVQRPLPIIAEKVAEVDP
FT                   RRRMFVERGIQAPPLPRDRKFHFKPEPLKEGDKVEGGDALGRVPETSLIEHVVMVPPGI
FT                   RGRLKWLASEGDYSVEDTIAVVERDGRDVEIRMHQRWPVRIPRPFKEKLEPQLPLITGV
FT                   RIIDTFFPMAKGGTGAVPGGFGTGKTVTLHSLAQWSEARVVIYIGCGERGNEMTEVLER
FT                   FPQYKDPWTGKPLMDRTVLIANTSNMPVAAREASIYVGITIAEYYRDMGYDVLLVADST
FT                   SRWAEALREIAGRLEEMPAEEGYPSYLASRLAEFYERAGRVKALGSPERSGSVTVVGAV
FT                   SPPGGDFSEPVTSHTTRFIRVFWALDTKLAYSRHYPAINWLMSYSAYVDLVTQWWHENV
FT                   DKRWREYRDEAMDILLRESELQEIVRLVGTEGLDEKDKMVLETARLIKDGFLKQNAFDP
FT                   IDAFATPQKQFRLLKMIMDIHRKSLELIEKGVTTQQILQALGRLYIDIVKAKFTIPNDQ
FT                   LEKIDEIRDRALKALDELVSG"
FT   CDS_pept        complement(281976..282578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="APE_0409.1"
FT                   /old_locus_tag="APE0409"
FT                   /product="V-type ATP synthase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0409.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79365"
FT                   /db_xref="GOA:Q9YF31"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF31"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79365.2"
FT                   /translation="MAKVQGDPRRFADTVLEKPFKEALARVEEAREAGLKLVEEAYKSA
FT                   LSAARKRLESRVEEARERLQGLKSKADLEVRTEAERVKDELVSRLIEEALAEFRRRKAG
FT                   MESYRQYLERVLGSAAGESGGSVAKVLCAPEDEEIVREVLGKLGLDGVSVEAVEGIYGG
FT                   VVVELAEGARLDYTVNNIIAAEEPRLRRAVKRALFEA"
FT   CDS_pept        complement(282594..282902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="APE_0410.1"
FT                   /old_locus_tag="APE0410"
FT                   /product="putative V-type ATP synthase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0410.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79366"
FT                   /db_xref="GOA:Q9YF30"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF30"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79366.2"
FT                   /translation="MAVAGGRILAIVDRETAPLFMGVGASVVEVAGSEEVLDAFRRSVV
FT                   ENGVRIVLVLKHLVEDEESLRREADRLGVTLLIIPSMGEKAEPIDVKKLIARALGFG"
FT   CDS_pept        283068..284156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0412"
FT                   /old_locus_tag="APE0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0412"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79368"
FT                   /db_xref="GOA:Q9YF28"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF28"
FT                   /protein_id="BAA79368.1"
FT                   /translation="MAIILGGMVPRPPWKYRLLAAIHAHRNAGDPGADPLVRRAVERLV
FT                   AVTSRVVFGVEKPGWITSGASEGNLLALYTLREEGYRRVVAFDTSHYSIKKSALTLSME
FT                   LDLLPTHGGRPRLDLLERRITPDSVVVATVGTTQEGLVDPVEEIAGVAESVGAAVHVDA
FT                   AYGGYIARFLTGKARFRLEPPVMTVVVDAHKIPEAPPPAGVILASKQKLLDNLWFESPY
FT                   IPTGRQFGILGTRPGGPIVAAWRRVEDLERNPGFPRLASILMRRLRKTLKALERLGYET
FT                   PVTPDLPVACATHPRLGEVLERLKASGVRVYRCRSPKPCLHVTNYGRLCRARLGSSRSP
FT                   RGCLRKPLGASLGNPGVTGLGL"
FT   repeat_region   284009..284316
FT                   /rpt_type=DISPERSED
FT                   /note="APE_repC01"
FT                   /note="type C"
FT   CDS_pept        complement(284391..287510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0413"
FT                   /old_locus_tag="APE0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0413"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79369"
FT                   /db_xref="GOA:Q9YF27"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024975"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF27"
FT                   /protein_id="BAA79369.1"
FT                   /translation="MNPYIAPLLWTAERYLDSNPFFIYGEKNPLLHQTEVVAKSLFIKP
FT                   TRILIADVIGLGKTVTALRILKTIEHYKNQKLGRVLIAVPAVLVEQWKDEMRSMGINPI
FT                   LIERKSLDFRAKQPELPSGWYIGSIDTLKRPEYMAFLQRNKWDAIVVDEAHKLGVVGGE
FT                   PNMRWRNLGKLIMENRDAIVLLLSATPHRGKANDYLSRLALVDPTLLDVTSVSTLEKVF
FT                   DKPEFYQRTHNVILFRRNKDDVNKIYERAEIFKPCNMLAVLIEPNDVERGFLRTITELT
FT                   TSYLRSYYTYIVKELGWKTGRAQSIVALLRTLLVKRGLSSPQALVKTFGKLVEKRGRFI
FT                   ELIDRGYTPDEAQKKIAEEIEDYARKLDEILSGDIGEIDEELDEEFERLAIYFDKLLDD
FT                   MFREELKKAQKYAEDILVGKAVDSKVETLKKILGLVLYTPPEELPDEFKDLASQKAIVF
FT                   TEFKDTATYLYEKLRKWAEDEFGDPGIVRVFTSENRGEIEDIKRWLSEDGRRVLVTTDV
FT                   AGEGLNLQYANVIINYEITWSPIRLEQRIGRVWRYGQDKTTYVFNLFLADGLEKEVAET
FT                   VFAKLYGISISVGKLEPILGEQVFLSTIRNELLEHAVEERETIGGLIPIEINFENRKIS
FT                   LSEARIIELVAKDARAFVKAFIKALKRLVREIKYKRIFPVRADAEKVREELLHLTGFRD
FT                   MEDVVETLKNAGEAFSKILDLSFEEREDKILLRSKDGTVFELPISNPETFLKRLQAYFR
FT                   TDDHAKYFVYQSSEKEVMLLSEVEVLIGGEIRYREPIGILANVETYSLTILRGKELFSK
FT                   LLKILDNSVPVDEVYGLDDVLNLIPQIMSSSPNTFYETALKNGAVKLIKMLEEYEEVKE
FT                   KLGAKKFFHTYEPQVKIREPTFIMISSANLPEVKDVPSEEVWGWAEDEAISTVLDYEKQ
FT                   EDREPTRVSGHEHYDVRSVKRGEDGSIKEERFIEVKTKIKRSLNFGLKSEEFKVAEKKG
FT                   DNYWLYIVYGVRTEKPVILCIKNPAERIPFRRKVSIEKREEYYFGAGGPI"
FT   CDS_pept        complement(287521..288069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0414.1"
FT                   /old_locus_tag="APE0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0414.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79370"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF26"
FT                   /protein_id="BAA79370.2"
FT                   /translation="MMAREGRYVFTFTARKRKKPYYRYEGILRTHRFYIEYYSLLEGQE
FT                   PSRAAGNGEARIAFPVRFMELVLDFSRELGGETVEVRMSKIRGQNLYYEKPIVLLPNEV
FT                   AFRRHLLFAVTVSTYKKPLEARFNALRNLLLTMNANLINILSTIVMDRYRELKASSNPA
FT                   WHWHMLRVGRAVKVLYKLD"
FT   CDS_pept        complement(288073..291639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0415"
FT                   /old_locus_tag="APE0415"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0415"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79371"
FT                   /db_xref="InterPro:IPR007555"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF25"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79371.1"
FT                   /translation="MVDVRSLRVRDEVKNLRYEPAVDLGDLVKGNAPIFIQDPAEFFSR
FT                   THLTDSMKELVIKAFMNLLGLKAETIGGKRYTVSSNLILLPSDLGGGKTHSLILLYHVF
FT                   KLVRDSHDKESVISKLRILDNDIADFVDGNWDLIKNMSLNLVVIDCKYSDLAPSPVRPI
FT                   EIGGRRVKTLWGYLGYELGRYDIVKISDERETAPYADDVSKLLNGSRALVLIDEIGRYY
FT                   DQSGLEPTKISAFLMNLAEALSKYNVSEVAVVISIPYEVRGGGAEAKAGMEYVHRPELI
FT                   RAINEVLSRPSVEIIKPVGRRDLAEILRKRIFAHKKNELKKFFNELVSREFNREYPAQV
FT                   RRILDDRSFWREAEETYPFHPMFLNVLEKLAYRLPYLQRTRDAIKIAVQTVLALKEGLF
FT                   DALEDEINLIMPHHIPLFVSEVLDETILRNAPDEYRVFYLILRSNVVVPENLGNLKKLS
FT                   KEEFYERVMSRALKSLKEDEAKLGLKLASNIWLHSLVGLGLPMNMGEFPTTADLIYSVS
FT                   PTEQDAKGVLGILRSVLPQLIVHGDPESDSAKWFFTIIPSVEELIEILKKNVTDEMAKN
FT                   KLAELLESGLIGRRGRGRPPKGYKEESVFAGYAVVKNAATIPKEILDSRDPALIVFADK
FT                   ISKDELFKVLKGRNNIVVLAPHVEGMGEEEKLAPEDIAGIRELAGLRGKTVWDSLLEIL
FT                   KYYVATESIREENLRAFLGEKVVKGDEEYLKELLNLLKTKVESKKDYYYIHSWNMINRC
FT                   YRKVYYYRLGQIRFEEGLSLESDKPILPLVEEFLREKELIPYEFKGENIISIVKDYLGK
FT                   NPKEEPIKVGELWNFILSTDKANVPIIRYRDFIGAVEDLVKSLDYAIRVKGKLLWKPIF
FT                   KSKEEADALDEGNKLLEKVREHLTRIKASWDDVELVYWEKVFDEWLIRETESIPSDKII
FT                   KVKDRSGQVFDIRDIKFDVKNVIKSGKLFYEEKKYLVELNYELPDDILEDKEYEVAGEV
FT                   IVKNYENEFLVKLQPDEGLSVEPSEFKGKSPLPIKFRLKAGRAGNYRIKVEVYGNGSIL
FT                   DSRIISVSVKGEWIEEEITIGEEGEAVEEDAKLVSIRVNDVVGLPSITRVAKVYPGKIR
FT                   GSLSVSGKAVSVSFNVDTTDPKVFELLWSPINSILRNMKEASALVDIEYSPEGELELRD
FT                   VAKLLVSTKGLKFKVKKKASRR"
FT   CDS_pept        complement(291643..294657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0416.1"
FT                   /old_locus_tag="APE0416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0416.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79372"
FT                   /db_xref="GOA:Q9YF24"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR009537"
FT                   /db_xref="InterPro:IPR014455"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF24"
FT                   /protein_id="BAA79372.2"
FT                   /translation="MASGEDKRFIETSRFPISLINEVSAREKQGGGRPPYWEMVFWWTR
FT                   KPLAGARAVIAGALLPGDYDKTGFLSELRLIAGKVPHRLNPILPRGVKERFKQAKLLDP
FT                   FAGFGSIPLEAIRLGVGEVVAVEFLPTAYIFLKAMLEYPKEYSEARVRVLGREIRELEL
FT                   DKAVSGFIREKSIFDGKTYEIPALIYDVARWGRWITKRLGEDPDIKELYDEDAAVYIGT
FT                   WEVKCPVCGRYTPLVGNWWLAKVKGKRYAYMKPETEGNKIGIKIIEGKTGGSPSPNVAG
FT                   RPELAECLLCGSRITYIDPRTGRTYRTKNEVANTLIRSRLEFYPKHALKDWNKKLEEYL
FT                   EGGIALEELRNSLARPRLLVKVKIANKDLKFEPATDRDDEKLWKALEKLRQLWGDPDIP
FT                   TEPIPSYDNRNLMTYTWGNDKWFKLFNPRQLLTLVKLVKLIRETGKRIEEEKLREGWSR
FT                   EEAHKYAEAITTYLAIAFLRSMTYNSLVTRWKPDSWVLNKVQDSLSTRGIAMTWNWGDT
FT                   WLAHEDISYNYFDSVETVVDALLYLVSAVSGSSGRVRVLLDDATVLSKLEGERFDVIVT
FT                   DPPYRDDVPYAELSDFYYVWLKRSLSGDGLALRFHSDALVSNTQWEGFALNEISYNEGR
FT                   LRYFGVREAEDYYERLMGMAFKRLSELLKDDGLIVTYFAHSSPEAWIELVEAGWRRAGL
FT                   RVTRAWAFATESPQRVTARGKTALESSIVVVWRKRGKDGGRVGEYVDVYREALENARRA
FT                   RDEAFKSGLTDSDMFLSTMLGALSTFTSYDRVVHFGRGLTSRDVVRESYAIATRVIANA
FT                   TETIRSPEALFYLASKAIFRRYSRPGGQTTLSSAPAEPIVLSSHDVIILSYGFLRSVER
FT                   PEKEGYKTFVNAGIIKSAEEVKGANVAKQKAFALLEPLDSTIEELKKLLGVRGVNPIKM
FT                   DAERRSFNSIDALHLLEYYAKQGRSEFKTTYQILYSKYPKQVREAVEVAKVISSYPSDP
FT                   ETNLAKLVRDYIEGV"
FT   tRNA            complement(join(295231..295284,295304..295325))
FT                   /locus_tag="APE_tRNA06"
FT                   /old_locus_tag="APEtRNA06"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:295271..295273,aa:Thr,seq:tgt)"
FT                   /note="codon recognized: ACA"
FT   CDS_pept        295342..295518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0416a"
FT                   /old_locus_tag="APES013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0416a"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79375"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF21"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79375.1"
FT                   /translation="MLIPLGFKGFGACWGPGSFGGWCRRRDSNPGPPDLPGPQATSACG
FT                   CLAGPYESGALPG"
FT   tRNA            complement(join(295405..295443,295492..295529))
FT                   /locus_tag="APE_tRNA07"
FT                   /old_locus_tag="APEtRNA07"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:295493..295495,aa:Met,seq:cat)"
FT                   /note="codon recognized: ATG"
FT   CDS_pept        complement(295572..295745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0416b.1"
FT                   /old_locus_tag="APES014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0416b.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79376"
FT                   /db_xref="GOA:Q9YF20"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF20"
FT                   /protein_id="BAA79376.2"
FT                   /translation="MEIIVTYAPRRREKRIKVVTFKIEADLLEEIDRRAEKKGLTRSEF
FT                   IREAILKQLHQA"
FT   CDS_pept        complement(295891..296676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0419"
FT                   /old_locus_tag="APE0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0419"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79377"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF19"
FT                   /protein_id="BAA79377.1"
FT                   /translation="MKLVSFKPLFTVFAALALLSAVGGAAVYYMHYGVLKSLASPTPSL
FT                   GAILDSVDRLEYEVRVGGDVYRVVVDNSPSSRSGVAELYKAGELQYKIRYEYGENALTS
FT                   MARIDPASGLETPMDVLRWEEAFLTGLSFAQGSQGEIIGVEVFPGIAPLYLHYYLSGAL
FT                   GIDWGQFIAQGAVSAAVRVNVSFQKVETPEGAKRGLQVVLLPQAAGLSQNPWAQAPLSM
FT                   ELARIDGLIAASKIRYDLAIPGQEDGGIEITLTLLQTTG"
FT   CDS_pept        296761..297027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0419a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0419a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34728"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E73"
FT                   /protein_id="BAF34728.1"
FT                   /translation="MTLGLDRGTNAMGHEGWTRVRCRVCGTYLDITGQPPGGRSITLVY
FT                   ACPRCAKDYGAYFCRADARSLKYRCPFCGSELVVISPVTTTQV"
FT   CDS_pept        297083..297421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0420.1"
FT                   /old_locus_tag="APE0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0420.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79378"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF18"
FT                   /protein_id="BAA79378.2"
FT                   /translation="MIVREEWITPHRRVVVVEDGGRRFYSIDFYMEWRGGTPQGLERVA
FT                   GVGGKEVWRLPLLGGCEALFLATPAGLEVISLRLSTSVDQDPAGGDARSAVALCEEGFR
FT                   RWLGSARS"
FT   CDS_pept        297397..298113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0421"
FT                   /old_locus_tag="APE0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79379"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022427"
FT                   /db_xref="InterPro:IPR030662"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF17"
FT                   /protein_id="BAA79379.1"
FT                   /translation="MARVCALLSGGKDSNYALYLSLARGDEVVCILAVKPRRRDSWMFH
FT                   TAALEAPRLQAEAMGLSHAYREAVVSGVREREVEELKAVLTRLRSETGFDTIVLGGIAS
FT                   RYQLERARMLARHVAAGVYAPIWGVDPEEHLLNLVRNGFKFVISRASTMGLGAEYVGRV
FT                   FDEDLAREVIALSRRYGFNPAFEGGEAETLVLDAPHYRMGLCVRGRVARLPGGVYELVV
FT                   EGMRLCSEARVELEQA"
FT   CDS_pept        complement(298099..298839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0423.1"
FT                   /old_locus_tag="APE0423"
FT                   /product="putative deoxyribonuclease"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0423.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79381"
FT                   /db_xref="GOA:Q9YF15"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF15"
FT                   /protein_id="BAA79381.2"
FT                   /translation="MRVYDMHVHLHEYSDREVEEILDADKSLVVVAVSDDLESAWRTLD
FT                   LWHTFGGRVVPCLGFHPWNVREGRVWEAWEVLRLAYRYGVPCLGEVGLDRRFVDEYTWR
FT                   VQNEVFDAFVQLAEDMGVMLNIHAPDAWKHVAHRIGWTSRARFMYHWYTGPATLPRALP
FT                   EGRVWFSINSAIRVQEKSVRVAREIPLRSLVVESDGPYNYRGLRLSPLMVRETVKLVAE
FT                   ARGEDPGRLMEAISLNSERLLGLL"
FT   CDS_pept        298919..299269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0424.1"
FT                   /old_locus_tag="APE0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0424.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79382"
FT                   /db_xref="GOA:Q9YF14"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF14"
FT                   /protein_id="BAA79382.2"
FT                   /translation="MRSLDRGSLAGLALVAGLSAYLIIEGYMAAGGPTLFPLAVAALWV
FT                   GGAAAIAWGRAWGLYPFMLGCLGFIQWRLLAVVPGEGGLRWVAEVSLATLLWFVATFEV
FT                   LRLWLRVRRGRV"
FT   CDS_pept        299318..299524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0424a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0424a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34729"
FT                   /db_xref="InterPro:IPR041043"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E72"
FT                   /protein_id="BAF34729.1"
FT                   /translation="MGGKHGKYVYVKRGDGWYVKVRVFKNRPQDSPERYLIVGPKRREA
FT                   PITFQVLEEDELPEEVRRALYLV"
FT   CDS_pept        299517..300602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0426.1"
FT                   /old_locus_tag="APE0426"
FT                   /product="dolichol-phosphate mannosyltransferase"
FT                   /EC_number="2.4.1.83"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0426.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79384"
FT                   /db_xref="GOA:Q9YF12"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF12"
FT                   /protein_id="BAA79384.2"
FT                   /translation="MSKPPCGEPEVSVIVPTLNERDNIRPLYVGLKKSLEGAGLECFEI
FT                   VFVDDSSTDGTIEEVERLSRSDPRVRLIVRRGEKGLSRAVLEGLRRARGRVAVVMDADL
FT                   QHPPETVPLLVEKVAGGEADLAVASRYAPGGRVEGWSLVRRIISRGAVLLAWLLIPESR
FT                   RTRDPVSGFFAVNLERVRPAIVSGRGFKILLEILYTNPYARVVDVPFTFRGRSRGSSKL
FT                   GPSTILDYLLQVLQLSSIPRFIAVGALGSLVNLAVYTLAFSATGVHPLSSILGFEAGLI
FT                   HNAILHDRITFRNRSMWRSHSFLRRLAKYHATSAAGIAVGVAASTILYSLAGLHPLLSQ
FT                   ALGIGAGFIVNFTLASRYIWR"
FT   CDS_pept        300613..301296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0427.1"
FT                   /old_locus_tag="APE0427"
FT                   /product="uracil-DNA glycosylase"
FT                   /note="UDG"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0427.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79385"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF11"
FT                   /protein_id="BAA79385.2"
FT                   /translation="MAGSRLRQLEEEVRRCTRCPLHATRTHAVPGEGPGEAGVMVVGEA
FT                   PGRMEDRLGRPFVGPAGKLLDSLLELAGLSRGEVYITNVVKCRPPGNRDPREEEIEACL
FT                   PYLVEQISLIRPRLVIAVGRHAGRTLFRLAGLRWPGLARARGRVWRGRIGGVELLIAVT
FT                   YHPAAALYNPGLRGELERDFSGFIRRSVAEALSRGGGGGGAGLDRWFSPDSRGPGEGAG
FT                   GDVDS"
FT   CDS_pept        complement(301243..303045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0428.1"
FT                   /old_locus_tag="APE0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0428.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79386"
FT                   /db_xref="GOA:Q9YF10"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF10"
FT                   /protein_id="BAA79386.2"
FT                   /translation="MLTSLAAPSTAASGDDARTIYYLLPAVEGESDSRGRLIEATLSVK
FT                   PSPGGGFKVVAGGEVDPTTELSMKMAALNALLLAGVSCRSVEVSISIRSQGPVAGPSGS
FT                   LATAVAVVMAAAGYDDVSVHGNYGYVITGAITPGGLAAKVGGIPAKCAAANREGYVLAI
FT                   PLSNKADAPPDCSYAAVAGVLDALSLMGWPRPAFSYRGGLPEAFNESMLGIAEDMRSNA
FT                   LKALEDARGRVPREDYSRESEAIKGLIERSVEAERYSPYAAASLAFTALTRAYTLSYLA
FT                   SLQEGLKPGEALAGLESELESLRAELDGMEKEGSMLYIEMLAVAYTRLADAEASIESLK
FT                   ASPPGEPSSAAAQLGYIKARLESVEGWLKTAGAVKDIGRELRSEDLRIIYSVFREYGYT
FT                   SADYGRSLVEYMINAYNLPEGRFAPYLAALSKLVSEARMYEERGNYVAAIGFLRDAVSM
FT                   TLQVVSAAPEEAPQPEDLELYRREMEAIISVLLARASSLGFQSGLTEAYIQYAEVLAGD
FT                   DPQLAIAMMEEATASAILWSIAAEAMESQLEAPAQPAPTGQDTLAQRIETGAVVAFAFA
FT                   TAGLLFTLGVYITARSFARSSRIW"
FT   CDS_pept        303256..303786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0429.1"
FT                   /old_locus_tag="APE0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0429.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF09"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79387.2"
FT                   /translation="MARKRRESKKEGEGGEKSKDLKIISVEVVTRDKVVKNPRQMALLY
FT                   LIDRLGPIHERTLQIIAHELQQRGAQLGYEFKIVAGVPYSPEFKNDLIALAYVGFVEVN
FT                   PRRNRRLQTTNDGKEALEKHGAPKGVVEVLEKHYEEIRNIASLEDWKVDEHLKTIKQLK
FT                   GARRREPFGGLGF"
FT   CDS_pept        303833..304396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0431"
FT                   /old_locus_tag="APE0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0431"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79389"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YF07"
FT                   /protein_id="BAA79389.1"
FT                   /translation="MSRGRVPWVLRSVVQHRLSLFLYGAPGSGKSLIAHYMGSRAVEAG
FT                   LRVCHFYTPPNKPRNVVEGVMYREVLDMSGLASSLLSASLGRCSFLVVDTINELYRLEP
FT                   TIESVSMLAMAASAVRSTGGVALGVASLRDGEESTPGYSVLEPYFHFIGRIYRLGVGFA
FT                   LELLKPSRKIFYLRYSGSGGVVWL"
FT   CDS_pept        304387..304911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0433"
FT                   /old_locus_tag="APE0433"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0433"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79391"
FT                   /db_xref="GOA:Q9YF05"
FT                   /db_xref="InterPro:IPR002726"
FT                   /db_xref="InterPro:IPR032690"
FT                   /db_xref="PDB:5GUF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF05"
FT                   /protein_id="BAA79391.1"
FT                   /translation="MALELAVDWRIDNILEAIILMLPAMIANATPVVAGGRRPVDMGVV
FT                   LPDGRRLLGDGKTIEGLLAGFAAGSAAGVLAALASGNMLLAVHSPAIALGALAGDMAGS
FT                   FVKRRLGIERGRPAPLLDQLDFYLGALAVSIALGYTWTPRVAVEAAAAVLLLHLAANIT
FT                   AYLLGLKKVPW"
FT   CDS_pept        complement(304995..305171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0433a"
FT                   /product="small nucleolar RNP protein Nop10p"
FT                   /note="H/ACA snoRNP protein Nop10p"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0433a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34730"
FT                   /db_xref="GOA:Q05E71"
FT                   /db_xref="InterPro:IPR007264"
FT                   /db_xref="InterPro:IPR023532"
FT                   /db_xref="InterPro:IPR036756"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E71"
FT                   /protein_id="BAF34730.1"
FT                   /translation="MQWLLRKCRRCGRYTLRRDACPVCGGPVAVPHPPRFSPDNRFIKY
FT                   RYELQKKLGLIPP"
FT   CDS_pept        complement(305192..306025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aif2a"
FT                   /locus_tag="APE_0436.1"
FT                   /old_locus_tag="APE0436"
FT                   /product="translation initiation factor 2 alpha subunit"
FT                   /note="aIF-2-alpha"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0436.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79394"
FT                   /db_xref="GOA:Q9YF02"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022964"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR024054"
FT                   /db_xref="InterPro:IPR024055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF02"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79394.2"
FT                   /translation="MSEEGGVEVKLLKPRKPLPDVGEIVVGTVQEVHDYGAYLILDEYG
FT                   GVRAFLPWSEIASRAVRNIHAVLKPRQKVVVKVIRVYKKRGQVDVSLKRVMDSEKKRKM
FT                   MFYKRYLKAATLVELIAEKLGKSVDEAYREVLWKLEDAYGDPMKGLEAAVLQGREALEK
FT                   AGVPEEWIEPLLETAKTHVRVKTVKITFYLTLRSMAGDGVERVRKVLEAAKSQIESFKD
FT                   SKVVARIYTVGAPKYRVELQGYNYKTLEKALEKMVEAARKTASKLGVEFSFERED"
FT   CDS_pept        complement(306121..306342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps27e"
FT                   /locus_tag="APE_0436a"
FT                   /old_locus_tag="APES015"
FT                   /product="30S ribosomal protein S27e"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0436a"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79395"
FT                   /db_xref="GOA:Q9YF01"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR023407"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF01"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79395.1"
FT                   /translation="MAFAPPLPIRRRKVLIPRPRSRFLLVTCPKCGNRQVVFSHSTFRA
FT                   RCLNCGEVLVEPTGGKARILGKIERIYG"
FT   CDS_pept        complement(306359..306646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl44e"
FT                   /locus_tag="APE_0436b.1"
FT                   /old_locus_tag="APES016"
FT                   /product="50S ribosomal protein L44e"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0436b.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79396"
FT                   /db_xref="GOA:Q9YF00"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YF00"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79396.2"
FT                   /translation="MKFPKRIRTYCPRCNTHTEHRVAQYRAGKRRAMALGERRYRRKQE
FT                   GYGSQRRPEQKRFAKVTKKQVLVITCTVCGRKRPFLGIRLKRLELVDVVR"
FT   CDS_pept        complement(306674..307153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0437.1"
FT                   /old_locus_tag="APE0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0437.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79397"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEZ9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79397.2"
FT                   /translation="MSERLPAGGPYKAVSGSHEVLGSESLREAREALANYCSASRDYCS
FT                   AYLERLLRLSRGIALKRLVDLYGDPGYKGVDRDVLEALGSLVEFYANYISGLLPLHGEE
FT                   VLVRSEATIMGGRVRLLKGEVTAAGPGLAARLYVAGLVSLVESNAKTLRLKPSNP"
FT   CDS_pept        complement(307119..308147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="APE_0438.1"
FT                   /old_locus_tag="APE0438"
FT                   /product="DNA primase small subunit"
FT                   /EC_number="2.7.7.-"
FT                   /note="DNA primase 41 kDa subunit"
FT                   /note="p41"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0438.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79398"
FT                   /db_xref="GOA:Q9YEZ8"
FT                   /db_xref="InterPro:IPR002755"
FT                   /db_xref="InterPro:IPR014052"
FT                   /db_xref="InterPro:IPR023639"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEZ8"
FT                   /protein_id="BAA79398.2"
FT                   /translation="MVEARGGLDPRRLFKAYYSLSPPVEEPRDIAYREFAFQLFDGDVY
FT                   VRHIGFDSMEELLSYMAREAPKNAYYSVARYSLPTARSMEEKGWLGSELMFDIDVDSLE
FT                   GCGEVLGDSCLSRGYKQAVRLVEALYRDFGVPSTLYFTGNRGFHVLADCGWCRRLGREE
FT                   RREIARYFTLEGLRLELIIPRPGRRGVRPAPPSPDDPGLRGWIARAALERGVDLSAVHE
FT                   AIEDLLDDVRVAIDVKVTQDISRLARIVGSLNGKAGLLVARLGLEGFHPGDWLSPFRGE
FT                   VEFRASARLEESRILGRTVSLEPGRVYSMPAHIAVLLQLKGYGAVAGGEVVVRAAAGWR
FT                   PL"
FT   CDS_pept        complement(308158..308907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0441.1"
FT                   /old_locus_tag="APE0441"
FT                   /product="DNA polymerase sliding clamp B2"
FT                   /note="ApePCNA2"
FT                   /note="PCNA B2"
FT                   /note="proliferating cell nuclear antigen homolog B2"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0441.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79401"
FT                   /db_xref="GOA:Q9YEZ5"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEZ5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79401.2"
FT                   /translation="MADARFYFSDARTWRYMVASIEKIIEEGVFVATGEGLSLRALDTS
FT                   HVAMVDLYYPNTAFIEYDIGGESVEFGVSFDLLSKVLRRARKEDELVLEVEGSRLAVKL
FT                   KSRGERTFRIPQVVMTYEKLPEPKVSFTVRARMLGSTFREAVRDLEPHSETLTLRALED
FT                   ALLLVGSSEMATVEIELSQSRGSLLDYEAESQDRASYSIEYFSEMLSAAQAADAVVVSF
FT                   SEDAPVRVDMEYLGGGRLTFYVSPKIE"
FT   CDS_pept        complement(308989..309219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0441a.1"
FT                   /old_locus_tag="APES017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0441a.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79402"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEZ4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79402.2"
FT                   /translation="MERVRVDEVRCMHEEIVERALYRIVEDLAEALDRTPPTVSSRALV
FT                   EGALKLALGAYNSARLLRDECRRAGGGNPGG"
FT   CDS_pept        complement(309201..309557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tfs"
FT                   /locus_tag="APE_0442.1"
FT                   /old_locus_tag="APE0442"
FT                   /product="archaeal transcription factor S"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0442.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79403"
FT                   /db_xref="GOA:Q9YEZ3"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR006288"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEZ3"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79403.2"
FT                   /translation="MSGRIKFCPRCGSIMYPKRDGARYLLVCKSCGYSEEASREDHQAY
FT                   RMRVTVEKGPRDKIVVIDDETPVGAQVLKGSVTCPKCGHDEVYFWMMQTRSADEPMTRF
FT                   YRCKRCRYTWREYA"
FT   CDS_pept        complement(309601..309918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0442a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0442a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34731"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E70"
FT                   /protein_id="BAF34731.1"
FT                   /translation="MKREARILASACVGGVCFAYIVRGPGVDGAVSSLEGCSGLCQRAS
FT                   ERGYMGELRYSHGSCSCGLPTPPGRSEAAEAYRRLAASISLSMLEVLGMLGRAGDPFYH
FT                   R"
FT   CDS_pept        complement(309915..310214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoL"
FT                   /locus_tag="APE_0443.1"
FT                   /old_locus_tag="APE0443"
FT                   /product="DNA-directed RNA polymerase subunit L"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0443.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79405"
FT                   /db_xref="GOA:Q9YEZ1"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR022905"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEZ1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79405.2"
FT                   /translation="MERLRIIRESRGSYVIQVYGEDHTLGTLLVEAIKRVSNPKLAYYE
FT                   AVHPMEDIIQVYVKYEDDVDIKEVLRKASDYLLEVIGDFRRRYLEALERRGGGG"
FT   CDS_pept        complement(310227..310859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0444.1"
FT                   /old_locus_tag="APE0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0444.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79406"
FT                   /db_xref="InterPro:IPR019202"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEZ0"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79406.2"
FT                   /translation="MPGRRYRRVVAVNLRLLDVDDFERFLERLSRAVKVDYSSWRREGD
FT                   KLLIEMVGGESSIRESIVRVKALLREYRRRARGGGLFSYSLRRVSREAGVAVPPDVLST
FT                   VLSGMGYRVEARSGEGVLDTDAPWSLVVEVAREVGERLREAAAQPLTTSSRKLVVAASI
FT                   LAGSTLDDAVRAAVEEGLLEEDEKGRLLVRGGWRESLKTLLKALQER"
FT   CDS_pept        complement(310912..311559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0445"
FT                   /old_locus_tag="APE0445"
FT                   /product="exosome complex RNA-binding protein Cs14
FT                   homologue"
FT                   /EC_number="3.1.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0445"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79407"
FT                   /db_xref="GOA:Q9YEY9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR025721"
FT                   /db_xref="InterPro:IPR030850"
FT                   /db_xref="InterPro:IPR039771"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEY9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79407.1"
FT                   /translation="MSYSSQGVVEKGKVMPGDVLATIEEFLPGEGVYVDPVKGFIRAAA
FT                   PGVAYLDMSRRIAYVKPHKKPQTPGPGSEVAALVTGVRGDLVVAEVYGVVRLSPKPAWL
FT                   YELPSPYSAAIPISQIADEYIKNIEDYYRMGDWILAKIVSRTPPFTLSTVEPRYGVVYA
FT                   ICSRCGAVMEFQSERSMKCPKCGNVEKRKVSIHAKSRHLRIRLVRNLVIYRS"
FT   CDS_pept        complement(311531..312190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0446"
FT                   /old_locus_tag="APE0446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0446"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79408"
FT                   /db_xref="GOA:Q9YEY8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEY8"
FT                   /protein_id="BAA79408.1"
FT                   /translation="MDSGVEASGYPPVGRAKILLERAVNPIPSPRRELEQYTTPADIAV
FT                   RIAVDALLRGLLEGALAADLAAGTCRLGLALLLYGASRVAAVEADGRLAGLCLGAAEKL
FT                   GLGGRIFFVASRVSRRRGPLAAGSVDLVATNPPFGVWRRGADWEVLEYALRLKPRAVYA
FT                   IVKSGNMGFHAAKAAGLGYSTLLISREHFPIPASMPGHRSRVRRVSVDVVLFTRGG"
FT   CDS_pept        complement(312215..313279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0447.1"
FT                   /old_locus_tag="APE0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0447.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79409"
FT                   /db_xref="GOA:Q9YEY7"
FT                   /db_xref="InterPro:IPR016435"
FT                   /db_xref="InterPro:IPR022428"
FT                   /db_xref="InterPro:IPR035435"
FT                   /db_xref="InterPro:IPR042263"
FT                   /db_xref="InterPro:IPR042264"
FT                   /db_xref="InterPro:IPR042265"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEY7"
FT                   /protein_id="BAA79409.2"
FT                   /translation="MKAGFCSLLGDIPYMVDIDSAVEAARRRGARRIVLQLPEGMLQYG
FT                   LYIAKCFEEMLGGAAQVYLHADPTFGACDLHYGELDTTVRPDLIVHVGHSPYPAELAHE
FT                   GLEPRGRVVYVRALSKSQLPLDALREAAGLLASRYGVRRVGIATTAQHTHLAEKAAEVL
FT                   RGEGLEVAVPPGLRPYFGAAQVLGCDYRLARGVRADGFVYVGGGVFHPLGLYLATLKPV
FT                   VQVDPYRGVSEDLTREGEKLYRSRLYRVSQSIGARRWGIIVGLKSGQYRPWLVEKLARA
FT                   IESAGGEYLLVASEVTTLSQLVAIDNPWFEAFTVTSCPRLPTDDFWSYEKPVLTPGEAM
FT                   MALEGRLEPYRFPW"
FT   CDS_pept        complement(313378..313902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl10e"
FT                   /locus_tag="APE_0449"
FT                   /old_locus_tag="APE0449"
FT                   /product="50S ribosomal protein L10e"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0449"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79411"
FT                   /db_xref="GOA:Q9YEY5"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR018255"
FT                   /db_xref="InterPro:IPR022981"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEY5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79411.1"
FT                   /translation="MPLRPARCYTHFSGPPYTRREYIHGVPPPKITRFEMGNREMMEKW
FT                   EIKGELVMLEAGQIRHNALEAARIAVNKYLATTIGDKNFYFRIRVYPHHVIRENKMMAF
FT                   AGADRLQDGMRQAFGKPVGTAARVYPGTVVLEVWARKGDEENVKEALRRGASKFPLPSR
FT                   IVIRTRGAQAS"
FT   CDS_pept        313995..315728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA"
FT                   /locus_tag="APE_0450"
FT                   /old_locus_tag="APE0450"
FT                   /product="molybdopterin biosynthesis protein MoeA"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0450"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79412"
FT                   /db_xref="GOA:Q9YEY4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEY4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79412.1"
FT                   /translation="MDSGIDRGKILSTLHTLEEAIARAAGRLEVLRGSLLEKRESLGLP
FT                   AAIGRPLARKAVARGCYPPYPRVNLDGCAVDSSRVSRGSVLRVTARLRPGMEPVELVDR
FT                   EGGCVWVDTGAPLPVGADAVVPLEELDMLGEGVVRLEAEPRRWMGVADPCSDAMDGSVV
FT                   LGEGEVVTPEAVASLASAGVHDVEAGSRLRACVASVGDELRSLEECREGGGVCETNRLL
FT                   ARSRLEAAEVEVVDLGIHPDRPETLSSLAAAARGSGCHILVTSGGSSVGLSDYALAGPE
FT                   DIVVRGLAIRPGRPTTLSIVDGIPVYSLPGNPRSAGSAIDLFLLPSLAAAGLPVATVVP
FT                   GMRAVLLAGVKPGRRLSYIPVAAVYCGGRLYAVPVSTESYMTVSWAAADGYIAVEPGKA
FT                   LEPGEEASVTIVRGVKRRLSIDYTGGLGGGGYRVTLAKPPHGKVVAEAIARCPRLEAVV
FT                   TEDAAGEMVEAGTPSGALEPVDQDIVIAVNRKCGNNIIAAPRVLEKSGWLSRAASRLGG
FT                   EILYVDNVQSSARLAALGYTCGAVTLKSLTPPGLRVASETRIRVYIARGWAGKGGSGEK
FT                   Q"
FT   CDS_pept        complement(315792..315986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0450a"
FT                   /old_locus_tag="APES019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0450a"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79414"
FT                   /db_xref="GOA:Q9YEY2"
FT                   /db_xref="InterPro:IPR020906"
FT                   /db_xref="InterPro:IPR038647"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEY2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79414.1"
FT                   /translation="MSQKQLPPVKVRDPTTGKEVELTPIKVWKLSPRGRRGVKIGLFKS
FT                   PETGKYFRAKVPDDYPETG"
FT   CDS_pept        complement(316237..316764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0452.1"
FT                   /old_locus_tag="APE0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0452.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79415"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEY1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79415.2"
FT                   /translation="MSMVVSRLEELLAAAPKTGLKASMYLGVVSSLSRLAEDAATAARL
FT                   AECIATANQACKQRGGLLHCSTGCASIEAAKTDGETLLWKYSSNAGSVRVADGRVEINT
FT                   EEAKLAIEPGKAEVSLPSGEGWVTIEVDLRSIDDSIGKAYFIKYAIRKVGKLLRTLQWD
FT                   LRSCARARAITC"
FT   CDS_pept        complement(316820..317542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0454"
FT                   /old_locus_tag="APE0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0454"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79417"
FT                   /db_xref="GOA:Q9YEX9"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEX9"
FT                   /protein_id="BAA79417.1"
FT                   /translation="MAVELRYDEEAVFLRRVNRFVVEVKSSRGVVRCHLMDTGRIDHLA
FT                   SPGRRGVLIAWLNRLGGKTVCRAQAFKTAGGVVAVVDSRVPNRLFAEAAPMVVGGDASI
FT                   EAEREVFGSRLDFLISTGRGLWAVEVKGVNLSLDGVGLFPNAPSARAVKHLEVLARLAR
FT                   EGVKPLMAFVALRPDIRVFAPNYRVDRRFASLACTLLRRGLVGMVGIRVSIDLEPGVVR
FT                   IRPVATAPVQCPPLQPGR"
FT   CDS_pept        317638..318996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0457"
FT                   /old_locus_tag="APE0457"
FT                   /product="class-III aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0457"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79420"
FT                   /db_xref="GOA:Q9YEX6"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEX6"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79420.1"
FT                   /translation="MAVDAPRIVVEPPGPRAREVLERDERVIMQSFTRWYPLVVKRGYG
FT                   AVVEDVDGNRYIDFNAGIAVLNVGHNHPRVVEAVKRQLERFLHYSLTDFYYEEAVSAAE
FT                   RLARSVPISGGAKTFFTNSGAESIEASIKVVRAFFRGTRPYIISFLGGFHGRTYGAMSA
FT                   SASKPVHRARFYPLVPGFIHAPYPDPYRCPFPGLEGEACGEAAVSYIEDYIFSKLVDPG
FT                   EVAAFLFEPIQGEGGYVVPPDSFLPSLQKLARKHGILLIADEVQTGFARTGRMFAVEHW
FT                   GVEPDVMALAKAMGGGLPLGAAVGRSEVMSLPRGSHANTFGGNPVALAAFNAVMDVIEG
FT                   ERLWERSQRLGEKALKILGEAAEELSIVGHVRGKGLMIGVELVRDENTREPHKEALAWV
FT                   LDRSFKRGLLVIGAGVSAVRIAPPLTIEEELFDRGLEILVEVLREADRRFSQV"
FT   CDS_pept        complement(319335..319673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0459"
FT                   /old_locus_tag="APE0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0459"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79422"
FT                   /db_xref="GOA:Q9YEX4"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEX4"
FT                   /protein_id="BAA79422.1"
FT                   /translation="MSGGEMKVKVRLAVVAAILRGSGRRYVSVREVGELLGVTSWTAGR
FT                   ILARLEREGVVSRYSRRTYRVLHPKGSGGLGEGPGEDGGPEDSHKEVSPPVAQAVDVNA
FT                   ARNGSQRD"
FT   CDS_pept        319751..320038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0460.1"
FT                   /old_locus_tag="APE0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0460.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79423"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEX3"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79423.2"
FT                   /translation="MASRKVLNKYKMLVESLGLKQLDVYRVVHEGKPVDVIRIQDPASG
FT                   KTALVDLGTTRESLTLQEFAEKLLKALGESGITVSERLLLRLRGKLLETG"
FT   CDS_pept        320272..320703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0461"
FT                   /old_locus_tag="APE0461"
FT                   /product="holliday junction resolvase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0461"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79424"
FT                   /db_xref="GOA:Q9YEX2"
FT                   /db_xref="InterPro:IPR002732"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014428"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEX2"
FT                   /protein_id="BAA79424.1"
FT                   /translation="MDMPRRGVGYERELAKILWERGWAVIRGPASGGGSRSRVQPDLVA
FT                   VRGGVVLVFEIKKARGETVYLDPGQVLGLLEWARRAGGDAWIALRLVGKGWRFHRADSL
FT                   EHTRRGGFKISRPGGGLKLRDLLTLYGGGVRRIDSYLEG"
FT   CDS_pept        complement(320700..322241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0462"
FT                   /old_locus_tag="APE0462"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0462"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79425"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEX1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79425.1"
FT                   /translation="MTEYGGGEVYLLDLDSVVDGSALRMISSGGLRGRVLIHSALVDYL
FT                   YSEAKRGRSAGYAGLAELSRLMDAGVGDVEIVVVEDDARVQPRDEGELKSVLRRYALRV
FT                   GATLVTSDPVQARAARALGVSVLFTGRSRTGRIRIEEFFDGRTMSVHLKEGVPPLAKVG
FT                   KPGSWMFVSLSDKPLTRAEIEEIAREIIEASALEEEGFIEIDRSGSTIVQLKDYRIVIT
FT                   RPPLSDGWEVTAVKPVAKLRLEDYSLPEKLYNRLLERAEGILIAGAPGMGKTTFAQALA
FT                   TFYAEQGKVVKTIESPRDMRLPPNVTQYSKNYADLGELHDILLLSRPDYTVYDELRSDE
FT                   DFQLYVDLRLAGIGMIGVVHATTPIDAVQRFLRRVELGMIPSIIDTVIFIDSGEVSKVY
FT                   ELSITVKLPTGLREAELSRPVVEVRDFITGELEYEIYTFGEQTMVVPVRERRGRGEAAI
FT                   LGAIRKLLPDAEVEVRDETLIVRLPPRSSRVTARRLKRAKKLAEKHGYDIRFMPL"
FT   CDS_pept        322389..323228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0464.1"
FT                   /old_locus_tag="APE0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0464.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79427"
FT                   /db_xref="GOA:Q9YEW9"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEW9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79427.2"
FT                   /translation="MVDILVTASRIYTGREVLGEGYIYVRDGVVTALGEGMPPEDLTYP
FT                   TITLGGRGRIAAPGLALAADAPAYLLRFLRPSVERRVELYRALGHDAAFTSSLPAVYEL
FT                   HLHGVTTVFIEYITPDLPAKLAEAVGGRYGLLHPSCPGTPEPGGKPPALAGVVSRGCGE
FT                   GGAPGWALESLPVYRPSALERPWSLSEELRREAGLGEGVLREGSTAEIAVFDSSRPPGM
FT                   LLDRYELSLDALYRLGLQVESLVSGSDILVDGGEHLYIVEKHFSEAYSLASRLAGLL"
FT   CDS_pept        complement(323288..324478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="APE_0465.1"
FT                   /old_locus_tag="APE0465"
FT                   /product="thiamine biosynthesis protein ThiI"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0465.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79428"
FT                   /db_xref="GOA:Q9YEW8"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEW8"
FT                   /protein_id="BAA79428.2"
FT                   /translation="MEYNVVLVRYSEIAVKGGYTRSRMERLLLRALEESLAAAGVEAEV
FT                   ERLQGRVLVRLRSPGDAAAAARASARVFGVKSVSPAVEVEYSGIEDLAEKAAEFFGERV
FT                   RGRVFRVRARRSGVEGFTSKDVERLLGKLLLERGAGGVDLEKPEYTAYVEVRGRRAYFF
FT                   DTINPGPGGLPVGSEEPSLALYSGGFDSGVAAWMIMRRGSPVHLAFYDFGVPEALEVAV
FT                   EGAKTLAGEWAWGYRPRLYVVNFRGAALIVNGLVKPSYRTLVLRRLMLLHAQDLAAREG
FT                   FEALVTGESVGQVASQTVRNLRLISSGLELPVLRPLAGMDKDEIVEKSREIGLYDIARR
FT                   QVEVCGVDQPPNPRASPQGFRSEFEKVRDIFIPPPRVFDLKGESLHSILKTLGLRG"
FT   CDS_pept        324597..325049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0468.1"
FT                   /old_locus_tag="APE0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0468.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79431"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEW5"
FT                   /protein_id="BAA79431.2"
FT                   /translation="MARVVSFRWLEGYAVAEATPEGVRLRFSNLTLEFGLREVLVEGVF
FT                   EGYREYTTPRGERKTIYIDFAFPARGVAEPRGAVYSGRADVPLGGYGLSYTSLEPSSAY
FT                   ITLYPPPGALYDYATVSPDLAAIFTVGRRQVYMMREEGSTVRIILV"
FT   CDS_pept        325165..325575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0469.1"
FT                   /old_locus_tag="APE0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0469.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79432"
FT                   /db_xref="InterPro:IPR022285"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEW4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79432.2"
FT                   /translation="MDVTSIPVKPASAKEVRELEIALIIGTLLRPDVIQEILHPREFTT
FT                   WVDSLAVAAGALAREKAGYTVAKIAEELGRSETTIRNHLQGKTKAGQLVRETYDMIKTG
FT                   KLKITIPTPECEETKKKLETVKTTLKELLEKL"
FT   repeat_region   325586..325951
FT                   /rpt_type=DISPERSED
FT                   /note="APE_repA01L"
FT                   /note="CRISPR leader sequence"
FT                   /note="type A"
FT   repeat_region   325952..325975
FT                   /rpt_family="CRISPR"
FT                   /rpt_type=TANDEM
FT                   /note="APE_repA01T"
FT                   /note="type A"
FT   CDS_pept        complement(325980..326744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0470.1"
FT                   /old_locus_tag="APE0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0470.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79433"
FT                   /db_xref="GOA:Q9YEW3"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEW3"
FT                   /protein_id="BAA79433.2"
FT                   /translation="MGERLIILSMAIAVLVVLTVWSWKPLEEDLETLQELLAQFPEEFI
FT                   KFFAKGGVYTLNFDTYYIMNFHGFFYTAVLGGYIAYSSANAISGEVQGKTFWILLSSPH
FT                   RRGLVLLSKYLVAVAVAAVASASTLAALALSAGVYGFEVDLARYLALYTAGTVYLASVA
FT                   SLGILLGAVALSPRAPWAAAGVVIAMYFVDTLTLDTRLERLGALSLTRYHDALGIVLEG
FT                   GVPGHDLAVLALSALAMLLTAVAIFERRDINI"
FT   repeat_region   326733..327041
FT                   /rpt_type=DISPERSED
FT                   /note="APE_repC02"
FT                   /note="type C"
FT   CDS_pept        326778..327029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0470a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0470a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34732"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E69"
FT                   /protein_id="BAF34732.1"
FT                   /translation="MSGTAGFITVSPGPPTEAPGGFPREPRGHRVRFMSFKPYKFYWGF
FT                   PNMSYITRRYGLDRHSTSAYLIALRGIERYSQIQKDTA"
FT   CDS_pept        complement(327082..327993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0471.1"
FT                   /old_locus_tag="APE0471"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0471.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79434"
FT                   /db_xref="GOA:Q9YEW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEW2"
FT                   /protein_id="BAA79434.2"
FT                   /translation="MGVVIEVEGLVKRYGSVEALRGVSFSVLSGEVFGYLGPNGAGKTT
FT                   TIRVLMGFSRPTSGSARVFGVELYNPGASGVRRRVGYVPGEFEFYGGVSGGRMLDYWCR
FT                   LVGGCSRGVVRELLEAFPLPLERAVGTYSRGMKQMLALVMAFSHEPDLVVMDEPTTGLD
FT                   PLARGRVLDFVRSKAREGVTVFFSSHVLSEVQRVADRVGLLRSGVLVALEDVSSLLRKS
FT                   GKVVKARVSKNLSPDRLAVDGVRVIRSNGELELVVTSGKALESVLRMLLDAGLEDLEVR
FT                   DATLEEVFMHFYERTSGPGGKG"
FT   CDS_pept        complement(328347..328667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0471a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0471a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34733"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E68"
FT                   /protein_id="BAF34733.1"
FT                   /translation="MPVYDTYAWIEYFRGSEKGAVVKQLLDSQGGYTPSIVLAEIARKY
FT                   RREGFDENDILKRLLFIVGKTEIITIDVDISMKASKVYLELLELSKKLKLRTPSLAEPS
FT                   YP"
FT   CDS_pept        complement(328673..328912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0471b"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0471b"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34734"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E67"
FT                   /protein_id="BAF34734.1"
FT                   /translation="MRRRFVSDAWDAELSETIKVKKSIYDILIRIAKERGISTPEKVLE
FT                   ELVLEKAGIPKDMFGVDKGKIKPYTEKDRMEDRG"
FT   CDS_pept        complement(328922..329092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0471c"
FT                   /old_locus_tag="APES020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0471c"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79435"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEW1"
FT                   /protein_id="BAA79435.1"
FT                   /translation="MISVLISFMLLFMDYMNISDMKPCISLRSHTAEVRGSNPRGPTIL
FT                   DAFHVLQISEL"
FT   CDS_pept        complement(329133..329651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0472"
FT                   /old_locus_tag="APE0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0472"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79436"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEW0"
FT                   /protein_id="BAA79436.1"
FT                   /translation="MEEGGEGIQREGPNIALVVDSNIIFSIVVAGKRAKAYRVIAGHQD
FT                   LELYAPEEVLLEFREHLKKLEKSARVEFWSKALLAFSLVRITPKEIYEDKLREAYSIAR
FT                   LFDPKDTPFIALSLKLEAPLWTEDKALLRASFKSNLYVALDTESVENLLHGEPLESIRE
FT                   KLYKKLFKQ"
FT   CDS_pept        complement(329606..329833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0472a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0472a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34735"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E66"
FT                   /protein_id="BAF34735.1"
FT                   /translation="MPRVVKIVVPDEVKESDVAQWVAEGLSKRLLRKLVVESLSEGIDV
FT                   NLEKALEEFEKTRDEVWRKVEKEYREKGLI"
FT   CDS_pept        complement(329873..330058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0472b.1"
FT                   /old_locus_tag="APES021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0472b.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79437"
FT                   /db_xref="InterPro:IPR008203"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEV9"
FT                   /protein_id="BAA79437.2"
FT                   /translation="MSEIEGIVKSGVIIPLKPLTELEGKKIKIKIVDAESVDAEKLYSY
FT                   LRLLREGEDARDFFKI"
FT   CDS_pept        330150..330287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0472c"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0472c"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34736"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E65"
FT                   /protein_id="BAF34736.1"
FT                   /translation="MIYNCWWARGDLNPGPPPCEGGVLTRLDDGPLRAPYAGLFLVVGL
FT                   "
FT   tRNA            complement(330165..330242)
FT                   /locus_tag="APE_tRNA08"
FT                   /old_locus_tag="APEtRNA08"
FT                   /product="tRNA-Val"
FT                   /anticodon="(pos:330205..330207,aa:Val,seq:cac)"
FT                   /note="codon recognized: GTG"
FT   CDS_pept        complement(330289..331263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0473.1"
FT                   /old_locus_tag="APE0473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0473.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79438"
FT                   /db_xref="GOA:Q9YEV8"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEV8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79438.2"
FT                   /translation="MNLGRGGVRRLQKLGSSSLVVTLPKEWVREMGLKQGDPVYVVVEG
FT                   GSLRIVPAVDSEATAASRIRLSGLDPGDAIRVLWCAYVLGPEEVVLENAGDDVYNMLRD
FT                   ATSGFIGVDVVRDDDSVSISILVDPSKLDLRAVIRSVASDLRDIAELLTEAARGSSVEG
FT                   EAERARIRLQRSITLAERYLMGVIGSHTGQQDARATASKLLAVNFLGLAASTLLDTVKT
FT                   LSRGGGNASKDTLDVLTALSTVASEAALNVASESLKRSSEVLANIAKLRSRVEELIYSD
FT                   KTSKTEAVALARVLESLRHLHLATTLIYCTLKIAQNQGAQRTA"
FT   CDS_pept        331447..332634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0475.1"
FT                   /old_locus_tag="APE0475"
FT                   /product="origin recognition complex subunit 1 Orc1"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0475.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79440"
FT                   /db_xref="GOA:Q9YEV6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="PDB:2V1U"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEV6"
FT                   /protein_id="BAA79440.2"
FT                   /translation="MEEVFTAALESKIFRKRWVLLPDYVPDVLPHREAELRRLAEVLAP
FT                   ALRGEKPSNALLYGLTGTGKTAVARLVLRRLEARASSLGVLVKPIYVNARHRETPYRVA
FT                   SAIAEAVGVRVPFTGLSVGEVYERLVKRLSRLRGIYIIVLDEIDFLPKRPGGQDLLYRI
FT                   TRINQELGDRVWVSLVGITNSLGFVENLEPRVKSSLGEVELVFPPYTAPQLRDILETRA
FT                   EEAFNPGVLDPDVVPLCAALAAREHGDARRALDLLRVAGEIAERRREERVRREHVYSAR
FT                   AEIERDRVSEVVRTLPLHAKLVLLSIMMLEDGGRPASTGEIYERYKELTSTLGLEHVTL
FT                   RRVSGIISELDMLGIVKSRVVSRGRYGKTREVSLDADRLAVENALSEDPFVARLL"
FT   CDS_pept        332708..333265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0476.1"
FT                   /old_locus_tag="APE0476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0476.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79441"
FT                   /db_xref="InterPro:IPR002802"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEV5"
FT                   /protein_id="BAA79441.2"
FT                   /translation="MGCDDGRVEKLGPQAGFTAVACISWDNRLRLPLAGSLGLVRVDGV
FT                   DATSVLAGLVLRLGAAGRPVLLDSLTIGGFNIVSPPGVERLTGSPVLAVYNYRPSLERL
FT                   ESGLRSSRLPLAGVRARVLSLVEEAAEASTPHGPVYLVAWGLEASEARRLVLETQVYGR
FT                   KPEPVRIAHYTASEASEALRRV"
FT   CDS_pept        complement(333223..333525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0477.1"
FT                   /old_locus_tag="APE0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0477.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79442"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEV4"
FT                   /protein_id="BAA79442.2"
FT                   /translation="MRVGRGGVDSVPPMHPVVEGRVGRDIESVAMHARSLAALISGSRA
FT                   ALDGIVRVTLDWEGARVVMVARRGEVLAIALFEGGDEGAAGGYTRLSASEASEAV"
FT   CDS_pept        complement(333605..334708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="APE_0478.1"
FT                   /old_locus_tag="APE0478"
FT                   /product="molybdenum cofactor biosynthesis protein MoaA"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0478.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79443"
FT                   /db_xref="GOA:Q9YEV3"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013485"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEV3"
FT                   /protein_id="BAA79443.2"
FT                   /translation="MSLTPRVNSGGAVVADAYGRPLKDLRIAVTPECNLDCFFCHMEGA
FT                   TESGPMRPGSWSPVLSVEDYDIIGEAASRLGVDSFKLTGGEPLIRGDVDKIVAVLARYG
FT                   EVSMTTNGILLPLKASSLKRAGLARVNVSLHSISEEVYEKITRRRAVKLALKGVEAALK
FT                   AGLRVKVNMVLLRGLNEGEFWRLLRLAEDLGFDLQVIEVHPAGRGRKVLSSFRRPIDVV
FT                   EERLSSMAVAVETGRLHNRRVYRLPSGVRVYLVDPVENPVFCMGCYRVRLTWDGRLLPC
FT                   IYWKGPYPSVAEALKRGGSREEKVWRVMKILLEANALRRPTYLFRLHDGQEPQAPSTGR
FT                   GLRLTLPGKAKAERLAYSTLKAPLIEG"
FT   tRNA            334925..335001
FT                   /locus_tag="APE_tRNA09"
FT                   /old_locus_tag="APEtRNA09"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:334959..334961,aa:Ala,seq:cgc)"
FT                   /note="codon recognized: GCG"
FT   CDS_pept        complement(335016..335312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0481.1"
FT                   /old_locus_tag="APE0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0481.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79446"
FT                   /db_xref="GOA:Q9YEV0"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEV0"
FT                   /protein_id="BAA79446.2"
FT                   /translation="MKETLEFLKVETSKCIYCGFCEPVCPTLPFGRHRGYGPRGRVFSA
FT                   RLVALDGKATEGDLESLYSCLLCGACMEVCPARIDIVSVVREARALITGMNRL"
FT   CDS_pept        complement(335400..336677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0482"
FT                   /old_locus_tag="APE0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0482"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79447"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEU9"
FT                   /protein_id="BAA79447.1"
FT                   /translation="MIRSIFRKLLGGRGEGLTQDNTIEELEVGDLTLRRGGEKTTVSYS
FT                   FSIKLEKPTATLAFNKGLKASMEGEGWKYRRTVEKGLGWATVNTASRKEDFREASGLVE
FT                   GYVEDFTLSMYGTRGDRALLKDETLWHPIPGDNVVAWGLRGRIKSYVYSANLESGLAVV
FT                   GPGYEEGQNVFRGLSTHRSPGLSLVVGKFRRIRLHGAQFWVRSRSLGREEAARAWDNIA
FT                   SLFTVFEEAGAGLGVVDKVVEIWDETDPFAQDNMLALRSQVLRGAARAEGASLYEVLVT
FT                   LGSKAFADSTPKDLGAYWVYENMPEAAAIAASLTIGGPLEGVLRSRARQLRECLEAGVR
FT                   GGYKILGVGIPRGYKQRVIIRCGVPLAFYRLATENSPDSLWEILKCIAGKRVYGEDDAL
FT                   DCIVKVLGEDAGRIFTHENKVSKQQF"
FT   CDS_pept        336784..338289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0485.1"
FT                   /old_locus_tag="APE0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0485.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79450"
FT                   /db_xref="GOA:Q9YEU6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEU6"
FT                   /protein_id="BAA79450.2"
FT                   /translation="MNESGKTIMVGKLPVGFKPEAPPPPPLKSLIIGPAIITLGLAIGS
FT                   GELIFWPIMSANIGPVLLWAALISLIFQTLWTLEMARWTVWTGEHWVLQMARLHGLVSA
FT                   AVLWGLFTFLAWGFGGWAAAGGRSLYVLTGGPGEESFATVFWAIILFLIVWIVALLAGV
FT                   VREWVEYILTFKMLIIWIMLLVSLAVVSSVDVWADVIRGTFIPSWPSEAIPEKVPYFTL
FT                   ASAIAFIGAGGTTNMWYSFWVRDAGYGMGVYIGRIPGYLRGRPTQLEIVGYLPEPTQEN
FT                   LSRLSEWWSRVRSVFWLIFFLLNFLTAVFFVTLVYSGKKNLGIETEGVGGVEVIELQAN
FT                   IVAEAFGSTIMSGIFLIVAAVLLFGTQLSVTEGVARQIADSAYVAIEGFRRVFRNDIRT
FT                   AYFAVITLFVIWSSLWISLINLAGIRPVLLLQLPANINLLFQIISIPLTLYFIYFVAGK
FT                   SLPKEIWNAMKPHPIVPLLLVLAMLYWGFFATLGWMERFGLLG"
FT   CDS_pept        complement(338421..339842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="loxD"
FT                   /locus_tag="APE_0487"
FT                   /old_locus_tag="APE0487"
FT                   /product="D-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0487"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79452"
FT                   /db_xref="GOA:Q9YEU4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEU4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79452.1"
FT                   /translation="MARIAEELEKIFGPEKVVSDPHIVRLYSREPSGLEGRAEAVVFPE
FT                   SAQDVSRLVRYAYSREVYIYPQGSSTDLAGGAFPERPGVVVSMERMRRVREVSVLDSVA
FT                   VVEPGVRLWDLNVELSKYRYMFPIDPGSVKVATVGGAINTGAGGMRGARYGTMRDWVLG
FT                   LEIVLPDEEGTILRVGCRTLKCRQGYDLARLIVGSEGTLAIVTEAILKITPMPENVVVV
FT                   LAFFPTLRQLVDAVIEVKSRAIDTLLMEFMDVDSARLAAETLGAAIRPDGHMLLVGVPV
FT                   NREASTRVLEEMVSIAKAAGAASVYTAKSMEEAEEKKLLEIRRSLFATQALLTQKQFKG
FT                   RKVMMLMEDIAVPPSKLLDAVERLKELEAKYGFKTVLGGHIGDGNLHPTISYPVDDEKA
FT                   KEAALKWYYDVMRMAIELGGTVSAEHGIGVLKKEALRLELERMGSVKALEIMAGIKRVF
FT                   DPKGILNPGKVVAAE"
FT   tRNA            complement(339917..339994)
FT                   /locus_tag="APE_tRNA10"
FT                   /old_locus_tag="APEtRNA10"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:339957..339959,aa:Pro,seq:tgg)"
FT                   /note="codon recognized: CCA"
FT   tRNA            complement(join(340001..340051,340088..340125))
FT                   /locus_tag="APE_tRNA11"
FT                   /old_locus_tag="APEtRNA11"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:340089..340091,aa:Ser,seq:cga)"
FT                   /note="codon recognized: TCG"
FT   CDS_pept        340218..340775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0488.1"
FT                   /old_locus_tag="APE0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0488.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79453"
FT                   /db_xref="InterPro:IPR018700"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEU3"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79453.2"
FT                   /translation="MVSRRGVASSLRVLLDRGFRFTIIGGTVVEYALGSRDLGDDVDLF
FT                   GEEPPPLLEEEYYGVAHELGWSSGQTWLGTPRLIARAGGEEVPLEFFDNVHDFYVPEPM
FT                   LERAERVVMDGVRVKMVLLEDHIVLKAHAGRGSDIERLKEIGRYVKRGRLRVSRDLVRE
FT                   AVEFFGDEAPVLLRRLREAGLL"
FT   CDS_pept        340772..342148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0489"
FT                   /old_locus_tag="APE0489"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="PK"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0489"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79454"
FT                   /db_xref="GOA:Q9YEU2"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEU2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79454.1"
FT                   /translation="MRGPVKIVATVGPSSSSASILAQMLSLGVDVARINASHGGVEQWN
FT                   SMLESLRRAEEAVGKRVGVAVDLEGPRVRTGNSEPVKLEKGDLVTLGFMEGDVPVDARQ
FT                   FFETIDEGDIVLLDDGKIILQVESVEGFRVKARVLEGGVLGPRKGVVVRGKEPDLPPLS
FT                   AKDRRALEFFADKGVSHVYVSFARSAEHVEKVRTVVRRLGLRQARIFAKIEGPSGVSRI
FT                   GEIAEASDGVIIARGDLGMHYSLEELPEIQELIVWEARKRYKTVVLATEFLSSMIEKPV
FT                   PTRSEVVDIYQAVLQTADALMLTGETAIGKYPVKSVQWMAKISSRAYKKLATSPPERPR
FT                   PTSTPYKLALGLVELAESLDSPLVVYSKTGRFAERLASFKPLKTFYVGVPSREVERVVR
FT                   HLWGAEPIVVGDYPYEAGLAKTYEKLRRENIIHGDETVVEAAWSSERGIYIIRVRNLEF
FT                   "
FT   CDS_pept        complement(342145..342834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0490.1"
FT                   /old_locus_tag="APE0490"
FT                   /product="purine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0490.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79455"
FT                   /db_xref="GOA:Q9YEU1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEU1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79455.2"
FT                   /translation="MARVPVKLVDWSDIVEWSLGLSNMIRESGYEPDVVIAVSRGGFVP
FT                   ARLLCDFLDVTNLLSIQSQHWVEAARMAEKAILKFPYRVDLSGLKALLVDDIVDTGDTL
FT                   LLAKEFIEKEWKPGELRVAALQWISSVAKFKPDYYYMEVREWAWFQYPWTRLEDTMQFI
FT                   TRLFREHEDLRGKAVAPEKLEEAFKEFYGIEPGSLGFYWKLALERLVEKGVLERVDGGY
FT                   RLSDRSG"
FT   CDS_pept        343190..343795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0492.1"
FT                   /old_locus_tag="APE0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0492.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79457"
FT                   /db_xref="GOA:Q9YET9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YET9"
FT                   /protein_id="BAA79457.2"
FT                   /translation="MGLPEPTKVSGVDVLEAIRRRRSRRSFSRRPLTLTEVSTILFHVA
FT                   GITGLAWWGGPKRPYPSAGALQPVEAYLVVERVEGLKPGLYHYNPSGHCLEMLREGKLL
FT                   GRLADVSLGQDHVAEAAAALVLTAVYTRTGSKYGHRSYRYVHWDTGFAGENVYLVCEAL
FT                   GLATVAVGAFYDDEMCGFLEIDCPWEMPMLVFPVGARG"
FT   CDS_pept        complement(343821..344771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0493.1"
FT                   /old_locus_tag="APE0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0493.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79458"
FT                   /db_xref="GOA:Q9YET8"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YET8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79458.2"
FT                   /translation="MGAFFFKRTRDDVAGEVARIVRETLPGGLDYTIESIAEFLGGRVK
FT                   RGLRDPRTAESLIASLREALNRFTAPGQLYHALSLALKILESRGEANVDVPGVFEKFVE
FT                   LDRRSRLEAAAKAVEEVRNADRILIVGFSSILEDFITKTLTIGGVEVYVLEASPAKRGR
FT                   LLVRAARRRRLKSYYAPDSAVYWLVEDSHSIVTSLYGFAREGIVVDAGSAAALALAREL
FT                   SVKTLVLGSELSVSPPASSIGDVASLLSLEAGMQGGGVKRRMSIVDLWRADMVDTLVIG
FT                   RTVEVGEALQGDKYSEFAEALSASVRESIFRELLG"
FT   CDS_pept        344887..345564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="APE_0496.1"
FT                   /old_locus_tag="APE0496"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="RNase HII"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0496.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79461"
FT                   /db_xref="GOA:Q9YET5"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020787"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YET5"
FT                   /protein_id="BAA79461.2"
FT                   /translation="MGIVVGVDEAGRGSLVGDLVVAGFAVEEARLGELQSLGVRDSKQL
FT                   SPAARVELYREISGVGFFTVEAIRPWEIDGENINILVTKAVEEIVSRIVSYLGVHPSLV
FT                   VVDKYGDVQGLRLALTRLGIEPRSILVEEKADSRYPVVSAASIVAKVVRDARLQVLRRM
FT                   YGVRGSGYPSDPETREWVREVFARGEAPRVIRYTWSTVRKLGGPWRSKKAGRNRSLDEF
FT                   LGG"
FT   CDS_pept        345570..346643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0498"
FT                   /old_locus_tag="APE0498"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0498"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79463"
FT                   /db_xref="GOA:Q9YET3"
FT                   /db_xref="InterPro:IPR007364"
FT                   /db_xref="InterPro:IPR016742"
FT                   /db_xref="InterPro:IPR028564"
FT                   /db_xref="InterPro:IPR038459"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YET3"
FT                   /protein_id="BAA79463.1"
FT                   /translation="MSRRRIRKFERPEEALLHLLDAAGIYRVGSRVWLHKPRVRELGFQ
FT                   YLAVETLVREYALAAEREYRGSVVYSKVYGGREYKILLGRGEEVAEASLADPSTVQRLL
FT                   FSWRHLEELLPSPPLPAFVVDLSLKFMHTEEELSKLRLQIAVALSEVRKYLWDPHLVLT
FT                   NMDPQTSGWISEVLGDNKVTISQSKPSEILWSMDADRVVILRPDAPQPLSGSEVLAADA
FT                   FLIGGIVDRIPRPGVSRILDNLVPWGVPRRIELRGSVAGVPERINRIVEILLKARYKYP
FT                   GNLEKAIITSMTKKDVLTRVYSEIIKRGRRVGSELVVEWSLYEDLSSWLPLTPEDFMLA
FT                   AKRARARIEGAPRRDNA"
FT   CDS_pept        346795..347679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0500.1"
FT                   /old_locus_tag="APE0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0500.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79465"
FT                   /db_xref="InterPro:IPR014426"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YET1"
FT                   /protein_id="BAA79465.2"
FT                   /translation="MRVEIVAADSLGVRSIATFVEACGYSIGVDLGASIAPRRFSLPPH
FT                   PRELRRLEQALDRARRRLEESNIAIITHYHYDHYLRDEPELYAGRLLLAKDINRSINRS
FT                   QRFRGYRFLVKSGLVERGRVEYADSRVFRLEGGLTIEFSKPVWHGEEGTKLGKVLMVRI
FT                   TCEGVSIVFASDVQGPGNNEALEELLKWSKPRPLVLIISGPPLYLGGYRVGMSSVELGI
FT                   RNLEVLAERLRPKRLVVDHHLVRDPRFPEVLERLRGRAAGAGVEVLTAAEYMGLRPEPL
FT                   ETMRRELWKGEEG"
FT   CDS_pept        347685..348359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0502"
FT                   /old_locus_tag="APE0502"
FT                   /product="ribosome biogenesis protein NEP1"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79467"
FT                   /db_xref="GOA:Q9YES9"
FT                   /db_xref="InterPro:IPR005304"
FT                   /db_xref="InterPro:IPR023503"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YES9"
FT                   /protein_id="BAA79467.1"
FT                   /translation="MKIVFLECSVELVPRSLWSHPQVLKSARRYGIEPGDLLLDKSLHY
FT                   NAMAELPAKWKRGRPDILHVALLTTTDSPLYNEGLLRIYFQVYDGRLFEVGTGVRVPKN
FT                   YERFRGLVAQLLKTERVPPGEGEALIRLHSRSLAEFVEREGRFILMWEKGSPTTTTYVA
FT                   ARALSTGLPIGVGCFPRGEFKRSTLRKASEAYSIMGGAPLKTWGVASRIVYALERLKSP
FT                   FT"
FT   CDS_pept        complement(348396..348827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0503.1"
FT                   /old_locus_tag="APE0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0503.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79468"
FT                   /db_xref="InterPro:IPR014450"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YES8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79468.2"
FT                   /translation="MSRPTDVTAFTRSLERWVMLQKAVLENFKNIDSQVRSSDRLDLII
FT                   HTRLAFNHMIKTLKAFDDWLQDPFISSNIPRDLLLDVWDTTLKMMELLIELDIRHTSQV
FT                   KNLIEEASREGRLNPILSQLKDIGGWREDRRGESGSMSI"
FT   CDS_pept        complement(348883..349293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0505"
FT                   /old_locus_tag="APE0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0505"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79470"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YES6"
FT                   /protein_id="BAA79470.1"
FT                   /translation="MVRYYHIEMLACPECRNPRLILYVVREKRGAMPPQPERLKCRRWC
FT                   YLFDRPASTVPLSTCVSSCVERDIEEGVLVCPACGRWYPIVEGIPVMMDDKYRDPERDR
FT                   EIASRLAGHVPEWVKLRAVAPVPLEPREAGEG"
FT   CDS_pept        complement(349385..350041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfi"
FT                   /locus_tag="APE_0506"
FT                   /old_locus_tag="APE0506"
FT                   /product="endonuclease V"
FT                   /EC_number="3.1.21.7"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79471"
FT                   /db_xref="GOA:Q9YES5"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YES5"
FT                   /protein_id="BAA79471.1"
FT                   /translation="MLGLDASYSAKDGVGVGAAVLISLETLEPVDCRVYISRVCIPYIP
FT                   GLLAFRELAVMAPAAAALSAEADVVMVDGHGIAHPRRFGIASHVGVILERPSIGVAKKK
FT                   LVGTLVEGPGGMYVVQDGERLAIVLGTRPREVYVSPGHRITLEEAASIARATIRPGGWM
FT                   PEPTRLADVISKALKTIIGGQSLINSALASLCRVKLGPRLEELERPLRRAGLEVE"
FT   CDS_pept        complement(350149..350760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psmB"
FT                   /locus_tag="APE_0507.1"
FT                   /old_locus_tag="APE0507"
FT                   /product="proteasome beta subunit precursor"
FT                   /EC_number="3.4.25.1"
FT                   /note="multicatalytic endopeptidase complex beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0507.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79472"
FT                   /db_xref="GOA:Q9YES4"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR019983"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YES4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79472.2"
FT                   /translation="MSFAGATALGIRVEDGVVLAADKRMSYGGFILSRNFKKIFVINDR
FT                   IGIAFAGLYGDMGGLVRIVEGQMRLASLETGKPATVRNVAKFLSSLLYSYKFFPFNVEA
FT                   IVGGIDPGGEPKLYVLDPLGSIIEEDYVAAGTGATTAFGLLEHVYKRGMSLEEAKKAAV
FT                   EALRASMARDAGTGDGIDVLVLPVSGKPSLETIKFRLVEG"
FT   CDS_pept        350952..351503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0508.1"
FT                   /old_locus_tag="APE0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0508.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79473"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YES3"
FT                   /protein_id="BAA79473.2"
FT                   /translation="MDGRAGSCSYCGSTMVVTLHTEGEIVCGSCGAVLAEQLIDDSAPQ
FT                   HHSGEDHTPGPPLRLSRLPRGVRRAYRRALRRGHVVVGEGSMPYSDLRAVEMSSDESIA
FT                   AILGMVDSIPGLARRRPRVKVGVAFYISYRLRGYSKSSALRTAARSSGASVAALERVEK
FT                   AYRREIENLIMAASMGGERV"
FT   CDS_pept        351593..352618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0510.1"
FT                   /old_locus_tag="APE0510"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0510.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79475"
FT                   /db_xref="GOA:Q9YES1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041623"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YES1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79475.2"
FT                   /translation="MGDPASIAKRIHVPTYDEILERIGRRPRRRARRRAAYEEEIELLA
FT                   RVRDIVISRTDFVREVARLLDGLHPFHRELVEIEFDRRDVSSAVSCISRARKMTDRLME
FT                   KYKVLLLASESPKEARALAREARGRILSLYKRCSRGLEVLRSLMVFMHRLPAIDPGSPT
FT                   IIVSGPPSSGKSTLVKNVSRAKPKVADYPFTTKQIHIGHFEAGEGRVQVVDTPGLLDRS
FT                   LEEMNPVERRAAAALRLLDGAVLFLFDPRPDAYMGLDRQASLLENTVAKLVTGRRIYVV
FT                   VNKEDAVDRGRLEEAVAAAEEAAERVGAVFLGSTSAVDGEKARRVVGEVASREGWTRRS
FT                   P"
FT   CDS_pept        complement(352615..353700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rtcA"
FT                   /locus_tag="APE_0511.1"
FT                   /old_locus_tag="APE0511"
FT                   /product="RNA 3'-terminal phosphate cyclase"
FT                   /EC_number="6.5.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0511.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79476"
FT                   /db_xref="GOA:Q9YES0"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR017770"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YES0"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79476.2"
FT                   /translation="MGSGEWVVVDGSMGEGGGQILRTAVALAAVLGRPLRIVNIRAKRR
FT                   PPGLRPQHLTAVRAVAAISGGRLRGAEVGSTSLEFTPGRVRGGRYRFDVGTAGSVALII
FT                   QALAPLLAYSDSPVEVELTGGTDVPMAPTIDYMREVFASILAMLGYEIEIRVLRRGHYP
FT                   RGGGRVVVRVPDPPGGFRARSFVERGPLKGVYVRSHAVKLPGSIAERQARSAASLVRER
FT                   LGVDPIVEIEAYKPHRDPHLGPGTGVLVWAVFGETVMGGDSIGKKGKPAEVVGREAAES
FT                   LLEDMATGAALDRHMSDMAPVYLALAGGVSTVFGARLTGHASTILELLRIMVDGFEYRI
FT                   LEGGLERPFKAELRGAGVSPR"
FT   CDS_pept        complement(353721..354239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadM"
FT                   /locus_tag="APE_0513.1"
FT                   /old_locus_tag="APE0513"
FT                   /product="nicotinamide-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.1"
FT                   /note="NMN adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0513.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79478"
FT                   /db_xref="GOA:Q9YER8"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006418"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YER8"
FT                   /protein_id="BAA79478.2"
FT                   /translation="MKRLLVVGRFQPPHLGHLHTIKWALGRAEEVIVVVGSAQESYTLE
FT                   NPMTAGERVHALRLMLEELDDWCRRLMIAPVPDIAMNKVWVQYLKMLLPPFDGVVSGNE
FT                   LVLMLFEDMGLAALRPPMFRRGECSGTRIRRLMASGESGWEDCLHPQVRRYVEEIGLPE
FT                   RLRRLQEMR"
FT   CDS_pept        354317..355375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0514"
FT                   /old_locus_tag="APE0514"
FT                   /product="RNA (cytosine-C(5)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0514"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79479"
FT                   /db_xref="GOA:Q9YER7"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YER7"
FT                   /protein_id="BAA79479.1"
FT                   /translation="MDSSIYSGLKVEAVARASRMFRREDEAIASLKPSRTAERLAGEAG
FT                   YSPVLVEKYIQILGEEEARELIAWNDKPLPETIRCNDFLIPCSELESMLSQKGFLVSRI
FT                   PWLPHGIEVLEQPIRVGATHEYMQGLYYIQDPGSMLVAYLLGVEPGETVLDMAAAPGGK
FT                   STHIQQLSRDSTILVAVDISRRRMRALRSHMQRMGFRSYVAVRADSRLLPRIAGTGWAD
FT                   RVMLDAPSTGEGIIRKDPERRRSRSQADVLRIHYLQLELLYTAVDLARPGAPILYAACS
FT                   TSPEEGELVVSRLLELRSDVEVERLESPVGSPGVDSYLGVDISGEARRCLRLWPQRHGT
FT                   EGFFICRVRRRV"
FT   CDS_pept        355351..355875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0516.1"
FT                   /old_locus_tag="APE0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0516.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79481"
FT                   /db_xref="GOA:Q9YER5"
FT                   /db_xref="InterPro:IPR005155"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR040598"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YER5"
FT                   /protein_id="BAA79481.2"
FT                   /translation="MQGEEEGLSRYRLRPPTPREERLVEGFLRAIGFKVNPYAEGMTVL
FT                   DPGGKFKEVFYLPWGLRRAVERLPLHYSAGLNLGSIGERGFRPSLHLARELAPLCGSPV
FT                   KCIRLSPRGEKLFLYSRDVYGDNIASHTSGAALVVGSNGQPLGWGVGLSRDGLLIVKPL
FT                   RDLGWYLRRGG"
FT   CDS_pept        355875..356681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0517"
FT                   /old_locus_tag="APE0517"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PPIase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0517"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79482"
FT                   /db_xref="GOA:Q9YER4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YER4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79482.1"
FT                   /translation="MMPLKDGDFVLINYTVKVVEDGSERVIDTTLEEVAKKSGIYDPKR
FT                   VYKEFPVIVGKTSLLGPLEKVLKELDVGERREVEVPPEEAFGEYKKELVVRVPVKRLRR
FT                   MNIPVRVGEEVEAGGRRGKIIRVTERFAFIDFNHPLAGKKLKIEVEVVGKVDSVEDKAR
FT                   ILAARALGLDPDKIHAEVREGGKEITLKLPPEVLGLSDLDALLAKAVSDVREYLSPRKV
FT                   DVVISIEFPEEAREEAEASDTGEGGEAEGESEQAAEPGGGEERQEG"
FT   CDS_pept        complement(356687..357745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0519.1"
FT                   /old_locus_tag="APE0519"
FT                   /product="glycerol-1-phosphate dehydrogenase [NAD(P)]"
FT                   /EC_number="1.1.1.261"
FT                   /note="EGSA"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0519.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79484"
FT                   /db_xref="GOA:Q9YER2"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR023002"
FT                   /db_xref="InterPro:IPR032837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YER2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79484.2"
FT                   /translation="MYTSFHRIDLPRTIVVGGGVLDKAGGYVSGVAQRGSYVLVVSGPT
FT                   VSSKYFERLRASLEAEGLTVGLKIIRDATVETAEEVAREALESRIEVVAGLGGGKSIDV
FT                   AKYASKRAGSVFVSIPTVASHDGITSPFSSLKGFDKPISRPAKAPEAIIIDVDVIAEAP
FT                   RRYNIAGFGDLIGKYTAVLDWRLAHKLRLEYYGEYAASLALLSAKHVSQYAEEIALGTR
FT                   EGYRVLLEALVSSGVSMCIAGSTRPASGSEHLFAHALHIVARNKPLHGEAVGVGTIMMA
FT                   YLHGKNWRRIRGLLKTVGAPTNAKELGVEDDEVVEALTIAARIRPERYTILGEKGLTRE
FT                   AAEALARKTGVI"
FT   CDS_pept        357912..358571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psmB"
FT                   /locus_tag="APE_0521.1"
FT                   /old_locus_tag="APE0521"
FT                   /product="proteasome beta subunit precursor"
FT                   /EC_number="3.4.25.1"
FT                   /note="multicatalytic endopeptidase complex beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0521.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79486"
FT                   /db_xref="GOA:Q9YER0"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR019983"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YER0"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79486.2"
FT                   /translation="MAEWIAGGLEGPAGRGLDERVVRSGTTTVGLIASDHVILAADKRA
FT                   TAGFLIASRRVKKIVMLSNYVAMTVSGLVADAQILSDVLREEIRLYEMTNKVKPSVRFV
FT                   ASLLSNILFSSKFFPYIVQLIVGGYDTQPRLYTLDLFGSITEDKYTATGSGSPIAYGVL
FT                   EERYREDLSVEEAIKVATTAIRSAVLRDAASGDGADVVVIGPQGYEEKFIPYNSLV"
FT   CDS_pept        358808..360823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0522.1"
FT                   /old_locus_tag="APE0522"
FT                   /product="putative exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0522.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79487"
FT                   /db_xref="GOA:Q9YEQ9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019975"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR033769"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEQ9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79487.2"
FT                   /translation="MASQSKAQETPGRRGLEERKQLIMEIYNSLRSADIASIEFEGPEI
FT                   AVYIRNPKFIVENENVVKDLARKLRKRIVVRTHPKSRKSMEYTIKFIRENVPPDVGIVD
FT                   IQFDDVLGEVRVIAEKPGKLMGRGKVFRNLVLAETGWRLEVYRKPLLQSGLLDSVLRHL
FT                   QRHAEERRRALRDIGERIFRDTLIGTRHVRVVGLGSFGEVGRSAILVDTGESKVLLDAG
FT                   LSPSGYGPDSYPYYWSPEFRVDELDAVVISHAHLDHVGTLPLLFKYGFRGPVYATPPTR
FT                   DIMIIVLRDLINLMRKAQGEPPFEPRDVEKALTRLIPVNYNTVTDVAPDIKMTFINAGH
FT                   ILGSSMVHLHIGQGLYNILYTADFKFYRIKNDRSTRLLPPAEYSFQRVEALIMEATYGS
FT                   KETQPRAEAEEELINLVNKVYKRGGKLLIPVMAVGRGQEILVVLNEALRSGKIPEIPIY
FT                   VDGMVYEVTAVYTNYPELLVKPIRDRILKQGENPFEGPTTVYVTDHYKRDEAMYSDKPA
FT                   IILSTSGMMNGGPIVEYFKYLADDPRNALAFVSYQAPGTLGRRLQSGEREIELEMDGGI
FT                   RRIKVNMEIVSIEGFTGHSTRGELLSFLRRLNPKPRNIVLNHGEPSAIAALAHTVKTGW
FT                   SKLGFESPPIIEAPENLEGVRLYPRNLKMKLALQHS"
FT   CDS_pept        complement(360842..361378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0525.1"
FT                   /old_locus_tag="APE0525"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0525.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79490"
FT                   /db_xref="GOA:Q9YEQ6"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015266"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016437"
FT                   /db_xref="InterPro:IPR022430"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR039757"
FT                   /db_xref="PDB:1ZS7"
FT                   /db_xref="PDB:2CX0"
FT                   /db_xref="PDB:2CX1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEQ6"
FT                   /protein_id="BAA79490.2"
FT                   /translation="MARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDS
FT                   GEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMI
FT                   PGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKARGRAVRRVHRLG
FT                   DALWELAQEVGKRLS"
FT   CDS_pept        361519..361752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0525a"
FT                   /old_locus_tag="APES022"
FT                   /product="small nucleolar RNP protein Sm"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0525a"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79491"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR022901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEQ5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79491.1"
FT                   /translation="MSGPITLPTLRMMLDYVDTPVLVKLKSGLRIKGVLKTYDQHLNII
FT                   LGDAEEIGETSIRRLGLTLVRGDSVVVITPAA"
FT   CDS_pept        361782..361970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl37e"
FT                   /locus_tag="APE_0525b"
FT                   /old_locus_tag="APES023"
FT                   /product="50S ribosomal protein L37e"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0525b"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79492"
FT                   /db_xref="GOA:Q9YEQ4"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018267"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEQ4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79492.1"
FT                   /translation="MGKGTPSMGKHGRSKTHIVCRRCGRRSYNVAKGYCAACGFGRSRR
FT                   MRRYSWQNKKWNRVRVV"
FT   CDS_pept        362082..363203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="APE_0526.1"
FT                   /old_locus_tag="APE0526"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="prolidase"
FT                   /note="proline dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0526.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79493"
FT                   /db_xref="GOA:Q9YEQ3"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEQ3"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79493.2"
FT                   /translation="MEARYDLNRRKLLAAAEEAGFDSLVIAGEANLVYALGYGNPAGVL
FT                   VLSGKCGSTLVVPLLDYERALRSVDTDVEVKAFYRGGESGIEPDIPKSDLISSENMAEA
FT                   AKRVLEGCSSPAVDFKWLRWETATALSNALDNPGDGSQLISQVRSVKEEWEIGLIAEAA
FT                   RIAEAALRRGIEELREGVSEREVAGAVVDVIMKSGGWGPSFPVIVAFGGNTALPHHHTG
FT                   DARLPHASPVLFDLGSVYKGYMSDMTRSLWRGPGGAEYRRLEELVAEAQAEAIDSVAPG
FT                   VEAWEVDKAARLRLSKEGFSKYFIHGTGHGVGVEIHENPYLRPGSSEELKPGMVVTIEP
FT                   GVYLPGMYGVRIEDMVLVTKRGRKLLTSFARIL"
FT   CDS_pept        complement(363298..364431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0528"
FT                   /old_locus_tag="APE0528"
FT                   /product="acetamidase/formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79495"
FT                   /db_xref="GOA:Q9YEQ1"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEQ1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79495.1"
FT                   /translation="MVTRITINRGKRCVDEADRCHNRWHPDIEPAAEVDPGDIVVIETR
FT                   DALDGQITANPGVDDVASADLNVVHPLTGPVYVRGAKPGDLLVVEVLDIKAEPFGFTVA
FT                   IPGFGFLRDLFDKPYKIRWRIEGGYAFSEDLPNVRIPGDPFLGVMGVAPSKELLKEIKE
FT                   REDRLLKRGGFVLPPTPEGAVPPREPVASEGLRTIPPRENGGNLDVRHFSPGSKIYFPV
FT                   FVEGALFSVGDAHYAQGDGEVCGTAIEMGATATLRFGVISEGAKKYGIRFPIFKPSESS
FT                   VRRFTHSKHVAVTGVGVIDSLNESENATLSAKHALLNLINLLEKAGYTREQAYLLASVA
FT                   ADLRLSQLVDVPNFTVTAFLPLDIFIEPPEVLKKLAE"
FT   CDS_pept        complement(364487..365389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0531.1"
FT                   /old_locus_tag="APE0531"
FT                   /product="ABC transporter, substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0531.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79498"
FT                   /db_xref="GOA:Q9YEP8"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEP8"
FT                   /protein_id="BAA79498.2"
FT                   /translation="MSNKVGSGVARRVVYIAVTAVVLIAVAAGIAFLQLGWEEGGSAGL
FT                   LVVVTFPGLKSDVELIACSGDRVIEIYNPGVDPHEAQLDPRAARMVAEADIVVTGGHTP
FT                   ADLKAAELASGTVVDVTRIPGIEILETPDGSPNLHYPIYHPENYRLFLSRLAEAMQEKR
FT                   PECDYIGNLRVALKKLEDLERLQGLLKGSEAVADHPAAQYPAHWLGAEVVLIIGGGEEW
FT                   APTVQELEKAERLLASGSVAFITVDDSGVPVSKAGEWLLREAERLGASVILVKAPYTEG
FT                   SIIDKLSYIAVQIEEGIYG"
FT   CDS_pept        365508..366251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0532.1"
FT                   /old_locus_tag="APE0532"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0532.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79499"
FT                   /db_xref="GOA:Q9YEP7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEP7"
FT                   /protein_id="BAA79499.2"
FT                   /translation="MRVRVEDLTVAYNGEPVLSGVNLEFRGPGLVQIIGPNGAGKTTFL
FT                   KAILGLIKPARGRVFLDGFEATGRPEMVGRYAGYVPQNPSAPKLSPMTVREFVETSLRL
FT                   RGVTRARERAVEVLHTLGIRGEVLESRLWELSMGMLQRVFIARAIAPDPKMLVMDEPLA
FT                   SVDPAGRMEIARIIAGLARERLVLMTSHDPSLLLGHTDIIVVINRDLIASGPPEEVYRE
FT                   DVLRRVYGESVARGLVLAGEGGAHG"
FT   CDS_pept        366299..367111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0534.1"
FT                   /old_locus_tag="APE0534"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0534.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79501"
FT                   /db_xref="GOA:Q9YEP5"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEP5"
FT                   /protein_id="BAA79501.2"
FT                   /translation="MLGLALYPSEWVFAVAGAGLAYGSLSPTLYSRRLLFLAGAAPHSA
FT                   LAAASLGAVAAALTGVGGAWISLALGLTLIYAAGYSIYRGVDPDTAAALLAGFTASLGI
FT                   AGLYLAGRTGASISTLVIGDPLLASRTEALAVLALGVLFLATLLLLGDRIAYIGVDRED
FT                   AMLSGTRVWAYDLLLYTMIALSTVGLITVVGFILEHVLLLIPGALILPLTRGSRTAALA
FT                   GGLAGSAAGVGGLILGGLTGIPPAAASGLILMLTYLVVLLHSGVWRSG"
FT   CDS_pept        367104..367490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0535"
FT                   /old_locus_tag="APE0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0535"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79502"
FT                   /db_xref="GOA:Q9YEP4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR038733"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEP4"
FT                   /protein_id="BAA79502.1"
FT                   /translation="MAKRRFGVSIPEDLAQRLDEASRRLGVERSRLVEKAVEALLEDYR
FT                   HLLTRHSCSGIIIVSCPPRGEAEIATAVEKFRDIVAARLHSHTTGRCIEAIIVEGDSMR
FT                   IAMLHRQLESVGCGARYISMPLHP"
FT   CDS_pept        complement(367617..368600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0536.1"
FT                   /old_locus_tag="APE0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0536.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79503"
FT                   /db_xref="GOA:Q9YEP3"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEP3"
FT                   /protein_id="BAA79503.2"
FT                   /translation="MCVYFYPWYSSDGRHWGDSPLTPVVDEPLLGYYDSRDPVVVDWQL
FT                   GLISDAGVDCLFVSWWGPGSFEDEASRLVFQRLGEHGLKAAILVEPYLGGDAGLYGRGW
FT                   WEETLDYVYENFVEKYSESYLSWEGRPLVLAFNPIGMSYRPLDPRFTIRIVGNDIDRAG
FT                   YQHWDLWPDYLAPWVAEKDAVLRVRGDGYVAITPRFDDRVFCEAGVRTGCGQRLIDPDY
FT                   ALNAYAIQWEWVLRNMDRVRLVAVYSWNEYHERSMIEPHRDATAVNPDPYYAYKATMNY
FT                   VARLEASAGGQGTTDMLAPAAAALAIASLLILILYIARRGGRGSSP"
FT   tRNA            complement(369145..369232)
FT                   /locus_tag="APE_tRNA12"
FT                   /old_locus_tag="APEtRNA12"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:369194..369196,aa:Leu,seq:tag)"
FT                   /note="codon recognized: CTA"
FT   CDS_pept        369558..370574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0537.1"
FT                   /old_locus_tag="APE0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0537.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79504"
FT                   /db_xref="GOA:Q9YEP2"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEP2"
FT                   /protein_id="BAA79504.2"
FT                   /translation="MAPVVCDVCGVRRAVVLQRHTGRRLCRECFREDIVGRVRREVERW
FT                   GMIGPGETVLLGLSGGKDSYVLLDALSEIVGPSRLVAVSIVEGIPGYNREGDIEKIRRV
FT                   AAARGVDVIVTSIREYVGASLYEIYSRARGRGAGHAACTYCGISRRRILALYARLYGAH
FT                   KVATAHNLDDEAQTAIVNFLRGDWVGMLKTHPLYRSGGEDLVPRIKPLRKVYEWETASY
FT                   VVLHRYPIQEAECPFINMNPTLRARVRTALRVLEERSPGTLLRMMERLDEELRPLAQAM
FT                   KPSSLGRCERCGEPTSPKRRLCKLCELLEEAGFQEPIYAIAGRGKRLRLQSPTASPG"
FT   CDS_pept        370582..370857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl13e"
FT                   /locus_tag="APE_0537a"
FT                   /old_locus_tag="APES024"
FT                   /product="50S ribosomal protein L13e"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0537a"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79507"
FT                   /db_xref="GOA:Q9YEN9"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="InterPro:IPR018256"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEN9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79507.1"
FT                   /translation="MAKPKVSLPEDVEPPKAIVKKPRLVKLGPVDPGVRRGRGFSLGEL
FT                   AEAGLDAKKARKLGLHVDTRRRTVHPWNVEALKKYIERLREAGVEV"
FT   CDS_pept        complement(370874..372043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0540.1"
FT                   /old_locus_tag="APE0540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0540.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79508"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEN8"
FT                   /protein_id="BAA79508.2"
FT                   /translation="MPVEIAWGSALVRGPGRIEVVEGAAEVLGGRLGEGSTLVVPAGRS
FT                   VLARVEGRAIVSGVVSTGGVEEAYNRFDSIAREASQRGRVAIVGPSDSGKSTLAAWIVN
FT                   RGGGGYRLLSADIGQNEVFAPGFMALASPQGVAVPGLDDSFSSVEPCFVGGFTPRGSES
FT                   RYLACASRLASLASQVVVDTDGWISLWEGLESKAALAIASRARLVVAVGIASRRARLLE
FT                   RVWGLDTLSVERLAGEAGKSRGERALHRERLIALRTSGGRERRVRPGEAEIVGAPIFRG
FT                   EPLAHEALKALHPAALYGESVDGDIVVVARRGGRVGVGSGLRVLREGWERGLIAAVHAG
FT                   GVIHVGVVTRASYREPSLSVYTRAEGDIEVLEVGRARVDVDSIMGRAKW"
FT   tRNA            join(372080..372119,372241..372278)
FT                   /locus_tag="APE_tRNA13"
FT                   /old_locus_tag="APEtRNA13"
FT                   /product="tRNA-Asp"
FT                   /anticodon="(pos:372116..372118,aa:Asp,seq:gtc)"
FT                   /note="codon recognized: GAC"
FT   CDS_pept        372386..372760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0542.1"
FT                   /old_locus_tag="APE0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0542.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79510"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEN6"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79510.2"
FT                   /translation="MARPVEAVKRLLERWLEGRRRGYVLTLVALRRLEERGEEATVERV
FT                   REEGLRILERTEGRIDWGVTRDEYTVNMVSSVLRELAESGLVEMVDGGRSIVRYRIARD
FT                   AEEEFLSSFGHLLQLVRMPK"
FT   CDS_pept        372806..373963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0543"
FT                   /old_locus_tag="APE0543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0543"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79511"
FT                   /db_xref="GOA:Q9YEN5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEN5"
FT                   /protein_id="BAA79511.1"
FT                   /translation="MKALRGSAAKLSLSLLLFWASYSIYYTITRRAVEEGLGEGSYLLG
FT                   VLMSGAEEAPLAASIVLGYLADRLGYRLPLALGLFEAGLVAAMAFTPLETYPILAGAAS
FT                   LVYALSYSALMGLVLGESGGSGFRYSVIAAFGSLGWALGGLAGGAAYSRLGSLGLLVAA
FT                   ALMAASYLVALSASPPRGGAAPSVGETITALKGVLPLFASLSTSWAALGFFFGAASIRL
FT                   SEALESPIAYGLVLTTVPALLGFLARPAAGRLVDKAGAVAVLALSNAAYSLLALVFGLP
FT                   TSPALLALAWSLPLYPFRDAAAAIAVSSRLERRLQATAAGLLSASESVGGAATLALALL
FT                   LDGGFREMMTASIALMLLSTLLLAADHSTAPRREPCPRRRQGPAL"
FT   CDS_pept        complement(373908..374552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="APE_0545.1"
FT                   /old_locus_tag="APE0545"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="UMP pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0545.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79513"
FT                   /db_xref="GOA:Q9YEN3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034331"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEN3"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79513.2"
FT                   /translation="MVAAVRVIGGETPLARYVLKVLRDRTTGFPEFRRYVRIAGSILAV
FT                   YIAGELGWVEEEVETPLGAKAKELAPAGPVYLVGILGASLPMVEGFASMMPEARIALVA
FT                   ARRVEEPGRLKIEVYYSRLPRMFDGPAVVLDPMLATGKTVAEAVRLARDRGASKVVIGS
FT                   IIASRQGVEYISSLYGDTPIYTLALDPELDENYFIVPGLGDAGDRALGVEP"
FT   CDS_pept        374633..375946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0546.1"
FT                   /old_locus_tag="APE0546"
FT                   /product="putative pseudouridine synthase PsuX"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0546.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79514"
FT                   /db_xref="GOA:Q9YEN2"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR005912"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR039894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEN2"
FT                   /protein_id="BAA79514.2"
FT                   /translation="MDSRVLESALRALSRYPLCDRCLGRLFARLGRGWSNRERGEAVKR
FT                   VLVMELHRRVLEGDEAALKTLVSAAPNIGEVARDVVEHLSPGSYREGGPCAVCGGRLES
FT                   VIASAVEEGYRLLRAYDIERFVVGVRLERGVAMAEEEVKLAAGAGYGESIKAEIRREVG
FT                   KLLVSRGGVTVDFDSPEATLMVEFPGGGVDIQVNSLLYKARYWKLARNISQAYWPTPEG
FT                   PRYFSVEQALWPVLKLTGGERLVVHAAGREDVDARMLGSGRPMIVEVKSPRRRRIPLEE
FT                   LEAAANAGGKGLVRFRFETAAKRAEVALYKEETARVRKVYRALVAVEGGVSEVDVEGLR
FT                   RALEGAVIMQRTPSRVLHRRPDILRRRRLYSLDCSPLEGAPLMECILEAEGGLYIKELV
FT                   SGDGGRTRPSFAEVLGREAVCIELDVVWVEHEAPAAPG"
FT   CDS_pept        375992..376315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl21e"
FT                   /locus_tag="APE_0546a"
FT                   /product="50S ribosomal protein L21e"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0546a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34737"
FT                   /db_xref="GOA:P58077"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="InterPro:IPR022856"
FT                   /db_xref="InterPro:IPR036948"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58077"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAF34737.1"
FT                   /translation="MVKAPRGYRNRTRRLLRKPVREKGSIPRLSTYLREYRVGDKVAII
FT                   INPSFPDWGMPHRRFHGLTGTVVGKRGEAYEVEVYLGRKRKTLFVPPVHLKPLSTAAER
FT                   RGS"
FT   CDS_pept        376358..376699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoF"
FT                   /locus_tag="APE_0549.1"
FT                   /old_locus_tag="APE0549"
FT                   /product="DNA-directed RNA polymerase subunit F"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0549.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79517"
FT                   /db_xref="GOA:Q9YEM9"
FT                   /db_xref="InterPro:IPR010924"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEM9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79517.2"
FT                   /translation="MERRILEYKAVPYQVAKKYMYERVREGDIISIQESTWEYFRKVVF
FT                   WDDPEAASELVEEIVKEGVSREAAANIASICPKTEGELRSILEMDRSITSVHEMASKLY
FT                   PIVSKYCKD"
FT   CDS_pept        376793..377773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0550"
FT                   /old_locus_tag="APE0550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0550"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79518"
FT                   /db_xref="InterPro:IPR007003"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEM8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79518.1"
FT                   /translation="MSRQPRPRDRKPPHQGRPQPHIAALEVEAIVLDYIPEGYPRDPHR
FT                   EHRSKPVVQGLGVRRLHLVDGVPLHEVDILERVTLAREVVYSVPIVARLPGGVERRVKS
FT                   VTVAVTCLPGQAREGGVREIYCYPLSYADQATLEALQQLLGEGDERHRYILVDSPDKLS
FT                   EVARGHGLSGKIVSTPRDPISYQDLTDVARATLPDAVRKLVREREDFFVEFFNVAEPIN
FT                   IRIHALEALKGVGKKMARHLLLERERRRFTSFEEVKKILKIDPAEALAEKIMEEIECRD
FT                   TVKYYFFVEPCDPSKPYLGYTERMWKAYAARVRARREAAGGESGS"
FT   CDS_pept        377718..378551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="APE_0553"
FT                   /old_locus_tag="APE0553"
FT                   /product="S-adenosylmethionine-6-N',N'-adenosyl(rRNA)
FT                   dimethyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0553"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79521"
FT                   /db_xref="GOA:Q9YEM5"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEM5"
FT                   /protein_id="BAA79521.1"
FT                   /translation="MPPGSGRGGRRRAESLVREVLGLAGLRPSDRLGQHFLIDDRAVGE
FT                   FLKPLEKAAAEGIREALEIGPGAGSITLPAAEVLDRIVAVELDNRLASALSRLAPARVA
FT                   VITGDGVSHAAASQAPLVFSNTPFNLSPAIVEALAVNNRVAAAVLGVQYEVARRMTARP
FT                   GSRDYSRLSVLVSLVFHAELAGVVRPQAYYPRPQVLTAVVTLRRRRRWRSLYARALELA
FT                   GCAFTQRNKKASKVLRRCLEAAGCAPPPWLDSLGDARVWMLRPEDFVGLAEACRG"
FT   CDS_pept        378554..379144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0554.1"
FT                   /old_locus_tag="APE0554"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0554.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79522"
FT                   /db_xref="GOA:Q9YEM4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEM4"
FT                   /protein_id="BAA79522.2"
FT                   /translation="MSWSRGSIAVYVNSCTYPPSDDTILLLEAMEALRREGRVYGSALD
FT                   LGTGNGALALGAVEVLGVRRVAAVDAYPCPALAARATLPPQALVAVCPYASCLKGGFDI
FT                   ALVNPPYLPEKPPPPGGQGCSPTLSEAWAGEGVMRGMLEAAGRLAGEVLTVYSSLSSVT
FT                   PQEVLGAMGFSTRILASERFFMERLEVVHAWRS"
FT   CDS_pept        379132..379863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0555.1"
FT                   /old_locus_tag="APE0555"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0555.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79523"
FT                   /db_xref="GOA:Q9YEM3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEM3"
FT                   /protein_id="BAA79523.2"
FT                   /translation="MEKLRIVLVETEGAVNLGFVARLAENFEADEIYLVSPRASLEEAK
FT                   RYAARAAWRLDAARVVSNLEEALRGVSASLCTSSHMSDRDALRAPLAPWEAAEVLAATP
FT                   GTVAIVFGRESVGLTRGEIALCSLYSSIPASPRYPSLNLSNAAAIYLYEVYKARRGGAV
FT                   ARGGVDEELIKLLRAYAAALASRLVHRERAEEVAVSLVRIASKSVMARREVENLIYLLS
FT                   KACRAVEGCMDEVPRHLQPRD"
FT   CDS_pept        379829..380893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0557"
FT                   /old_locus_tag="APE0557"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79525"
FT                   /db_xref="GOA:Q9YEM1"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEM1"
FT                   /protein_id="BAA79525.1"
FT                   /translation="MRFLATCNPGTEDVVAREIVEEVDSAKVEEVGEYRGRIVFRSSGE
FT                   PWLVAEQIYGLRSIHSASLLLAEAEVSPGREGLEEVWRAAYKSGAHLHIPYGATFAVRG
FT                   ERIGEGHSYTSVEIASTVGDAVQRAAEESLGWRPMVRLNSPQVVLHAEVDIFTFRLGVL
FT                   LTGERSRHRRRYRVYDHPAALKASLAYVMLRLAGARDGDTILDPMCGGGTVAVEAALLF
FT                   ETSRVYCVDLNPRHTRGARLNAESARVGGRVEVYTWDARMLHELLGEDSVDRIVSNPPY
FT                   GIRLGDPVDVRILYREFMPSAARVLRSGGRAAIITAETKALVAAARSSGLRMAGARRVR
FT                   HGDLWVDIVVLEKP"
FT   CDS_pept        complement(380994..382289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0558.1"
FT                   /old_locus_tag="APE0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0558.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79526"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEM0"
FT                   /protein_id="BAA79526.2"
FT                   /translation="MSAPARLPVSRTLALVASAAALLVLGAAALLIAGLGGGEPEELVI
FT                   GGVFSLSSGTSVEACRQALAGAMAAVEWVNSNGGVNIGGSKVPVRLLQEDDKGDPANAV
FT                   RLIEYMARQRGVGVMLAPCDPGVLVDAVEAARGYGVVSIVYGDAPASVADPGGKTLLVG
FT                   APAEEYFTPVLEMVSILDIQSRNLAIVYQDTGFAAAVAEATRNRAVEQGFVVVLYSAYP
FT                   PQAGEEELGTLALRLQASNPDVIIAIGGFRDGVELVRAMSSYGVEAKFIAMAVAPSVPE
FT                   FYSELGALSQAILYPTLWELASKPYTTAEGYEWFGPSREEFYSLFREAIESLGHPVSEP
FT                   GYHAAMAALAVLAVAKAAEEAGSLDPDAIYESLKNIKIMTFAGPFDLNPETGLQNEREV
FT                   LVGQWINGRRFTVWPVGQAYATPVYPHPGWPG"
FT   CDS_pept        382374..383825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0560"
FT                   /old_locus_tag="APE0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0560"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79528"
FT                   /db_xref="InterPro:IPR016675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEL8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79528.1"
FT                   /translation="MLERVKPGVGPEWGGGGIYSLRLHRGSLFYTLAFEARSTLLRGDC
FT                   SWSSYDYSLVGPPPRSGGDTYNAVEAVDGKIYFGGWAHAPAVLERKGKGRLAEVVFTNK
FT                   YSILHEMDVDTGEVRLLWKEGARDRRLWACEVSEVLYNPLRDTLLLARGDGHINCGIFE
FT                   AGRRGGVRKLSSTPVLKGEVFMDMACFSIHHGWGGNPGLECVDLESGETVYTGEAVPEE
FT                   AGLDGGGLDHYREGAVFQLHTRVYVAHKGGFTVFDPEGGGEPRFYRVLDFGDNPYSPTR
FT                   TNALYLGGGVLIPFNTPTAATVRGTDELPNNVQRSSRRSPAPTLLVYVTPTDMRIVGSL
FT                   GARVTSMEALGDKVLLAWSTQPNFERYDATATDASVRGVAVVSQDSLLAGRPPPLSIRV
FT                   DPGWVGDRRFGGLPLYGYRELQVDPRGGRVVLEAYEISDEAPVKYGREVVEGGEWIDVS
FT                   SLTDSLVVMRIEKPPREGMVRVRAL"
FT   CDS_pept        complement(383822..384628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0562.1"
FT                   /old_locus_tag="APE0562"
FT                   /product="putative prephenate dehydrogenase"
FT                   /EC_number="4.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0562.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79530"
FT                   /db_xref="GOA:Q9YEL6"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEL6"
FT                   /protein_id="BAA79530.2"
FT                   /translation="MECRVGFVGAGSVARALARAASARGWPVCFYDIDRERAGEAASQY
FT                   GGLSFSSLQGLAAESEAIVVAVPGPAAGGVMVEAARSSRSGTLVVDTATFKRGVVAAAR
FT                   GMPPRVLAALTHPLFGGRASRPEKHYVAVMPFPGREGVVEAERLYREMGFNTIRLRSWE
FT                   EHDRLAGYSIGLVYALAEALYAALESGGLDLDSPLPSTTYRVLGMLAQSVLSDSPDLRG
FT                   EILSNPSTREAAASLASALMEVARGAGPRGRGRSSYNLLYRLLEEC"
FT   CDS_pept        complement(384618..384869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="APE_0562a"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0562a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34738"
FT                   /db_xref="GOA:Q05E63"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E63"
FT                   /protein_id="BAF34738.1"
FT                   /translation="MGIEEARRLIDELDAKIVALLEERLELCRRVGEEKRRLGRGLRDE
FT                   DREAEVLGRVPSRWRPLYRLVIEECLREQARGGFRGGV"
FT   CDS_pept        complement(384859..386001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="APE_0564"
FT                   /old_locus_tag="APE0564"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="5-enolpyruvylshikimate-3-phosphate phospholyase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79532"
FT                   /db_xref="GOA:Q9YEL4"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEL4"
FT                   /protein_id="BAA79532.1"
FT                   /translation="MASRDSLGEVFRVSIFGESHGPGVGALVTGVPPGLEVDEAYINRE
FT                   LERRRPGGPYASPRREADRVEILSGVFRGRTTGAPILLFIRNVDVKPGFYEEFRYKPRP
FT                   GHADYVAYERYLGHQDYRGGGIFSGRRTAALVAAGAIAKLVLARYGVRVYAYVKSIGGV
FT                   EARVEPRDSEEFRRAIDRDPLKCPDPEASERMRRLVEEARREGDSLGSVVEAVAFNVPP
FT                   GLGDPPLGGVDALLARAVMAIPAAKAVEFGEGFALAFMRGSEAHDSPRAVGGRIVHETN
FT                   RSGGIVGGLTNGMPIVFRVAFKPPSSIPKPRRTVDLRSLGEAWVSGKGRHDPVIGPRAA
FT                   PVVEAVTAIVLADLLLLREALLPEWVEDLRPWTRGEAGGD"
FT   CDS_pept        complement(385991..387274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="APE_0569"
FT                   /old_locus_tag="APE0569"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="5-enolpyruvylshikimate-3-phosphate synthase"
FT                   /note="EPSP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0569"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79537"
FT                   /db_xref="GOA:Q9YEK9"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEK9"
FT                   /protein_id="BAA79537.1"
FT                   /translation="MVWLRAPDRVVVHPSTVEGRVEAPPSKSYTHRMLFLALLARGRSV
FT                   VRRPLVSNDTLATLNAVALLGGKPRLGRGVAEVEGGEVRGGAVVYAAGSGTTIRIAMGV
FT                   AAHSAEATLLYGDESLNRRPVHPLSEALRSMGARVCDTGGNPPVKVSGPLRRASVEVDA
FT                   AISSQFATSLLIAGSRLGEFELSAARLSSRGYVDITLESLSMFGVRVEREGYRLFRLRG
FT                   TPKPVDAAVPGDYSSASFMLAAGAIAGRVEVEGLRPVDPQPDRRIVELLRSMGARVRVE
FT                   GGVVAVESTGPLEPVDVDLDGSPDLAPVAAVLAAYARGVSRLRGLERLKYKESDRLSAI
FT                   AWNLARLGVEARVRGGILEIRGGGVEGGVARSWGDHRIAMAMAVAGLGARRPVAVEGFS
FT                   RVPDSYPGFLEDLARLGARVEAVKGGGV"
FT   CDS_pept        complement(387262..388104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="APE_0572"
FT                   /old_locus_tag="APE0572"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0572"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79540"
FT                   /db_xref="GOA:Q9YEK6"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR010189"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEK6"
FT                   /protein_id="BAA79540.1"
FT                   /translation="MARARASGGLTIVNAIGHGRLGGAAGLGLWVESRVREARGLWAGV
FT                   SLTPRGERRLPPRVLEAAATAACSLGACVEGLEAEVHTGFPPGVGLKGSAALLASLVEA
FT                   VLRLKGVRAPPWRAALAAARVSRGAGLSVTGALDDHAASLLEAPVITDNRGMAILRLLP
FT                   RDGCRLTAVIGVPGVENPVENLDPSPFRRHSRLYDAAARLGLAGEWLPAMAVSGVAGAL
FT                   ALGVEGLASRLYEAGAAAAGVTGKGPAVFALTERPRGAAEVLETAGYEVVEARFKWCG"
FT   CDS_pept        complement(388104..388925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="APE_0574.1"
FT                   /old_locus_tag="APE0574"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0574.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79542"
FT                   /db_xref="GOA:Q9YEK4"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEK4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79542.2"
FT                   /translation="MIRLALFGSGVSSSLSPAIYRGFAAKRGLRLEYRVYEAGPGGLAP
FT                   ALRMAGELHGFNVTKPLKREALSLASTLDSHARAIGAVNTMVAGEEGWEGFNTDWKGFL
FT                   DSLKLYTASPPDTALVIGAGGAGRAAAYALATWGAGRVLIASRTGLTARRAAQDLAGLG
FT                   AEVEPVPPGGLEDAAAASDVVVNATPLGWDGVSTPVERGFREGCIAVDMVYRPLATPFL
FT                   RRAAASGCTPVDGLWMLAIQAAENIAVWLGLEASPVELRTYALEAMRGGRG"
FT   CDS_pept        complement(388922..389590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="APE_0577"
FT                   /old_locus_tag="APE0577"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0577"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79545"
FT                   /db_xref="GOA:Q9YEK1"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEK1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79545.1"
FT                   /translation="MGASGRICTVVPVEDAGEAAMLALSSPTGCVELRLDFYPGDPGEA
FT                   LELLATRLHSPARVVVTLRSAGHGGLDRRARGERRAVLARLEDLAPEGWLVDYEVEDLH
FT                   ASSGCSGCIASSHPTTPPTPRRALEEAAVAERLGASAYKLVYPGVEPWEQAAAARLVAE
FT                   AGGFATSFTLGPGTLASRLTALALGAPLVFGSHPRAPLDGVPQSSEIMELYLRMGLGES
FT                   "
FT   CDS_pept        complement(389597..390673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="APE_0579"
FT                   /old_locus_tag="APE0579"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0579"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79547"
FT                   /db_xref="GOA:Q9YEJ9"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEJ9"
FT                   /protein_id="BAA79547.1"
FT                   /translation="MAQAAVERRVFRLSVDEETVVAAGVGALSEAPRAAGGTAYIVHEE
FT                   ALSAEAARLARILEARGVEVLGAVAGGGERVKSLDWVTRLWDLMLQAGVERSTTVYIIG
FT                   GGALLDAAGFAASTLMRGLSTVNIPSTTLAAFDAAAGGKTGVNLRGKNMVGTFHNPRMV
FT                   LVEPGIVAGQPDEGYRDGFAELVKHVALSGDREPAASLLPQALARRPAPLARLAFWSLG
FT                   YKMQVVAGDPRERGLRRILNLGHTIGHALEAASSYTLSHGRSVSIGLAGELELSRRLAG
FT                   LPRGEAEDVLDMLSTAGLPLEPPPGLAGEAAGLVGLDKKREGGSIVMPLLERLGRPRLS
FT                   RVPVETVSRLMVELWGGG"
FT   CDS_pept        complement(390655..391467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroG"
FT                   /locus_tag="APE_0581.1"
FT                   /old_locus_tag="APE0581"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0581.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79549"
FT                   /db_xref="GOA:Q9YEJ7"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="PDB:1VS1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEJ7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79549.2"
FT                   /translation="MAGFKGVKLALKSEERRETVVEVEGVRIGGGSKAVIAGPCSVESW
FT                   EQVREAALAVKEAGAHMLRGGAFKPRTSPYSFQGLGLEGLKLLRRAGDEAGLPVVTEVL
FT                   DPRHVETVSRYADMLQIGARNMQNFPLLREVGRSGKPVLLKRGFGNTVEELLAAAEYIL
FT                   LEGNWQVVLVERGIRTFEPSTRFTLDVAAVAVLKEATHLPVIVDPSHPAGRRSLVPALA
FT                   KAGLAAGADGLIVEVHPNPEEALSDAKQQLTPGEFARLMGELRWHRLL"
FT   CDS_pept        complement(391487..392455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0583"
FT                   /old_locus_tag="APE0583"
FT                   /product="putative transketolase C-terminal section"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0583"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79551"
FT                   /db_xref="GOA:Q9YEJ5"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEJ5"
FT                   /protein_id="BAA79551.1"
FT                   /translation="MASAPALQMASYRKALGRLLARLASELEDLVVLDADTLRSTGAIE
FT                   VYRSAPRRVLNMGISEQDLIGTAAGIALAGLRPVVTGFGAFLMRGWEQIRNTVDRDGLN
FT                   VKIVATHTGLSPHVDGSSHQVLEDLALMRSLARTAVFSPADDVATVETVEWLVRRYRGP
FT                   AYVRLGRDNAFRVYSEEEFTFRPGGGEVLVEPGEAVTLLATGPMVGVSLAAAALLRSEG
FT                   LRVGVVDVYSIKPAPRRLVLEAAERSRLLVTVEEHRTVGGLGDVVSSILAEEGACARQA
FT                   RIGVPPGVYGSSSRDYMSLLRHLRLDPESVAARVRRLAAAL"
FT   CDS_pept        complement(392495..393205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0586.1"
FT                   /old_locus_tag="APE0586"
FT                   /product="putative transketolase N-terminal section"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0586.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79554"
FT                   /db_xref="GOA:Q9YEJ2"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEJ2"
FT                   /protein_id="BAA79554.2"
FT                   /translation="MSPSLATVSSLLEAARGRLHILAGRGLGWHLHSSTTALPILAVLY
FT                   AYWLPRGRVEGVDRRVILSKGHASLGFYALLEEMGLLERGSVERLFARPGSPLQAHPEA
FT                   GRTPLTLVSNGSLGQALSVSNGLVIGSRLKGRRVEVAVVLGDGELDEGQVWEAAATAAA
FT                   MRLWEVVAIVDRNRVQHTGETEAIKPKEPLEDRWRSFGWEAVTVEGRVEEIARALDSRA
FT                   GDRPTAIIVEAVDA"
FT   CDS_pept        393471..396176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0588.1"
FT                   /old_locus_tag="APE0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0588.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79556"
FT                   /db_xref="GOA:Q9YEJ0"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEJ0"
FT                   /protein_id="BAA79556.2"
FT                   /translation="MGSLKARAEVICPGAFLLLCLMLSLGLAGSAAGASDSPTPSGTLD
FT                   ASPHLWLRMAETLVERLYDPSLNLFRETWGTPEGQCWYWNTEQGEAAQIAVYLNDSTLL
FT                   SSLLAAYRQYLTYDNGANVYLFSRYTPCSMIRQLSLDPQNFSLGNLIVNIGGDLAGTRA
FT                   DNLDYSRAIALGLDIYKDPTNIYEQDKAWPNMWYTANLKSHEVWYLAPGDTTDYKGIWD
FT                   TSDGSLGTGRITGYSVRVEHVTDPATNATYNVGVAERTMEDANLSYTQRFILEPRKPYV
FT                   KVELTVANKSRYTLSDVSVALAFDNLDWWLYRYVYIPGLGLIDASTAGRLISEGEKEYH
FT                   LARTWEGFWQPVTDSSGRAWWPSIIYADGPLGMNRGLLVLVQGDYGVHFWGYGNYQAPR
FT                   EDLYGVPAYTDWYYRWLKYEIMIGELAPGESKTVEVLIIPMSSYAPGLEDLYIEMASRL
FT                   DRLEGRDLSYAVNTGTGAFKGLAAAYSLLGADDRRFVERVIDSVGSVMEGWGWRASTRI
FT                   LANYTLALAHLHGHTGKGEYLSRAEAAAQRLLEAQVRDPGDPRNGGFLDAVHPFGTATH
FT                   LDVNAEAAHALLAMWERTGSRVYKEAVDYWLQNWFHREQDTGRWYYHRFRSLEDAGGES
FT                   LGKRYLDEERPYALGYLLQALSRHYWSDDRLLASANRIWSLLTGEYWVATWEGAGETNV
FT                   ETQSSSAAGLREYLLALSEKAGAALEYVRDGSVSHLAFDPRRGSLDPKTGAWLVEARAV
FT                   IGVTGTPDSTAATLAVYIPSGMVDLVLLDGSPASRAYSLSELEGKPGSYYFEGNIVYVR
FT                   LQGAQRVTIAYRLVEPKPPLPEVYKTPLAVAAAGAAAFIAAEASAPLLALATACLIIVL
FT                   WAAGWLPTYVAIAMVALSVGLGLIAIRRNS"
FT   CDS_pept        complement(396676..397476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0591.1"
FT                   /old_locus_tag="APE0591"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0591.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79559"
FT                   /db_xref="GOA:Q9YEI7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEI7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79559.2"
FT                   /translation="MAGNYSLVKTRVDPPLGWLVFSRPERLNAFNTSMMREVLAALDEL
FT                   EGDEGVRFVAITGEGKAFSAGIDLGELAEAGSPEEAERLFSTLAMVVERILGLRKPVIM
FT                   AVNGHAIGGGAELLWAGDIVVAVRSARISWPESLWNLAPPFLPTLGPFVLGPARAAYLA
FT                   LTAEPITAEEAYRMGLVSLLVDEPGQLEDAVNRVAEKIMASPPAAVESIVSMLRAGKRG
FT                   WHTQLGVAELKRLSKDTTALQAAKSFKDTKRPPDYKSLWRTGKK"
FT   CDS_pept        complement(397737..398294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0593.1"
FT                   /old_locus_tag="APE0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0593.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79561"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEI5"
FT                   /protein_id="BAA79561.2"
FT                   /translation="MASVIRFAIIATVLALLAPAIAYYLYPAEARPLADLPVYSSSSSL
FT                   GRGLEATRGLQGPVEARGVVERPVGHPAMMHHHLVYLEVDGRTVMLALPGCWRASNGEI
FT                   LMGHQLAYLLEGREVYVKGVFMKTSMGPLIIAREVNVNGVKLERIDCMPMPPMGDSDMP
FT                   HRGMPGGWEERWSNPWTTEDEP"
FT   CDS_pept        398532..399095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0594.1"
FT                   /old_locus_tag="APE0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0594.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79562"
FT                   /db_xref="GOA:Q9YEI4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEI4"
FT                   /protein_id="BAA79562.2"
FT                   /translation="MVEGVLAALYSASAALFTLIAAVLARAYLRLGLQELAGVAWGFSL
FT                   LAASSAMGAAEMLVDSPRAAVSLYVGSASLAAAGLAIILFANLESRRSISPIQLAAPLV
FT                   MAVSIDSIAGVLGLLAGYTSRGLARLGFTLIGASHLGRVVSVYLMPGKEAVALLLASEL
FT                   LRSLAAFIMSLYYSGRVVGSGEEE"
FT   CDS_pept        399070..399348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0594a.1"
FT                   /old_locus_tag="APES025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0594a.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79563"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEI3"
FT                   /protein_id="BAA79563.2"
FT                   /translation="MLEVARRSRVEIIIDVLEALQDEGPMTPTRLATVANMPYDRLQTV
FT                   LEPLVAKGLVRVRDMGRSKQVEITREGVRALHDLKRVRRLLSDLGFA"
FT   CDS_pept        399452..400603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0595.1"
FT                   /old_locus_tag="APE0595"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0595.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79565"
FT                   /db_xref="GOA:Q9YEI1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEI1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79565.2"
FT                   /translation="MKRRIVILGGSFGGLQAARYTLDLLGDKADITVVNESDRIVFKPA
FT                   LTYLAAGMRSSAEELYIPLREKFANTSARLEVSRVSGIYPEENKVELSSGSAIEYDYLV
FT                   IALGAVPDEKALPGLEEANANPWTLEGALKVRRALENGARKVVVGSFKPPYPCPPAPIE
FT                   LAGLVAKTPLAGNGGVEVTLGFPGPRPLPPLGEEVSSKLEALIESTPIRYVRDFKPIEV
FT                   DPGRKVLRHEGGEESFDVLALVPPYKVNPLIVEAGLASEGGWPRVLFEKGFRHGSYDNI
FT                   YVIGDSSVAQYGAPMAGFLAGFMALGAARAIAEDLGEPVEAGGKKAYAKCFVDYIDDGA
FT                   AVFCDFTGLFTGEGGPHCHVIAEGGLVGEYKKALERYWRSFKL"
FT   CDS_pept        complement(400709..401341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0596"
FT                   /old_locus_tag="APE0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0596"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79566"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEI0"
FT                   /protein_id="BAA79566.1"
FT                   /translation="MGVDLKMLAVALALSAILVGGGLYAASALAHGGGQGVGGMMGGSQ
FT                   PIASPGMGGMDGHDEPYEDDYGECPMMEYMHMGGMMGMPGPWQGGGWMQGGMGYVFMDQ
FT                   DSMEEALAEVEGVVVNALDRYNAIVVDTGDGTVRAKILPAYIDVENGYMVSGAWIFENI
FT                   EKAVEDRGEEVSVRLTIFRGGAWTAAVAIEIDGVGTFVFPALYDALN"
FT   CDS_pept        401639..401890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0597.1"
FT                   /old_locus_tag="APE0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0597.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79567"
FT                   /db_xref="GOA:Q9YEH9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEH9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79567.2"
FT                   /translation="MMGWGWGFFGGLWGLFWMLIFILILGAVIYAIIVLIRGLATGQQT
FT                   QQPVQQPSEKHLEQEIRSLKSEIEEIKRLLSERKREEK"
FT   tRNA            complement(402386..402462)
FT                   /locus_tag="APE_tRNA14"
FT                   /old_locus_tag="APEtRNA14"
FT                   /product="tRNA-Asn"
FT                   /anticodon="(pos:402426..402428,aa:Asn,seq:gtt)"
FT                   /note="codon recognized: AAC"
FT   CDS_pept        complement(402512..402964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0598"
FT                   /old_locus_tag="APE0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0598"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79568"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEH8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79568.1"
FT                   /translation="MQPPPAAGAHSYPSRGPPLPVEVVRLLGRGNFITRIFEVKSEESI
FT                   VVYGLGRPKEIRLPREVIEWMVDSYPITRILEEAINHYSFRRRLSHPGAIRSLILLLYA
FT                   RGRGEPPYKVARRYGIAPEQLYRMERGLKKDGMYEFVMNALSLASG"
FT   tRNA            complement(join(402990..403035,403073..403103))
FT                   /locus_tag="APE_tRNA15"
FT                   /old_locus_tag="APEtRNA15"
FT                   /product="tRNA-Trp"
FT                   /anticodon="(pos:403030..403032,aa:Trp,seq:cca)"
FT                   /note="codon recognized: TGG"
FT   CDS_pept        complement(403297..403824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0600"
FT                   /old_locus_tag="APE0600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0600"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79570"
FT                   /db_xref="GOA:Q9YEH6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEH6"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79570.1"
FT                   /translation="MEPLGGPDSSVLALLWGSPTRVLLVRKRCAPGSPWACDLALPGGG
FT                   VKRGEAPLEAAAREAWEEAWIPPAAVRPLASYCCEKTLTAGRRIHVVIAALQGPAEPRP
FT                   AEEEVDAAIWAPLHIASAKPGPVRHPYRGVIEGLSLPGGLILWGATLRILRRILAMLQE
FT                   GEVKLNTPQRHI"
FT   CDS_pept        complement(403788..404342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0601"
FT                   /old_locus_tag="APE0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0601"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79571"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEH5"
FT                   /protein_id="BAA79571.1"
FT                   /translation="MCSGGPVKSLVSPDGVHGERLLHGGPPTGECRTVVFDFDGVLAEG
FT                   FEGEVRPRPLGVALARRLIGRGYRVYIVSGRPEQERSLIARLLREWCIPLGGVRGIILR
FT                   RRGVGEVDHKLESIMEVEAREGCVGEVHDDNPYVLEALRRRVETLVLHTPRGCEVLKGK
FT                   PAEPCTAQAGWNPWEGQTPQC"
FT   CDS_pept        404463..404693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0601a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0601a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34739"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E62"
FT                   /protein_id="BAF34739.1"
FT                   /translation="MPKCIVCGRFFHEGQGIIIKIPGGLLEFHSSRCAQRFLRMLLEER
FT                   GSECVAREALELARGLRSSLERLEEGRAKAI"
FT   CDS_pept        404690..405439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0603"
FT                   /old_locus_tag="APE0603"
FT                   /product="molybdopterin converting factor"
FT                   /note="MoaD-MoaE fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0603"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79573"
FT                   /db_xref="GOA:Q9YEH3"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEH3"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79573.1"
FT                   /translation="MSSGWVELRLYTILKDAAGAETVRVPCPPGGVTLGEALREAARTS
FT                   GGLERALDAVSWEVYGLLDDGSRLALEDRVACGSRVHVIPPPSGGGVVVEARLLKPGEP
FT                   VDIASLVARAASASPANGAVAVFVGTVKSVVGGVRVEKLFYEAAWGVAERVIESILREE
FT                   AGANGLSAAIVYHYTGERRPGETTIVAVVAGASRGNVYPGLQRVVDRVKREAPIWKVEY
FT                   REGGVKAYILGDRVVTLVHPGRRPRAS"
FT   CDS_pept        complement(405399..405857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0604"
FT                   /old_locus_tag="APE0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0604"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79574"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEH2"
FT                   /protein_id="BAA79574.1"
FT                   /translation="MLAAAEQLPEDVLVGVVFYHEWSTPLLDPAPRAREALASFQEIPS
FT                   LPGRPEPVLGAAEAFHMAEDYRGALYKPLVLILWTAVARPRTPLTMGFNLLRGAGLEYV
FT                   LAVSKAKLPGWAGQVGVEEDGAVLYRAQVNVGRMLARMLEAGGPGARG"
FT   CDS_pept        complement(405916..406503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0605.1"
FT                   /old_locus_tag="APE0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0605.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79575"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEH1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79575.2"
FT                   /translation="MRRGGLNRGYDVVWAIDLSKSMARTAGGLGASKLKVSSGIIAMAS
FT                   SRILSRPGSRVGIVGFHDRAFPILPSTDNYRRVLDSLTLLRAVGEGSAGGDGIVESVKM
FT                   LRGSGRERHVVMVSDGGFNTGIPIPLATIYALNMGVRLHFIIVGGQPGDVVKRSVEEAA
FT                   SRTGGRVYIVAGEGDDMKAAVGVARAAGGSQA"
FT   CDS_pept        complement(406481..406948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0606.1"
FT                   /old_locus_tag="APE0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0606.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79576"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEH0"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79576.2"
FT                   /translation="MDALTAYTLYSTGLADLMAHLSSEGYVFEAPSAIESQLHLLDAWR
FT                   IRRGFRPVNGLALTDIKVPEEEPRDLLATPLEAAVLSYAAREGVVLLSDDYRLRVRARE
FT                   MGVEARSSLSLISMYVRSVGEPPDSLPEIVMSARAIPLLIPRSALEAWGVE"
FT   CDS_pept        complement(407392..411387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0607"
FT                   /old_locus_tag="APE0607"
FT                   /product="surface layer-associated protease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0607"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79577"
FT                   /db_xref="GOA:Q9YEG9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034041"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEG9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79577.1"
FT                   /translation="MHTPRISGLAVRLAAALLILIMLLPLAPSYTPSAAPPTPEYKAYV
FT                   DPVLLNPEGYDMPVDVAYTPELSSLIAKLREQRLASGLEPLREGQAKVTIIYLGGNPEE
FT                   VAGLTEGVIFGLNMGGKWVIEAWADRESVEALASLEGVAAILKSRSPVSSILREVELLE
FT                   KLQPEPGVEPTLYAAVDAIGASRVWEEFGVTGEGVKVAVVDTGVDYGHSDLGVESIARA
FT                   EDGTPLIFDADQLGFALTLSEAVKDEEGYVNVSTPVPFIDLFFMGYGEAEAGWLLYISP
FT                   DGTVAYYEFPIDRFFVGDIESAGGVFKFGLAVQTVFILYGSLGILNYSLPVLLADGDGD
FT                   GSYETVYADLSTAYYLFLKALSDTGMISGEPDPSLLDLSFADETPASYGSEVLARDFTG
FT                   DGVNDFSAGALAGWTYDWVGLLTGESVNLGWRLGFDYAGLVLPGLDPQGRWVSILYDTL
FT                   AHGTSVATVIASRGNVEFNLGYIETSLRGVAPGAKIAAGGSFLINVFVAQLFLSGFEPQ
FT                   DSPLNWVYTGEHQVDVINNSWGNSYIALRGFLTGADDYATIEDYIVSASGTVIVHAMGN
FT                   GGPGYGTATTPGAGSLIISVGASTLFDYRPFYGYLPSPGGDVISWSDRGPSQIGVAKPD
FT                   VVNIGSFAWAGVPVLTGLGNGSLAFDIFGGTSEATPMTSGSVALVISAYQQAFGAKPSP
FT                   GLVKAILKSTARDTGADAFTQGSGQVDVYRAVKAVLEGGVPIALSTSVYENVYSLLSGY
FT                   SYPFLAPNPVEDTQIYPGVLKPGETAVETLVLKTLSGEAEVSDVKAYTFHVVRKGLLEY
FT                   LDLENAYVILADGSTVPLQERLAGVGEDGSTLTLLLQGDERRIIVPMKQEYLQGLAKPL
FT                   EYENEIIVSFPYTIMDPGRTYGPSPGVPYLILGAEFHLGFDLDGDGVITLGETARVNYD
FT                   IRYANTLHVEIGNPESQAAEVAEWLTGRWGIEVSPEDAVPVLDLRILFNVYGLIGQQLE
FT                   LPLKLETEFLHRFPACGLSVSLSSTTVTPEGVEAEVAIQVPEDAAPGVYQYYIEIAYSD
FT                   GGKTLVPVSVPVAAVVDSETGVLDFGGFVEEAPYRQYAVSGKFDWSWRYESGDWRTFPV
FT                   VFEDPSVKAVVVAVEWQSPDTAIDVAVGGPGYNFLAADTEEDIAYLYGSVVAAKMAYHG
FT                   GALGRSGLVPYYETPSKTKSIVLAPVAEAGKPYWVVVRNSIIDASTVFPETFTVELRPV
FT                   RVTAEVLGELQEGEEVTVRFTITGTALISYAQVYTSVEGATVTPSTLGFGLTHVVEVTF
FT                   TYQGEEEVSIALLTPLARSYDIGFDYGPYKFAIFRVPGFFTATAPLS"
FT   CDS_pept        complement(411629..416281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0609.1"
FT                   /old_locus_tag="APE0609"
FT                   /product="surface layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0609.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79579"
FT                   /db_xref="GOA:Q9YEG7"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEG7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79579.2"
FT                   /translation="MRIVSIAIAALMVALFTLPTVLPIAQAAQDVIPAQTIEPGFDEPL
FT                   VIDLDQMQDMVALTIVGQGFQDASGLTFEIWRIVGERTSFGVYDFTTPIAVYGGDNQAR
FT                   LRYVLGEWVEDPSDLTPPTLVIDMEDITAETGETVTVGPYELRIKDEAGNVGRIEFTVA
FT                   DLVSGAPTITALNPYATVEDARMEIDHGLLSGDPPTDTIFDIDPMYEGYVLPIYRPGDE
FT                   VEFSVGNIPGTTERIYVYLDWVGSGNSVRISPGETGTLRLPKELPMGIHLLIAVIYYED
FT                   AGERHATLAFTPIYIIPKLFEAEPFVIEGDAGETISLDIRGLPFSTQVGNDIDGDGSLE
FT                   VGWLENPFSGTGNTFDLIIDGPVSTTERGSLSVTTVLEDDIEGQDRGSLDLYLYVRGGD
FT                   STIVWNHDVEPDLHVVTEIKFPAALVASRPDVPPDSFTYGDSGLVVYVDGDPLTSANSP
FT                   LEIPGCSDSIVEVVVFNTMARATVSIYLGPFLLGTVTTDSRGAAKLTVNLAEIGPLPDA
FT                   DATGDMDYAFTAVAVRGGFYDNINMDNEDGIFIDIVPTYFVDVGETAFYFEDGGIWAGN
FT                   GTQFIITICGVEPFETVTITEEIDLESSASTVVADSRGVAQYVHIAPDIENTGKDVTVI
FT                   AQDSDNDTSAYFSTVLEYKVPELLTFNTSYEIDSTALGTIKYSTDKPGNSLNSGTTDTL
FT                   EIDADNTGYVVPGLTYEVYIGDTVVEVDGQDIISNEPYPLDTVAPGEPGVYPLTIKAQG
FT                   FSFIEEGLYYLVVSDPLSLEPQIIQVYPMESEILAGPPGGVLFAAFNYTDEDSIEIRSP
FT                   TITTPGSTPASFDVIADTGVTVTLSGDEYVVGVDDNGAVMYTVENFQTPATTHTLHMQG
FT                   GLGGLFTFNIELVPHWKVTILNTDIDGDGVSEVAASGENVQVQVIAHGAKSGGLYKVVL
FT                   VKPGTEDPLVSLAGETFESAAFQASVDGTINATVTVAPELINVALASMFEAVVVDVQTG
FT                   QVVARSLNLAEVVPAIGSNAMLSTYILTPLTPLKLYVSFTPFSSLTDPVDDDPSATFAD
FT                   DTIVAVTVQVSVKTLAGATLFTTVGTAISYYDFVNNTFANPYDASTLSGAIFLVLIPNY
FT                   DKSLAGQYVKIVIDKIVVQTVENDSDLTNPTPEFHLVPDTIDYTLGVVRLGADGGVLSI
FT                   VDLSSVEEGISEVKSIVLAIQDDLTVIDTKLDSIEATVTEINEGVAILQTDLGNLQASV
FT                   DELTELLQQTGEEITMKLDEISGDLAEISNGVATIQGDVATILELLDAMNATLTTIQGD
FT                   VAEIKTTAGTILVSVQDLQTIVADSTDAVIKAVEDNVALVLDGQQLILESLDTLDAKIT
FT                   AVSDGVAEVQTILGDVSVSLEDLVEANATIEEVVVENNQLLATITTSMGTLTADMSTLK
FT                   DLIESGVNVKLDQVLEDLSTISDQNAQLAAQAEAIAQTLAAVQDDTAKITDIQSTLASV
FT                   AGDVASVKQDTSTISSKLDDANGKLDSISSKVDSVSSAVADIQEQLGQVGDTAESASGR
FT                   AQTWGIINAVLSLAVLGVAGYLVLQLTRRE"
FT   CDS_pept        complement(416585..418210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0614.1"
FT                   /old_locus_tag="APE0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0614.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79584"
FT                   /db_xref="GOA:Q9YEG2"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEG2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79584.2"
FT                   /translation="MLARRRRGLSEVYGALVAVAVAVAVAAALMSVGGRTAGLIAGAGE
FT                   AASQSIAAASNPLYMEAWVEAGALKVRFYSPGAPVESVVVLKPGEGVAARVELPEPAVE
FT                   GVVDAMEGYDCSPVILGVETVGGGLRLHPTPYTCPGSQEGGGGGLGAAVNIAGLWFSLA
FT                   GLGEAWVISVGAWEPIDAVFKVEIELDRSCSPRIAALGAEVWPDGSGGYGEERLGTLDT
FT                   GVGAVEVYGFALCTGDGLWAGVRLDPPGMMVLRGEAEASGTIAYPGKPRKAVEAVVYSD
FT                   GLETVSGRTEAWMVSPRYTNGATQAQGAFATATGIVALLHSSQPGEARASLEATITLTG
FT                   AAPLALSTHTTTLPHPTPARVTLLACRDQAPSLGIDALLNPPPIIGASIAGVTRTLEPG
FT                   ETLQASWTPGLEITIAYTPRETMGTPLKPLAIENQGADGRYTITLTPAPSPCGAPAKPL
FT                   LIIQDTPQGRTLAHLQVQGARLKVAPAEAARAGGYSTVLKAWIDPGKREIQIYGTPTQI
FT                   NPQQTYAAVKTGSPPMETDIIISQ"
FT   CDS_pept        complement(418295..419557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0618.1"
FT                   /old_locus_tag="APE0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0618.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79588"
FT                   /db_xref="GOA:Q9YEF8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEF8"
FT                   /protein_id="BAA79588.2"
FT                   /translation="MRLTSLLLALLVLSPTLLSTPSSGVGGGFTLDLVQAVDLPGGYIL
FT                   VDADVVEGSVAALLYTGDGFRLALLTGGFIEWSRPLQPPQGVEGFEPIGVDAAGGGLQV
FT                   YSRGRQGLSEVLAITVYTMDGSPREERLITLGEGFRAYSASLQGSTLLVAGSLYTGLDT
FT                   GWDAAAVQVDLIAGKPVSTAAYEEPGDQKAVDAAFLPGGALCLVSTAREEGGGGSLACT
FT                   AGEGEWWAVPLPQGLPAGARAWDGCIAWWSGGSGWSSAQPPPAAEPQPLPGLDRVYGVA
FT                   AAMHPEAGEIAVAGGSLDGSPAIAVYTGCPASGGDWWAFKLMEGQGAVAGVWTRGGEAA
FT                   VHIVSGGQQALAVYRIEAKTPGEGETTTAPTPPQDTQTQEPRGLAEDLLQSLSDRRLTA
FT                   VLAALALALGLAAAYTASRRG"
FT   CDS_pept        complement(419623..425475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0620.1"
FT                   /old_locus_tag="APE0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0620.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79590"
FT                   /db_xref="GOA:Q9YEF6"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEF6"
FT                   /protein_id="BAA79590.2"
FT                   /translation="MNIHASPWPIRLLPALAMLAILALAVSPPLYSAAPGESPQQALLV
FT                   GEELEWFYTRVYGLRGYSLPGGVAVQLSAYSEGRGLLVAAGSAPGLGSLIMGVDLESRR
FT                   LSWSQALVGDPVELAVDGSTGSWAAVGTSTGEVAVVSLDNPSVRADFYTASRLGVTSLL
FT                   VWSGGDSPRLVVVDGGGAAYFADPTEEGWVEFSPTGGGGVEKGFHSPPFSAVLGDKIVL
FT                   QGGRWSLGSTAYLVFGSLQNGSTLSNTADSYYEGLDARVSGLLFYRTPSGAILPATPQE
FT                   ILDSERGVLTRYTLYMASTPAEGLRILVQPSWSGLEGEAGYVDEETGLAVLPSEVLDAF
FT                   IPASDQTLVFIYTEETYLVDEQGNERLVSTVCYAAEETLDPPPGSSVDLDIVVMDLVSD
FT                   ADSLESCMDILGLEPGVRTLQPLLGMTLESSQAGFDYVADTWMAWLPMPEDLRGGGLEG
FT                   ATVAEVYTPVNPVFEDFSKLLLVGSPQGFLHIYYLDDNGYPASGKPAPQSIFLGGAPTE
FT                   VEIASGGGVIYVGTSSGHVYMLKYRPDTGLYTVSRSLSVDESPVTSILNLETHIIVASQ
FT                   QGLLQAVDVGRWEPLWRNLPGFQGVETGLDNPVIVSVTAEPAVIASLGGGSIYTFESPG
FT                   FDLNPIILDFRVVLETVGGAREVGPGDLGLGGGSRAAIRGPGGEVYAVDEEVWERGSIT
FT                   LYVPRGDYTIEVELPGLGKLYREVEVLQPLILDSIEVALREVVVEAVVPATPPSPEYRV
FT                   AYDLYSGPVGGVELTLAPSQAATEDLGYTPDPLPVATVTGDDGRATAILWSGVEYSVDG
FT                   SSEVVSRVEGSVAAWGLGPFTVEAVLSLYPLDIVVYDAEAYQAGVAFQVKPSSVEITAP
FT                   TGRSARVAEPGDSVRIPLPPGSYIIRVEAPGYSPAEAQAEVGRAASLVTVLMEPAYNEV
FT                   TVRAVLSDPTGLFGGSIKGARIAFTLEEPSLGYRVEVDTGEEGEAQVTLRSGVYRVEVE
FT                   HHILGKTVYSGVEILSPGPLEIPLPAGASSLSLRLIDGELGVDAPGGFTVTLTYLLTGE
FT                   SRSFVTRSSSFSLEAPEGLYRILVSSLEGYYEDTEASLSLERGAGESVTLSLKPVKIPL
FT                   LVEAVYNDPTGVAVGGVGDALVVATPLETPVEVASEVQTTDSQGRAVFLLRPGVYEITV
FT                   THPYTEGARLEIDLFKASRSGVQVKLGLKPIYGELEVALLDSDLGVELPSALLRITWHG
FT                   YSQSSQKTLQVEGGTALVRLPFGSYTLEAELPGYYRPSLYSLTLAQDRVFATITLDPVV
FT                   VEVEVNVYYSHSTAIIGSSKVDLPPSPAGLASVTLRPDDPVLEALGVDPVSVVADETGS
FT                   AVASVRAGSYIIEAAAGSSVSGSRAFIGEETTAVSISIKPKAYTVDLVGYDQDLGVERG
FT                   VIEGARAVLIAFNGVTLEEPLEFTLPERAVLPEGVYTLEVSAEGYPGSTVEAAISSPGT
FT                   VYIPIEPLKVDVAFTVSADVGGSRVPVLWGALYLDHASIEEERPFEVEISQGGGEARLR
FT                   PGVYRAEYRVSIAGVEVAVDAGSIVVPEEGGGVEVVLKPPLAAVKIAAVDKEFSVRLPE
FT                   FSVAYIYSGPFGELEGEVEGIGGEAVLQLPPGLATLEVRALGFKPASTTLEIWGDASLE
FT                   VEMEPIVFGVAIRLADPDGNPVEEEVELILRHTSLPLELRARGEGPILRLEGVRPGSYI
FT                   AEVKILEENTLLTDTQLRLTVTQEGALLPGVLTVEYRRFTVELWLLDALTGEPIGFPYI
FT                   VELERQAPEGGFGYSVETVVRGKALLSLPPGTYQARLTPEAGQSFYRVDTTFTFTVDEP
FT                   GKVELRISPIMYSATILVVDDRGTPQQGALVRVLSEEGVEVASGLTDASGVFTFQAPYG
FT                   LYILEAEKPGYRESTGTIQIPQSTTLTITLQPGPMVLLQRYGPIAVGFTGLALLAVGLY
FT                   RVRERIARRLLEEEEYF"
FT   CDS_pept        425604..425870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0620a"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0620a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34740"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E61"
FT                   /protein_id="BAF34740.1"
FT                   /translation="MRVRCVQEAIRRAYYDRDASRGLFQTFSWLVEEVGELSEALRKGD
FT                   KGSMAEEIADVIAWTISIANLVGVDVEEALRSKYGGELSGCEG"
FT   CDS_pept        complement(425867..426631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0621.1"
FT                   /old_locus_tag="APE0621"
FT                   /product="probable farnesylgeranylglyceryl phosphate
FT                   synthase"
FT                   /note="FGGPS"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0621.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79591"
FT                   /db_xref="GOA:Q9YEF5"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR010946"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEF5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79591.2"
FT                   /translation="MAVKRRRLLEKLLERRSRGRLHFTLIDPDKTGPGEAGEIAARAAE
FT                   AGSDAILVGGSIGVTFEETDGVVKAAKRSGLPVILFPGGHTNASRHADAVLFLTVMNSD
FT                   NPYYIVQAQILGAPLALKLGLEAIPTSYIIVGYGGAAGFVARARPIPYEKPELAALHAL
FT                   AGAMMGGRIIYLEAGSGAPKPVPPEAVAASRKLVDAAGYGGEVLLTVGGGVRTPEAARM
FT                   LAEAGADVLVTGTLAEESPGKLADVVEAFKSA"
FT   CDS_pept        complement(426579..426917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0623.1"
FT                   /old_locus_tag="APE0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0623.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79593"
FT                   /db_xref="InterPro:IPR007808"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEF3"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79593.2"
FT                   /translation="MGRRRRKRMRRQVRTVPQVYKRYFTCPRCGSLTLSITLTQAKDEE
FT                   GNVKAGVKRAVAVCGNCGLRCEMEVPEGLEKVDVYNLVSDAYFEGRGCGEVGGEEEEAS
FT                   GEAPGEEV"
FT   CDS_pept        427181..428431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="APE_0624.1"
FT                   /old_locus_tag="APE0624"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="AdoHcyase"
FT                   /note="S-adenosyl-L-homocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0624.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79594"
FT                   /db_xref="GOA:Q9YEF2"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEF2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79594.2"
FT                   /translation="MAQGFKVRDLSLAGEGRMQIEWAERHMPVLMRLRSSMGGDKPLSG
FT                   VRVAACLHVTKETAVLVETLRKWGAEVYLAPSNPLSTQDEVAAALAEAGIGVFAWRGMT
FT                   PEEYKWALSTVAGREPDIVIDDGADLHVLLHEEMRSVGEKVWGGTEETTTGVIRLRALE
FT                   REGRLLYPVIAVNDALTKFMFDNRYGTGQSTVDGVLRATNILIAGKTVVVAGYGWVGRG
FT                   IAARFRGMGAKVVVTEVDPVRALEAAMDGFTVTTMDEAASLGDVFITATGNINVIDARH
FT                   MEKMKDGAILANAGHFNVEINVAALEEMSVSKRRVRRYLDEYRLPDGRRLYLIGEGRLV
FT                   NLVAAEGHPSEVMDMSFSNQALAVLKIAGERGRLEKRVHRVERIQDEMVARLKLETMGV
FT                   RIDSLTEEQKLYLQKWK"
FT   tRNA            join(428497..428534,428573..428611)
FT                   /locus_tag="APE_tRNA16"
FT                   /old_locus_tag="APEtRNA16"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:428531..428533,aa:Met,seq:cat)"
FT                   /note="codon recognized: ATG"
FT   CDS_pept        428911..429201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0628.1"
FT                   /old_locus_tag="APE0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0628.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79598"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEE8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79598.2"
FT                   /translation="MASVRFEDLRVNGSVVCPRCRIPMYYASETVKEGGRHRITRFYVC
FT                   PSCKLKLVDERIVVIPSSSTVEVEVAGDRKTIYRQHVDRPRRQARGRAVRR"
FT   CDS_pept        429341..429961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0630"
FT                   /old_locus_tag="APE0630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0630"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79600"
FT                   /db_xref="GOA:Q9YEE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEE6"
FT                   /protein_id="BAA79600.1"
FT                   /translation="MRRLREMYLEYKRIVNVYPDTPSIARRMFVTNGFDGLLAAIGVNI
FT                   GGFSGGADPVVMVLSIMGGSLSMGVLSGVVGVYLSERAERLKELSRLEKKVSRSLRRSI
FT                   YWKAANIIPLYIALWSGVGVIAFPLISVLPYIAAAYGMLAIEEAFAASLAIALALAGGL
FT                   GLYLGVVSGESKLYSTLRGLMLAVGAIILVHIFKFAVAGPLPG"
FT   CDS_pept        complement(429927..431186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0632.1"
FT                   /old_locus_tag="APE0632"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0632.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79602"
FT                   /db_xref="GOA:Q9YEE4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEE4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79602.2"
FT                   /translation="MTASLNPGALEEAFGYSVDVLKRLISIPTVAPQGDHYGEAAELLA
FT                   RELESLGFETVVERVPSEYQREKCRHASDNPRFIVYGRRGEGPALHFNGHYDVVPGGPG
FT                   WSVTEPFKPVVKDGKLYGRGAIDMKGGIAAALGAFKALHLSGAWPQGLRVEAAFVPDEE
FT                   IGGECGTGYLVNGMGVTPEYVVLPEPSGLEKPWHGHRGILWMKVRVKGRTAHASTPWHG
FT                   RNAFLLASAIALDLQQALASMYAGRRSRHRIEPEESAKPTVSLGGEAGVTGGGKTNQVP
FT                   GEFYFTVDRRLIPEETVSQARDELLGVLTWLSVKHGAEVEAEEVISAEPAINEPGELYE
FT                   ALREAASQSGRSIGEPVVCPGGLDMWYYTVKGSKALAYGPRGELAHAPDEHIDLGELRF
FT                   LVETFARLPITLAVALQRRT"
FT   CDS_pept        431450..432202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0636"
FT                   /old_locus_tag="APE0636"
FT                   /product="putative metal dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0636"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79607"
FT                   /db_xref="GOA:Q9YED9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YED9"
FT                   /protein_id="BAA79607.1"
FT                   /translation="MSCAELYFLGTGAAVNPRRMQSSLLLDYMGVTVLVDASCGAANAL
FT                   EALGYPPESIGAVVVTHGHYDHVCGLGLLSFIKSFRGGPPLKLHSPPAAEGVVRSVVEA
FT                   GLRSSARGGVGYSILPLRPGGEAGFGGVVRVRGLRADHTVEALSLEIGLAGLGFILVSG
FT                   DTRPTEELEARAPRALATVHEATLPSGMAEKAAATGHSTVGEAVGVASKSGIGLLYHLT
FT                   PESEEEALRASRGTRVMVPQDLQAVKIC"
FT   CDS_pept        complement(432274..432666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speH"
FT                   /locus_tag="APE_0639.1"
FT                   /old_locus_tag="APE0639"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /EC_number="4.1.1.50"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0639.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79610"
FT                   /db_xref="GOA:Q9YED6"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YED6"
FT                   /protein_id="BAA79610.2"
FT                   /translation="MAQIPSSRTNGSGAQMRVFGLHVYGNFYECANTELLKSPEELEKV
FT                   VLEAAREGGMTVLDIKSWKIGEGVSVVAIILESHITVHTWPEYRFATVDVYSCGGHTNP
FT                   HRAFEVLAEALKPARVEKGVAERHLE"
FT   CDS_pept        432769..433542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0640"
FT                   /old_locus_tag="APE0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0640"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79611"
FT                   /db_xref="GOA:Q9YED5"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YED5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79611.1"
FT                   /translation="MSSGVGIVTRIQSVSPAISAVLLDHPGVYLRTVRGASAIYGGEYT
FT                   GMPGFRFTVGRIGDASLLIGLIPPYPQAVAEAVYELFILGIRNVITITRGARLGRRVEE
FT                   GERVVLAKAAIPLDGVSQRIAPPGTPLLASAELLRGLLAYAELGVLKGSVNPGTTVTMQ
FT                   SLRMAWSYDDAEEYIGLRDVRAADTVTAPLYALQYQFERLNALSVVVAERPLTPTPRPV
FT                   ETDARALERHDEREADLISKILIAAVETIKAVAGE"
FT   CDS_pept        complement(433555..434604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0641"
FT                   /old_locus_tag="APE0641"
FT                   /product="thioredoxin"
FT                   /note="ApTrx"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0641"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79612"
FT                   /db_xref="GOA:Q9YED4"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:3EMX"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YED4"
FT                   /protein_id="BAA79612.1"
FT                   /translation="MMVASTFVVVFQGFGLTAPQGGGSSPSGGGEEGGLEEPQGLFPTV
FT                   SYTLPLAGGDRLVYESTSTSASGTNVATNAVSIVEPGWPESSVEVQLLEAGDPVVTSTP
FT                   EKGVLTTTLLALPKEYLGMQEIVIPVYIPPGRSGLCMRLTLEAGEAGGYTYRGYANVGD
FT                   YTIAVKAVYRGDGILEAFEAGIVGGGLSIRYTQSLVEASVSGSDTMVSVEWECTADGFS
FT                   SNLSYVKEGLAVLEDGRLIYITPEEFRQLLQGDAILAVYSKTCPHCHRDWPQLIQASKE
FT                   VDVPIVMFIWGSLIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGATPWSLKV
FT                   EKAREIYGG"
FT   CDS_pept        434871..435854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0644.1"
FT                   /old_locus_tag="APE0644"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0644.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79615"
FT                   /db_xref="GOA:Q9YED1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040087"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YED1"
FT                   /protein_id="BAA79615.2"
FT                   /translation="MARGCDLCFPGRKAVVFVTGLCDDSCFYCPVSRAKLGRDVFYVNE
FT                   VPVASVEEAVAEVLRTGASGASLTGGDPLVALHRTLDVARALKSELGRGFHIHLYTSGR
FT                   RMTPEVARALWEAGVDEVRIHPTERSLLSRVGMVKRYTGMSVGVEMPIAPGLEELAIEA
FT                   VKTVEAVGGDFVNLNEMEIVEPNARALLARGYTESGERPFTVRGALEAVLRVLEWAAEN
FT                   SSVPVHFCPASFKDSIQTGNRLRSSAARDAYWYEEPTPHGTLTWGEVRGGSPPPGLGEE
FT                   RGGRIMLPPRADLLETVVRMYGGEAYIVEAHPTPSRTPIVSERRIA"
FT   CDS_pept        435875..436312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0648.1"
FT                   /old_locus_tag="APE0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0648.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79619"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEC7"
FT                   /protein_id="BAA79619.2"
FT                   /translation="MSGSSLDEAALLVEALQGAFDFAGVERFDVGGLDVTVLDAGFISG
FT                   RRVVIVVLPEGSKISIWSSRRAVAAGLAIGGGRDPLIVIYTRRGRIGKAGYLYLGYLAH
FT                   RHGFDVVVVNGGPGEVREVLEMLSKTGRIVVREDKLYPVRP"
FT   CDS_pept        complement(436309..438771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppsA"
FT                   /locus_tag="APE_0650.1"
FT                   /old_locus_tag="APE0650"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0650.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79621"
FT                   /db_xref="GOA:Q9YEC5"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEC5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79621.2"
FT                   /translation="MERRLILWLDEISKDLLPLVGGKAAGLGEMIKAGIPVPPGFVVTS
FT                   EAYRRFVFETGIAGFIKHILEETIVSGRPEEYEKASELIRSKFVRTPMPPYLRRAIVDA
FT                   YRKLGTLVGVEEPRVAVRSSATVEDLPEASFAGQQETYLNVKGEEEVVEKVKTAWASLW
FT                   TARALSYRDSLNIDHETALMAVVVQKMVSSRSSGVMFTIHPVTGEEDKIVIESIWGLGE
FT                   YIVGGKVTPDRFVVSKSDLEILEVRISRKDKALFYDPDLNENVEIKIPESGEELEDLRR
FT                   KHPAVAEVVEKYGIRPDAPSLSEKEVKELARLAIKVENHFARPMDIEWAIDFELSPPEN
FT                   ILLLQARPETVWSRKKEEAEAKPPEEEAVPEGEVLVRGVPASPGVASGRVKVALTVEEA
FT                   AKKMEKGDVLVTKMTDPDWVPYMKMASAIVTDEGGMTAHAAIVARELGIPAVVGTGDAT
FT                   KKLKDGMLVTVDGSRGVVYAGAVKTEEAREEEARPELGAAVAEVLSEVYPVTATKIYMN
FT                   LGHPEEIDRYKHLPFEGIGLMRIEFIISSWIGYHPMYLIEQGRGVYFIDKLAEGVAKVA
FT                   SAIYPRPVVVRFSDFKTNEYRRLKGGEKYETLDERNPMIGWRGVSRYIHPNYEPAFRLE
FT                   VRAIKKVREEWGLKNVWVMFPFVRTTWELERALKIMEEEGLSRGRDFKVWIMVEVPSTV
FT                   FLADEFAKMVDGFSIGSNDLTQLVLGVDRDSGFLAKMGYFDERDPAVLRSIEILIEKAH
FT                   SQGATVSICGQGPSVYPELVEFLVRRGIDSISVNPDAVVRVRRQVASIERRIMLERLEE
FT                   LGSRLSRL"
FT   CDS_pept        complement(438938..439117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="APE_0650a.1"
FT                   /old_locus_tag="APES028"
FT                   /product="preprotein translocase SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0650a.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79625"
FT                   /db_xref="GOA:Q9YEC1"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="InterPro:IPR023531"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEC1"
FT                   /protein_id="BAA79625.2"
FT                   /translation="MSVRRRRERRATPVTAAGLLSFYEEYEGKIKISPTIVVGAAILVS
FT                   AVVAAAHIFLPAVP"
FT   CDS_pept        complement(439311..440357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0654.1"
FT                   /old_locus_tag="APE0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0654.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79626"
FT                   /db_xref="GOA:Q9YEC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEC0"
FT                   /protein_id="BAA79626.2"
FT                   /translation="MSAREVFGRATNVLLTLIILVVIAYSVTITVEPRYALESDVVIVG
FT                   VDGDRLVYSMEPVFERGKGYILVRTPSPGYTLALEPVEGGVRVYVVEKRTYPLPLPGPA
FT                   WAVDKGVVPVEGLAPGCSLRGVEGSRVEGPAVVKSVLALALSRNDTILLNLKPDGEKPR
FT                   AEFEVPVKVGKRSFKGGVVEAELDLSRVSEVRAGQGKTAVVYMKASVRMVQGDLVFDCQ
FT                   GKSVSVSLAFVQLEPEPGVALEVLDTQEQLREDVILPSGSYECLATRNPVEPGKTVYTN
FT                   IFDMDNLSYLYTIDLGDATIGVNAGFAGFKTRVTVVSGLEEVKTVCILKSVSGDLLPIL
FT                   SSASFKTS"
FT   CDS_pept        complement(440385..441755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0656.1"
FT                   /old_locus_tag="APE0656"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0656.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79628"
FT                   /db_xref="GOA:Q9YEB8"
FT                   /db_xref="InterPro:IPR013696"
FT                   /db_xref="InterPro:IPR024913"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEB8"
FT                   /protein_id="BAA79628.2"
FT                   /translation="MNIGFDDVDFRGGGCTTHFAGLLLHTLARRGGYTLADYPILARLN
FT                   PGIPWKTRGNAAVVLRLWARGEDEALDAVETALQLMWDYTGGRPSEAGKGPGMAVLVGD
FT                   PYRPRLESLYKRALAGVLDRESAAGAVEKEGGRVYGGRGIIGAAASLAALGPAEDYTWE
FT                   LVAYRRPEAWGAARCVDWEAAVKVESTLPPCTFNNIDMAEGRVAAAPAGPDPVLAGFRG
FT                   DCPHLLPRYSEALCEEPHFWVLYRSNQHTDAPRGLERRIYPYSYVTVEAEVLGTPQTLP
FT                   GGHVVVRASTGEGEADLVFYREASPLNRVARLLAPGDSVEAMGSVRPYRPRGLWTVAVD
FT                   KLVVRRLAPVYERHSPLCPRCGARMESAGRGRGYRCPRCGYASREARPLETPVPRALQP
FT                   GVYTPREGRLRHLTAPPGRRPAGRRPPRPMKLEWAFSPGPSPPEPPGGVGESFSLQP"
FT   CDS_pept        complement(441794..442045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0656a"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0656a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34741"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E60"
FT                   /protein_id="BAF34741.1"
FT                   /translation="MPEALVAINVNVGKEDEVFNKLLEMPEVKEVFMVYGIYEIIALVE
FT                   APTMDQLRETITGKIRKVDGVKMTLTMVIVTRRVKNKG"
FT   CDS_pept        442140..442481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0661.1"
FT                   /old_locus_tag="APE0661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0661.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79633"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEB3"
FT                   /protein_id="BAA79633.2"
FT                   /translation="MSGEAGVRQCCLDPSTFSHREGDIARAMGLSGEDASRVRKYVEDL
FT                   LKQSPPPKVSEALERIWARDCGNLSLEQRIYATFILGVSIYGSMVQEYLIRSMSSREAK
FT                   GASGGRRSP"
FT   CDS_pept        442462..443769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="APE_0662.1"
FT                   /old_locus_tag="APE0662"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="HisRS"
FT                   /note="histidine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0662.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79634"
FT                   /db_xref="GOA:Q9YEB2"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEB2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79634.2"
FT                   /translation="MAGGRPRPPRGFRDFPPEVMILRKRLLSRLERVFESYGFDPLDTP
FT                   AVEYWETLSGKYGEEAESRLIWRFQDPWSGRWYALRYDLTVPLARFVASNPGLPMPFKR
FT                   YHIGKVWRHEEPQKGRYREFVQCDADIVGSPYPEADAEIVSLAVDSIDALGLPGFRVRV
FT                   NDRRLLAGVFEEELGFDNPLPIYRAIDKLDKIGVEGVRRELERLGLPGSTVERIMEIIS
FT                   WRGRPGEVLESVRRGYGSNEKVREALDHLEEMLSLADDKRVELDMSLVRGLDYYTGPIL
FT                   EVVLDEPRIGSVAGGGRYDGLVGMFAGRDIPATGVSIGIERIIDAGLELGVYSLDVKTV
FT                   AQVAVVVLDRRYYRYAWEAARILRRGGLNVRIDLSRASGQVQRRKASRLGIPVLAFVGA
FT                   KEAEGGFLTLYSAAKGERVAVPLGEAVKAVERLLPS"
FT   CDS_pept        complement(443766..444116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0663"
FT                   /old_locus_tag="APE0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0663"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79635"
FT                   /db_xref="GOA:Q9YEB1"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEB1"
FT                   /protein_id="BAA79635.1"
FT                   /translation="MRDACLEYLALEPDEVLGHSGRFVRLEPGGGQGVWVYLGESRDYI
FT                   LVEGLYCSCPSMAGSLVKGGWGCKHLRGLKAAVSSGRFRRVSVEPGEVRQVVLEVYSTG
FT                   LAVTVRRRLSAG"
FT   CDS_pept        complement(444124..444837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="APE_0665"
FT                   /old_locus_tag="APE0665"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="phosphoriboisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0665"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79637"
FT                   /db_xref="GOA:Q9YEA9"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEA9"
FT                   /protein_id="BAA79637.1"
FT                   /translation="MGGCDPMDEAARGALDLLGRIGGELGVLGVGTGRTVMRFLREASA
FT                   RGVEPGVAVPSSFETAVELAGLGWSVGDPRVYRGVNVYVDGADEAEPGRGYMVKGGGGA
FT                   LLGEKILSSRSKLNIFIVGEDRLVGRLGEKTPVPVEVEPGFVSMVLASLEELGLNPRVR
FT                   TSPGKRGPVVSDWGGVIVDLLTGPLEDPRGLESMLRNVPGVRETGLFLGLADYIVVGLS
FT                   SCGYRVLGPYRGRAV"
FT   misc_RNA        complement(445320..445649)
FT                   /locus_tag="APE_rnpRNA01"
FT                   /product="ribonuclease P RNA component"
FT   CDS_pept        445535..446722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priB"
FT                   /locus_tag="APE_0667"
FT                   /old_locus_tag="APE0667"
FT                   /product="putative DNA primase large subunit"
FT                   /EC_number="2.7.7.-"
FT                   /note="DNA primase 46 kDa subunit"
FT                   /note="p46"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0667"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79640"
FT                   /db_xref="GOA:Q9YEA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEA6"
FT                   /protein_id="BAA79640.1"
FT                   /translation="MPLPRVSPVPLAGPGRRGEGGVSSAPLAGGPWAAGRRRLPGLLII
FT                   FRRVFTVGFWVGGVLAKKYPFLLGLDRVLELVTGFRGEAARRVLAGDEDLVGLGFRRAV
FT                   AAVEGWLDYPFADTVEGEVASFYLGLAIAYRAGPAAVSRVVAGEYLRASRLLAGEPGEV
FT                   ASGILGGLGFPVERGGLSVPWVVDRRGVVMLPLGWRMGVDVFLRLSAADESSPELRLAN
FT                   QMLLSGSVYLSDARLRALASAASRLAIESRVSEAASLESEAVERYARHLAALAEGGLPF
FT                   IPEALPQCIKNVFAKAVGGERLGWLELYLALVFLARIRAGPDAVEELLTPSLGERVARL
FT                   LARVYSQAPPADHQLPPCEVLAASGVCRCRGSLLSEYRRSVRSLLGLPDRGAGRR"
FT   tRNA            446761..446848
FT                   /locus_tag="APE_tRNA17"
FT                   /old_locus_tag="APEtRNA17"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:446797..446799,aa:Leu,seq:caa)"
FT                   /note="codon recognized: TTG"
FT   CDS_pept        complement(446854..447528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tenA"
FT                   /locus_tag="APE_0669.1"
FT                   /old_locus_tag="APE0669"
FT                   /product="transcriptional activator TenA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0669.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79642"
FT                   /db_xref="GOA:Q9YEA4"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEA4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79642.2"
FT                   /translation="MGESLLSDRLKRDNMDLWSLLPSHPFVKALYSGSLPLDKFRFYAV
FT                   QDYNYLVGLVRSLSIAASKSWSFEVARLALSHASFLASTEMANYERLLGELGLSLSEVL
FT                   REEPAPTNEAYVNFMIATCSTGTALECMVSLLPCYWSYREIAIANERLLRENSVDLYRR
FT                   WASVYLSSEYGEAVEEYRRAVDRLWAEEGGVYSRLKRIFRKATRYEYMFWDMAWRMEKW
FT                   PV"
FT   CDS_pept        447602..448753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0671"
FT                   /old_locus_tag="APE0671"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0671"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79644"
FT                   /db_xref="GOA:Q9YEA2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YEA2"
FT                   /protein_id="BAA79644.1"
FT                   /translation="MDRGGVLRVAAAALPAYAYFYNVGSIGFWLPLHVRELGWPYTYIT
FT                   LIATWYFVAVTLATPLVGLLSDLTRRPGYILAGGMAVVAATSVAIPHVENPPLLMALRA
FT                   LQGLGLAVGLPIALGSLSLIQGVRRGVASTVIASGLGMSGGAFLSGLMVEYLGFPALFY
FT                   AAAVPAALSTLVALGWRPPPPPSGSPGLLAALRSMPWEVLVVMAGIAVRNTFASGVFSV
FT                   VSIIFNKIVGISYTATGVVLAINPAVQASVTTVFERIMRGRALLLYSTGLSGTALAFYL
FT                   YLTAGSALDLAAAQIALGAFYGATVVSGNTMIIALAPSEIRYTASSLYTFAFNIGWILG
FT                   TSIAGKVMDAAGVDAWIKLAIAGTLVSGLIPLTLLASPRARRI"
FT   CDS_pept        complement(448944..449870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="APE_0672.1"
FT                   /old_locus_tag="APE0672"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0672.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79645"
FT                   /db_xref="GOA:Q9YEA1"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:2D4A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEA1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79645.2"
FT                   /translation="MITILGAGKVGMATAVMLMMRGYDDLLLIARTPGKPQGEALDLAH
FT                   AAAELGVDIRISGSNSYEDMRGSDIVLVTAGIGRKPGMTREQLLEANANTMADLAEKIK
FT                   AYAKDAIVVITTNPVDAMTYVMYKKTGFPRERVIGFSGILDSARMAYYISQKLGVSFKS
FT                   VNAIVLGMHGQKMFPVPRLSSVGGVPLEHLMSKEEIEEVVSETVNAGAKITELRGYSSN
FT                   YGPAAGLVLTVEAIKRDSKRIYPYSLYLQGEYGYNDIVAEVPAVIGKSGIERIIELPLT
FT                   EDEKRKFDEAVQAVKKLVETLPPQLRE"
FT   CDS_pept        450010..452067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI"
FT                   /locus_tag="APE_0673.1"
FT                   /old_locus_tag="APE0673"
FT                   /product="V-type ATP synthase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0673.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79646"
FT                   /db_xref="GOA:Q9YEA0"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YEA0"
FT                   /protein_id="BAA79646.2"
FT                   /translation="MLLPRMLEEVVLAVPARDYDRVVAGLAVEGIFHVDSPPQGVKGEV
FT                   DRSYRALLTQASERSSRIRQYFDLAGVEPYRVSGVEIEVGGWGESWKRYLEKYSGVEKF
FT                   YSGLLEEYSEAEARLKELLDIEARIAPVAHLDVDIARLYRSGAFDFAVYYGSYSEGLES
FT                   RVGEIVSRVGGLAAVEASGGSVVVAVAVPKGALSKISPEILRLNLSIYTPPEGVPGSPR
FT                   EAMEYIRGEKARLGRRLVSIQEMASERLGELAEFYTVVTAFENIFKFLVSTLRRGETRI
FT                   VRGFVDVRDSGRLRSIVDRMTRGSYVLLSLGVRRGGEAPIPSKVDLPQFLKPFSRVVEL
FT                   YGYPEPNEIVPTVFLAITLPLTFALMFPDAGQGLLVLLFSLFYLRRVSRDWAYVIAVMG
FT                   GASVVSGLLAGEVFGPLVSKMLGLPELWYRLGLETPPYAMPTYAIDHGEEELVPVLVYR
FT                   ALNVSLFMGAFMLSFGTFLGVVNGVIKRDWVGLVESRLPRFLLFASITGPFLVYMDAGE
FT                   AGSVLRQALLELGGDSIAAKLVLAGSVLGLAWMLLAGPIIYMLEGHSPLAGLANSFLEA
FT                   YESLLMLVGNIPSFLRIMALALAHSSLMFVIYYLTVMIMQGGILADVVGALLYVGGNLA
FT                   VAAMEGLLAFAHASRLHFYEWFSKFYSGTGVPYTPIKVEGVRIKIAGQTF"
FT   CDS_pept        452083..453288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="APE_0674.1"
FT                   /old_locus_tag="APE0674"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="transaminase A"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0674.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79647"
FT                   /db_xref="GOA:Q9YE99"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE99"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79647.2"
FT                   /translation="MAGGYNRRVDLITGSPTRKIDAVRERLAREGRDVILLSTGQPGFL
FT                   PPTFLRERLAQALLDEGFKRLYSYTPTPGYADVREAIAEDLAALGGPRMEPDDILVTAG
FT                   GQEAMFATLSTILEPGDKVILMDPTYFGYRPIVEYLGGRVEWVRAPPSLGFQPDEERLK
FT                   EAFTRDVKAVVLVSPDNPTGRLLSTESAKLVADLAVDTGAWIVYDEAYKTLVFEGEHVY
FT                   LYKLAPDNTISINTFSKDPGFPGWRLGYLYGPGWIVGKIRLVSEELVYCPPSIAQVAAK
FT                   IYLEDREGRLRHLEYAREFLKTRMEAMAGALEEMLPEAVFARPGGSMFITVDLSSYLSK
FT                   ASITSEDLSVKLLDEESVATVPGRYFGPSGDTMLRLSFATETPERIREGIGRLARLLER
FT                   LA"
FT   CDS_pept        complement(453318..453668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0675.1"
FT                   /old_locus_tag="APE0675"
FT                   /product="tRNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0675.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79648"
FT                   /db_xref="GOA:Q9YE98"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE98"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79648.2"
FT                   /translation="MASGGEAGLIGIEDFAKVDLRVGRVVKAERLPHSKKLLKLIVDIG
FT                   GEERQVLAGIAKWYSPEELVGRLVIVVANLQPKRMAGEVSQGMVLAAPCGDSEKPVLLT
FT                   VSEPVEPGSRVC"
FT   CDS_pept        complement(453815..454639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="APE_0676"
FT                   /old_locus_tag="APE0676"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="ketopantoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0676"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79649"
FT                   /db_xref="GOA:Q9YE97"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YE97"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79649.1"
FT                   /translation="MPGDKVTARRILKMKGSRPIVAVTAYDYPTAWIADEAGVDVILVG
FT                   DSLGMVVLGYPSTLQVTLDDMVRHTAAVARAAKRPLIVADMPFGSYEPSSSAAVESAVA
FT                   LARVGAEAVKLEGGSEYADRVKAIVDAGIPVMGHLGLTPQRAMRIGGYRPRARGRDEAR
FT                   RLLLDAESLVEAGVFSIVLEFVSEEAAEMVTRRVPVPTICIGSGRRCDGQIIVFHDIVG
FT                   LSRHTPPFAKKYVDARRIMVEAVTRYAEDVRNGRFPGEEHVVHAKEPLEDIS"
FT   CDS_pept        complement(454661..455590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /locus_tag="APE_0677.1"
FT                   /old_locus_tag="APE0677"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KPA reductase"
FT                   /note="KPR"
FT                   /note="ketopantoate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0677.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79650"
FT                   /db_xref="GOA:Q9YE96"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE96"
FT                   /protein_id="BAA79650.2"
FT                   /translation="MGAYCIVGLGGVGSLLAYYVYRGTGDTPIAVVRRRSQAMRLQAGL
FT                   RLYGVVDAYVPLEPYVGTPPRGCRLSFISVKAYDAAAAVEAAAEFSEMVAVAGNGWGGY
FT                   EKALDLGVDAAAIVVESGVASLEPGLARVAGLGRLIVGSRGGVSGAAFESFEILRRGGA
FT                   PALLAGDIEAWRWLKAAANSAINLVTTILGSRNGFVVESREAWRLASRAASEVGLVASM
FT                   LGYSLPEDPVEYTRLVALQTYDNESSTLQDLRRCRRSEAPYIAGRVVEEASRLGVGAPT
FT                   VEALYSLLQALFALKCGSMERLNPTTPN"
FT   tRNA            complement(455651..455727)
FT                   /locus_tag="APE_tRNA18"
FT                   /old_locus_tag="APEtRNA18"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:455691..455693,aa:Ala,seq:ggc)"
FT                   /note="codon recognized: GCC"
FT   CDS_pept        455870..456316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0680.1"
FT                   /old_locus_tag="APE0680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0680.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79653"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE93"
FT                   /protein_id="BAA79653.2"
FT                   /translation="MPGAVHSLRGTVFWSETDAAQIAHFSTFFKICEWAEEDFFRRALG
FT                   DEAFHGVLESNVMFPRVRAECTYHYPLHVHDDFRVDIVDVVIGVKSITYTFKVWNETHS
FT                   TLSAECRLVTVAVDPRGFKSVEVPGYIRERLLEAGARRAESGGR"
FT   CDS_pept        456385..456681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0680a.1"
FT                   /old_locus_tag="APES031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0680a.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79655"
FT                   /db_xref="InterPro:IPR003831"
FT                   /db_xref="InterPro:IPR023129"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE91"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79655.2"
FT                   /translation="MPAPLRKVVLDVLKPIRGPSIIDVSREVAALPGIEGVNITVKEID
FT                   VETVTLTMTIEGSDIDYGSVEKKLEELGCIVHSIDQAVAGKKIVEQEEVEQGE"
FT   CDS_pept        complement(456708..457094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0681.1"
FT                   /old_locus_tag="APE0681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0681.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79656"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE90"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79656.2"
FT                   /translation="MKASIGPLRQVLKLMALAHNEEAGLVIGARRGDTVYAYILYRTDN
FT                   LKQSPEEFESDPWQVVQAHRAAEKLGLEVVGVYHTHTTCPPSPSGKDVEGMKRWPGVWL
FT                   IACPGEVKAWTLEGETPVEIELEE"
FT   CDS_pept        complement(457084..457605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0682.1"
FT                   /old_locus_tag="APE0682"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0682.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79657"
FT                   /db_xref="GOA:Q9YE89"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE89"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79657.2"
FT                   /translation="MLVGVISDTHDNLALARRAGEIFARERVEAVIHLGDYVAPFTLAE
FT                   LLGVVGGKAVFYGVFGNNDGERLGLSRVAGGFGASLLDPPATVSIGGRRLLLLHGFGSP
FT                   ENTVELVDALASSGRWDAVLYGHTHKARVERVGGSLVLNPGDGGGSLEKPSAAILDLES
FT                   MEARLVSLEG"
FT   CDS_pept        457695..457901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0682a.1"
FT                   /old_locus_tag="APES032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0682a.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79658"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE88"
FT                   /protein_id="BAA79658.2"
FT                   /translation="MEGLKNLVVEDLSKLWIEYDRNTDTLYINFGEGEPDESVLIGDNV
FT                   IANIREGRLISIIVTDFSRLAGL"
FT   CDS_pept        457930..458598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0683"
FT                   /old_locus_tag="APE0683"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0683"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79659"
FT                   /db_xref="GOA:Q9YE87"
FT                   /db_xref="InterPro:IPR006386"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE87"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79659.1"
FT                   /translation="MARGIKLVIFDVDGVLVEVKSSWGYIHRRLGVEEEAMKVKEMFER
FT                   GSIDYIEWMRLDTELWIRASGGRLHRSRLMEIVGEIPVRKEAFEAVRMLRRMGLRIGLV
FT                   SSGIDLLVRRVAAEIGADAWASNRLLFDKNGFLQPGGSPLVGVDKRGAVTRMAYELGAS
FT                   LEEVAYVGDSRWDASAMSIVGLPIAYNDGGELDGVARARVDSLLDVPRVVAEWGRARAR
FT                   "
FT   CDS_pept        458574..459086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0685"
FT                   /old_locus_tag="APE0685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0685"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79661"
FT                   /db_xref="GOA:Q9YE85"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="PDB:3AJV"
FT                   /db_xref="PDB:3P1Z"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE85"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79661.1"
FT                   /translation="MGKGEGEVAGCKAAARLGVEGVFVEECFDGSYCRNLERIGYLRKG
FT                   RLEPLEAAYQASRGMLCMGETRGWAAAVEVIAGLGLSLDTALVYFDLRRKGRKPLVGVR
FT                   RGTLVYEHGGRVYEVLVLSEGYPLKIGSLVEWSRGASMDNHSPIVAIVDRTGLITYYEA
FT                   RAVRSIQ"
FT   CDS_pept        459143..460255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnA"
FT                   /locus_tag="APE_0686"
FT                   /old_locus_tag="APE0686"
FT                   /product="putative methylthioribose-1-phosphate isomerase"
FT                   /EC_number="5.3.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0686"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79662"
FT                   /db_xref="GOA:Q9YE84"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YE84"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79662.1"
FT                   /translation="MRDIDPSLRREIESLERFLKVKPLYFDFDEGVFVWLDTRLIPFRE
FT                   VYRRTSDYRRVARAIVDMEIRGAPAIGVAAAYALALAAAEAASRGGEGFIEALSEARRE
FT                   IESTRPTAYNLFWATARVYGAVSEAFRRSGVDAAVRAGLEEATRIYVEDVRGNVEIGRV
FT                   GARLLESGDTVLTHCNTGALATAGFGTALGVIRYAWMEGKDIRVITTETRPVLQGARLN
FT                   VWELRKEGIPFKLVVDSAVGLIMSRGMVSKAIVGADRIVSTGHTANKIGTYMVAMAASR
FT                   HGVPFYVAAPASTFQPDAGPEAIVIEERSPDEVRGVISEAGYVRITLGDVEAYNPSFDV
FT                   TPPELITAFITDRGVIEPPFDVNIRRTLED"
FT   CDS_pept        complement(460283..461257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0688"
FT                   /old_locus_tag="APE0688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0688"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79664"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE82"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79664.1"
FT                   /translation="MSSIMGLHHITALSADPQANIYFYTKVLGLRLVKVSVNQDEPNVY
FT                   HFFYADYEGNPGSDLTFFPYPRLPRGVPGYGQAVRIIYTIHPDSVKYWIDRFKRFNVTL
FT                   LGLEENSEGVRINFVDWDGLGLSLQASDRPSYVDVKPWSGGGVPKEHFPRGFYSVVIMV
FT                   RDCHTSGYFLEDILGFEKADEGEEYAVYTIGGGGPGRVVELLCPREAAPGRLGAGTVHH
FT                   VAFAVKDLRELAVHREKLVKRGYNVTPVIDRKWFTSIYFREPGGVLYEIATIGPGFTVD
FT                   EPVERLGSRLVLPEWLEPYRGEIEASLPKVRLPSGSIVGGAEA"
FT   CDS_pept        461515..462813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0689.1"
FT                   /old_locus_tag="APE0689"
FT                   /product="isocitrate dehydrogenase [NADP]"
FT                   /EC_number="1.1.1.42"
FT                   /note="NADP-IDH"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0689.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79665"
FT                   /db_xref="GOA:Q9YE81"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="PDB:1TYO"
FT                   /db_xref="PDB:1V94"
FT                   /db_xref="PDB:1XGV"
FT                   /db_xref="PDB:1XKD"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE81"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79665.2"
FT                   /translation="MASPPCTTEELSPPPGGSLVEYSGGSLRVPDNPVVAFIRGDGVGP
FT                   EVVESALKVVDAAVKKVYGGSRRIVWWELLAGHLAREKCGELLPKATLEGIRLARVALK
FT                   GPLETPVGTGYRSLNVAIRQALDLYANIRPVRYYGQPAPHKYADRVDMVIFRENTEDVY
FT                   AGIEWPHDSPEAARIRRFLAEEFGISIREDAGIGVKPISRFATRRLMERALEWALRNGN
FT                   TVVTIMHKGNIMKYTEGAFMRWAYEVALEKFREHVVTEQEVQEKYGGVRPEGKILVNDR
FT                   IADNMLQQIITRPWDYQVIVAPNLNGDYISDAASALVGGIGMAAGMNMGDGIAVAEPVH
FT                   GTAPKYAGKDLINPSAEILSASLLIGEFMGWREVKSIVEYAIRKAVQSKKVTQDLARHM
FT                   PGVQPLRTSEYTETLIAYIDEADLNEVLAGKRG"
FT   CDS_pept        complement(462905..464341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0691"
FT                   /old_locus_tag="APE0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0691"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79667"
FT                   /db_xref="GOA:Q9YE79"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE79"
FT                   /protein_id="BAA79667.1"
FT                   /translation="MAARLSALKMRGRRLLHVRLHSLSDPLLLGAGAARLSRYSLLAML
FT                   SLTFLAAASLILWLSGYTPYWLPLLAGGAAAAAGLAPTLYRAVVGGMVEREVPLLLLYM
FT                   LPYSSIASNVADLLLASYHPSLRWARREVERLRLMVKSGLDPEAAARLLARTTPSKTLG
FT                   AMLREYIAAERLGLSRSRLTLYIIDYTMKAIKTQWDSYTRLAQSLGEINLTLVSTALLL
FT                   TPMAILVEPQAAAAAALLPAVASPALALFLAALKPPIGWPPGNTVLALTSYAAPAAMVA
FT                   AFALATPLHALAAGAALAVAVEAGYRLQSIRERRALESLGAAVAKARAGLDFSEDLANA
FT                   RQAAGPVVDVVISASTTAGRTGVSKAVEAVYNTILESRLLARRAKTVAVILGAASVAVP
FT                   AIAILLLKVIGEASASWQASQVLVPLDTLEATASLIMTVSPLIPVPAAVLQRPGAPSPL
FT                   YSLAAAALAYAAAGAPAPAL"
FT   CDS_pept        complement(464346..465761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0695.1"
FT                   /old_locus_tag="APE0695"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0695.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79671"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE75"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79671.2"
FT                   /translation="MIRRFFTAKQRQTPAKQDVELESGRGWAGLEEWRLVAKYSVGPVE
FT                   YYLYRDNSEGVRLTFKEPPEPGEAVVKEIIAGNIEPVGEGERYHAEKRMSGYGRLYPLI
FT                   IDGHIEEIAFEGPGRGVSVIHSLVPGRWIDVDLKLGEDEANSLALQLARKAGRSLSLAQ
FT                   PLAEGLTGEGHRVAVTFSREVSRFGSSFVIRKYPEKPVTMADLVASRVLTPLQAAYLWL
FT                   LVESQQFIVVSGPMGSGKTTLLQALAGLIPPFYRVITIEDTPEIRLYNRHWDSLVTRPP
FT                   LPGESMVEVDLEALLRFALRRRAEYIIVGEVRGREARLLAQAAASGHGSMTTMHGDTPE
FT                   GVILRLQLEPISLPPVFLSLIGAIVMLRRLPGYGGAVRRRVVSITEIEGGEAVDVFAWD
FT                   PKGDLVSPDNPRDIVESSFRLREAVSRIPDLITDLEAELSERAGLLEKLAGSPPEVFHK
FT                   ALARFYSERYGRV"
FT   CDS_pept        complement(465795..466223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0697"
FT                   /old_locus_tag="APE0697"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0697"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79673"
FT                   /db_xref="GOA:Q9YE73"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE73"
FT                   /protein_id="BAA79673.1"
FT                   /translation="MGGRSRRGLSPLVASIILIAFTIIGGFVVYEYFMSSSESVMAAGE
FT                   GVIVNANTVYVSNTEKLVYLSGVNGHSSSITITQVKYYMQDGTPQTVDLSQNGGTITVK
FT                   PGDKFTIDLLLPADAAAATLVYTTDAGETLSSPPVSLS"
FT   CDS_pept        466315..467247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dys"
FT                   /locus_tag="APE_0698.1"
FT                   /old_locus_tag="APE0698"
FT                   /product="deoxyhypusine synthase"
FT                   /EC_number="2.5.1.46"
FT                   /note="DHS"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0698.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79674"
FT                   /db_xref="GOA:Q9YE72"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="InterPro:IPR022899"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR036982"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YE72"
FT                   /protein_id="BAA79674.2"
FT                   /translation="MEEVRDCRLEEGLSVEGLVECYRDIHGFMAGHLAEAVEVLREGLE
FT                   ASSVRVLTFTGNLVATGLRGVLAQLIDGGLFNVVFTTAGALDHDIARFMGGKYLKGRFE
FT                   ADDTELHRRGVHRLGNVFIPVESYGPLVERFVRTLAEQAAGVRGEWGVYELLRLAGSLM
FT                   EGDRDSILAAAARRGVDVFVPGWPDGAFGTSLFMERQRGTSITVDYFRDMARLADIFFP
FT                   QEGEAAALIVGGGISKHHAIWWSQFRGGLDYAVYVTTAVEYDGSLSGAHPREAVSWGKI
FT                   KESSRRVVVYGDATITLPVIAYCLLHGCG"
FT   CDS_pept        complement(467244..467744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0700"
FT                   /old_locus_tag="APE0700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0700"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79676"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE70"
FT                   /protein_id="BAA79676.1"
FT                   /translation="MAGAYPVIPYKPRMEGESDQPLELQLVDLEKVEASGYMRVVHHAG
FT                   ERGFHIKLVLNEREAISLFVWNDKVFKCLNTLARSYGVIPIEEIEVDEEEGDRLIAEGS
FT                   YRLRRGVLELVFEKSYDTSIVSPGRCVYRLKLKGVREYISPKHGHSARPEYFLIASRAS
FT                   RGG"
FT   tRNA            complement(467835..467913)
FT                   /locus_tag="APE_tRNA19"
FT                   /old_locus_tag="APEtRNA19"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:467875..467877,aa:Gly,seq:gcc)"
FT                   /note="codon recognized: GGC"
FT   CDS_pept        468122..468535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0702.1"
FT                   /old_locus_tag="APE0702"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0702.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79678"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE68"
FT                   /protein_id="BAA79678.2"
FT                   /translation="MVSISSLKPHEEVEDDRLELLLDDIRRRRLVVKPILVDAKTLVIL
FT                   DGHHRFNALKILGARYAPAVLVDYDSPCVSVGSWREGVSVSKEEVRRRGVEGKLYPPRT
FT                   SRHRVCFEIPDVNAGLEELVGDGLGAGEHDGGL"
FT   CDS_pept        complement(468551..469720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="top6A"
FT                   /locus_tag="APE_0703.1"
FT                   /old_locus_tag="APE0703"
FT                   /product="type II DNA topoisomerase VI subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0703.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79679"
FT                   /db_xref="GOA:Q9YE67"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR004085"
FT                   /db_xref="InterPro:IPR013049"
FT                   /db_xref="InterPro:IPR034136"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YE67"
FT                   /protein_id="BAA79679.2"
FT                   /translation="MSGEMFGDEVDIKARLRAAEVMYKKFHRLISDVIKGRPPKLEIPK
FT                   RTLSNTIFDPERGILVIGEEKLEREFLNVGESRRFMQTLLMASIIYQSLIENEYPTIRD
FT                   LYYKGKHTIVYRDYSGRKREENTWDEQKESDSVIQDIEVYTGLFREDMLILSKEKGKVV
FT                   GNMRIRSGGDVIDLSKLGHGAYAIEPTPDLIEFLDVDAEFVLVVEKDAVFQQLHRAGFW
FT                   KKYKALLVTGSGQPDRATRRFVRRLHEELKLPVYIITDSDPYGWYIYSVYKVGSITLSY
FT                   ESERLATPKAKFLGVQMTDIFGYRGKKPYLSEAERKKFMIKATDKDIKRAKELLNYSWI
FT                   GKNRRWNVEIRLFLKHLVKLEIEAIASKGLKFFAYQYIPEKIETGDWID"
FT   CDS_pept        complement(469739..471445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="top6B"
FT                   /locus_tag="APE_0706.1"
FT                   /old_locus_tag="APE0706"
FT                   /product="type II DNA topoisomerase VI subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0706.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79682"
FT                   /db_xref="GOA:Q9YE64"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005734"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015320"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YE64"
FT                   /protein_id="BAA79682.2"
FT                   /translation="MSAVAKRTRRARARAEEAARPGSTGEKYREMSVAEFFAKNKELAG
FT                   FANPTRALYQTIRELVENSLDATDAKGILPWIHISIRQIEGSEGRGGRPRYTVTVEDNG
FT                   IGVPVTSMAMAFGKVLFSSKYVIRQTRGMYGLGVKAAILYGQMTAGTPVEVYSATKGSQ
FT                   YVYMMKLVIDVQRNEPRILERGEWNKRGSWHGTRVTLSLEGDWSRAKSKILEYIKRTAV
FT                   IAPYAEIILETPDGEIYYFPRSTRKLPKPPRESKPHPHGVDIEQLKSMLRSTRASTLRE
FT                   FLVKEFQSIGDKTAQDFLEKYGLDPDLKPRELLKKGRDKLLRRLADALMEYPFRAPKSD
FT                   YLSPIGSDIIEIGLRRMFNPEWVGAVSRSPKAYRGHPFIVEVGIAYGGGIEARSEPLLL
FT                   RYANKIPLLYEEREDVSYKVVSSINWRQYNVDFPAPLVVLVHIASTKVPYKGVGKESVS
FT                   DVPEIEAEIRNAVQEVARRLRLYLSRKAREEEAIRRSVTLAKYIPEVAVSLAYFLRPPS
FT                   KWQPPKPEEVKKIQEALIKIVARHIELPPVDGKTEDPEAIVRRIVESVELE"
FT   CDS_pept        471745..474039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0708.1"
FT                   /old_locus_tag="APE0708"
FT                   /product="aldehyde dehydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0708.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79684"
FT                   /db_xref="GOA:Q9YE62"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE62"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79684.2"
FT                   /translation="MHLSRWIGWRYVGRRVKRVEDYRLLTGRGRYVDDVRLEGMLYAAF
FT                   ARSEYPHAVVRKVDLSDALKAPGVVAAFSYSDLEGSLKPWTFDAPSSPMYPLARDRVRY
FT                   YGEPVAVVVASDPYQAADAVELVSVDYEPLEPVVDPLKAMEPGAPRVHDEAERNIAYSR
FT                   RLSCGDVEKAFREAAVVVEDTLWVARKYAASLEPRGVAASYDGSTLTVWVSTQTPHDHR
FT                   DELLEKIVPPPSDVRVIQPDVGGAFGAKIEVYPEEVVVPYLAMRLGRPVKWYPSRREDM
FT                   VATTHGRDIRAELALAASRDGRILGVRGRIIGDVGAYPLGIFLPLIAGRILPGPYDIRS
FT                   GDVEVLAVYTNKTPLAAYRGAGRPEGIFFMERMVDLLADELGMDPAELRLRNMVKPEAM
FT                   PYRNCFGWQYDSGDYPGTLKRGLKLLRLRELESWVEEERRKGRLLGLGYAFYVEITSGG
FT                   PFETAKVSLERGGTVSIVVGSTPTGQGDATGFAQIAADILGVGVERVRVRWGDTGLIGE
FT                   GVGTFGSRTITVGGGAVIEAVSELVERLRPKAAEMLGVDPGRVEYRPGEFYVVDSPEDF
FT                   VGLWDVVEQLYRELGEKAGEVLSAYAKYDPKKPVYPYGLHAAVVEIDPETGVPRVVEYR
FT                   ALDDVGRIVNPMLLEGQLVGGIVQGIGDTLYEEMVYTGDGYPATLSLSDYGVPTALEYP
FT                   EVVELHFQETPTHHPHGTRGVGEIGTIAAPPAVARAVEDAVRRYTGRGGFRVRRLPVKP
FT                   EDILAALAAEG"
FT   CDS_pept        474062..474271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0708a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0708a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34742"
FT                   /db_xref="GOA:Q05E59"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E59"
FT                   /protein_id="BAF34742.1"
FT                   /translation="MQARQSRRGFLRRLKTLVLAALVFVIAYRLALALAASILKGAIAA
FT                   AMLVSILAAAAVVIAVVMLLRRGR"
FT   CDS_pept        474277..475143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0710.1"
FT                   /old_locus_tag="APE0710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0710.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79686"
FT                   /db_xref="GOA:Q9YE60"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015254"
FT                   /db_xref="InterPro:IPR016544"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YE60"
FT                   /protein_id="BAA79686.2"
FT                   /translation="MAQRVRWERVERVAEAFSRLSIGEVLGFEEQVDPQYKLVSRLAGE
FT                   IGAGKAALSALLVGLASYRLAMRGEEWWLCFYRHMRSSLPRAEGLRGVLRAVEGFLTSC
FT                   SGAAIGREAKLRRVRRAASAAEVLGEVLDNPLVLVERPSEVLEALRVALGEKGFRKTTV
FT                   FSVKIAYYAVRPLAGRKPLTLDVPIPVDVRVACASISSEMVEAPSYREVVARPEAAQRA
FT                   WGRVARSSGIPVLHIDSILWVTGWAPRELPPGEAREAVAGILSRALDRGKAVLLASELV
FT                   RRPCPGG"
FT   CDS_pept        complement(475118..476245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="APE_0712.1"
FT                   /old_locus_tag="APE0712"
FT                   /product="O-succinylbenzoate synthase"
FT                   /EC_number="4.2.1.-"
FT                   /note="OSBS"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0712.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79688"
FT                   /db_xref="GOA:Q9YE58"
FT                   /db_xref="InterPro:IPR010197"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE58"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79688.2"
FT                   /translation="MEVVRLEVFEVWMPLVSEFRTSFGSTRLRPALLVRAVEKGGEEGW
FT                   GEVVAGEGPWYSSETVWTAWHVIEDYIARLLPSTIEHPREVGGRLSRIRGHNMAKAGVE
FT                   MALWDLKARMESKPLWSLIGGVKRDVSVGVSVGIQPSIEDLVRTVSRYLEEGYGRIKIK
FT                   IEPGWDLEPVEALRREFPDVPLQVDANAAYTFLDAPRLSRLDDYGLLMIEQPFHHDDLL
FT                   EHAHFQSMVRTPVCLDESVKSVRDAVAALKLGSARVINIKPGRVGGIASSLEIHDFWSL
FT                   KAHLPVWIGGMLETGVGRGHLVALGTLPGVRYPSDISASRRYYMEDIVDEPWELERGSV
FT                   IRARSRPGIGVEVDWGRLNKYVKKSRRLSLQGKAS"
FT   CDS_pept        476501..478012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="APE_0715.1"
FT                   /old_locus_tag="APE0715"
FT                   /product="Trk system potassium uptake protein TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0715.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79691"
FT                   /db_xref="GOA:Q9YE55"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE55"
FT                   /protein_id="BAA79691.2"
FT                   /translation="MPVRRRRQTLFTALQYLGLILMVTSLPFTASGLVGLLLWSGRSMA
FT                   EFRVASELLASGVVLVLVGLLLSRAPGGLLGKGDAVFITVATWLSVPLFSAALMSEILD
FT                   IPYVDALLETVAGWTTTGLSILTGAESSSGGYVPSVDEIPESVKLWRSMLQWVGGVGIV
FT                   VFTVAFLARPGISAAALYIAEGRFERLEASLKASAIRMTLVYMVYTLLGALIIYLSGMS
FT                   LSDAIQHSMTAISTAGFSTHADSVGFYKGDYAVYASTLLVSFLGALSFVDLDNIMRLRL
FT                   GRVLRSVEFRVIAGLTALSAAAAAAVWYIDPVMRSSYTLADTIYNSVSGYITVGFSTAS
FT                   LEGASDSYKLLIAALGLIGGSAFSTAGGIKVLRLAIALKTLDVETTRILKPSSYVPKNL
FT                   IGGRRLTEDMVKRSLAVIIAFATVEILLGLTAVALYSDIYPTVDIIFDVTSALANIGLS
FT                   TGVTSPEAPTGLKVILIAGMLLGRLEILPYIVAAKYLVESVRART"
FT   CDS_pept        478168..479115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0716.1"
FT                   /old_locus_tag="APE0716"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0716.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79692"
FT                   /db_xref="GOA:Q9YE54"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR031857"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE54"
FT                   /protein_id="BAA79692.2"
FT                   /translation="MNPRRPTPTGLKPAPSKPFSSMVIEKRDSGDGESEPSFKQDGGLI
FT                   VSETLASRFLEWLDLPEDSRQLRDYRNNLRLLIGKPLDCATLHEFASQSKRKYETASRL
FT                   LSFVASKRGLGLRQLAAELRECLGKKPRSGSDTYVPPDSSILEAARRLEGTRVYHVFLL
FT                   LVGSGARLSTVHWLLRQGLDSSRLVCLEDRGFCRYHVDYVKGEKLQWALYSPREFWERV
FT                   LEEPRLTLSYNRVQEQIAGAGVKAKHIRNWVYNKMLSLGMPEGVVEFIVGHKASSIGRR
FT                   HYMNMIVQADMWYTTYLPVIPKSLKLSCTTCYEG"
FT   CDS_pept        complement(479413..479799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0718"
FT                   /old_locus_tag="APE0718"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0718"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79694"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE52"
FT                   /protein_id="BAA79694.1"
FT                   /translation="MLTLNSLAPSERRTLILIYRYVYREGRTSRCFTYQGLRSWIHYAL
FT                   PKHERPEWHTVERAIRRLAELEVVRRLRRGRKVIFCPGKHWHQLLVEYRGVLSQAVKLE
FT                   EPYRSLLHYLPGHKTWDRMRNRGI"
FT   CDS_pept        complement(479786..480055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0718a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0718a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34743"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E58"
FT                   /protein_id="BAF34743.1"
FT                   /translation="MMMYCLPYEKPRLHERMGLTISEAVEIMDGIVDLAAKHGRWDLVL
FT                   AEIWSRLRGNPCKAMYAAFIAGVMSQTSSFYSMLLERRAEHADA"
FT   CDS_pept        complement(480059..480400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0720"
FT                   /old_locus_tag="APE0720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0720"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79696"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE50"
FT                   /protein_id="BAA79696.1"
FT                   /translation="MARSWVVAEAVALIEHYINVLIEIEKRLCPGSDACYSGYASIMAV
FT                   DREKRSEAAERLREARKILEDARLGLERELTRAVLKELAEEKARELLDAAKQRLDGNGK
FT                   LRVELESRG"
FT   CDS_pept        complement(480407..480652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0720a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0720a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34744"
FT                   /db_xref="GOA:Q05E57"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E57"
FT                   /protein_id="BAF34744.1"
FT                   /translation="MNWLDRLSVRELRALRFLREKPQGASLKEISDSLGIPPSSAHGLM
FT                   QKLLALNLVDKNGQGKYYLTKAGEQVLEKIGAIITG"
FT   CDS_pept        480774..481433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0722"
FT                   /old_locus_tag="APE0722"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0722"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79698"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE48"
FT                   /protein_id="BAA79698.1"
FT                   /translation="MALRKPIVSPTTASILILLLQRAQASSVELAVELGVYPSQVNAYL
FT                   HYYRKQGIVEKSGDVWRLTEDGLKYVQERYDYLTNVASAFGIKINKDESRRINLYSEIR
FT                   KVAVEWLNGHEDCLFIVDFLAFLYFERGKTYFEAGRGLADSLAEALEEYSSGGYVSPFR
FT                   VQECLAELSQRGVVYIWRGRKVRLAKQLIEAARRQAPAAPAASRPPGRPYPSGGRI"
FT   CDS_pept        complement(481345..481620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0722a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0722a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34745"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E56"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAF34745.1"
FT                   /translation="MFKRGGVEKFLLTFIRYNARELPQHKIIDFAGSGSFYQNVEHLKR
FT                   LGLIEETVCFSEEKGVRVKCVRLTDKGVQVVERLRELRELVFGRPL"
FT   CDS_pept        complement(481978..482151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0722b"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0722b"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34746"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E55"
FT                   /protein_id="BAF34746.1"
FT                   /translation="MSGCEREAILRLLVKLKREMNMRLAGWPEARKRALEAIELYEAEL
FT                   EELLAEEPTFGK"
FT   CDS_pept        complement(482257..482580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0722c"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0722c"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34747"
FT                   /db_xref="GOA:Q05E54"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E54"
FT                   /protein_id="BAF34747.1"
FT                   /translation="MERAVPALLFLTALYMPLTLLGMALGGDAVRAPLTLLGLPIALAT
FT                   GSGATGQAAAAVAMAAAALWVAIAPPGRRLRRAAIALAIIYGYLAVSLAFAFIIFSAVA
FT                   SGL"
FT   CDS_pept        complement(482633..484669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0725.1"
FT                   /old_locus_tag="APE0725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0725.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79701"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE45"
FT                   /protein_id="BAA79701.2"
FT                   /translation="MRVASLALVALLLAQAILYAVPVKASGLTLTDVQNAIDLGVQAVL
FT                   DAIRPVDVNGSTYYVMPDYPSPTIMVKYNGELYVPGSFLDPGDKYYKTELVGVTNNMVA
FT                   WRYYFNVDSDSDYDIVIYASLTNVDYNTDELLVYVDESEYQFDLALGTRGSYWYYGVTQ
FT                   GWSTTKTIYEGNDYKFHSARYVLRHSTIIAAWLLEDEGYSYYPRKMKELWDNVVDFNYD
FT                   VYAPLFGRSKTYPDSFFDYRYSTWLSWNGYEGHPWQVGDYLVNYPYKSRIYILDSLGLF
FT                   NEAISGWKEFPLHKLLRAMHLLDKYGASAQSEAEQLIAEAIIEGGWDGYGLKKANVYGL
FT                   SWSYKGYPVYLNATLLAALVKYYDTTGDRWVAGNDILYMADRLAGILVRLQWDYEHDTP
FT                   WGPVRLALFRGWWPAAYDIGSLVSKPSAWGILDTFTSGLDSVTGVLATLGYDVGEALRP
FT                   MPSEWPFAVVNSESTILAVQALKLYLDLAQRLGRSPLDPLQEPKALWSGELVETGGDST
FT                   GFLSLTSYYADYGVSGDGWLLRVAAFSDIYEDAWAYAYSKVRLNAPASGSYTLRILMMV
FT                   YYYGVDSYGNTGYVIAVVKLYDPSGNLIKHVEDTVVTIEKDLPPGMEGVKTLSFELNNL
FT                   QLGAGDYYVEVGLKALADASLLQVSGVFVKAYGVIESISLQPS"
FT   CDS_pept        complement(484760..485614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0727"
FT                   /old_locus_tag="APE0727"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0727"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79703"
FT                   /db_xref="GOA:Q9YE43"
FT                   /db_xref="InterPro:IPR026071"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE43"
FT                   /protein_id="BAA79703.1"
FT                   /translation="MPVIGLYDSRDVRVIDWQLQRMREAGIDCLFISWWGPGGFEDEAA
FT                   RRVFWRAQLYGLKAAIFVEPYLGNDPSRYDRAFWEQTLAYIKQNFIDRYPGAYLRLDGK
FT                   PLVLAFNPIGLAYDPRPDFPGYAIRIVGNDIDSAGYQDWDYWPDYDNALSGELRVRRDG
FT                   YVVLTPRYRDDHFRSPGLSIDYDLSQGWYERQWEWVLRNLDRVRLIAITSWNEYHENTF
FT                   IEPANDPAIKDPYYLYNSTKQYIAEAKARGQYWGLPEAAAAAGGALAAAIALARAVALA
FT                   RRI"
FT   CDS_pept        complement(485768..486436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0728"
FT                   /old_locus_tag="APE0728"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0728"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79704"
FT                   /db_xref="GOA:Q9YE42"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE42"
FT                   /protein_id="BAA79704.1"
FT                   /translation="MKLPLVAFAIAIALLVAPAAPALAAASVTIDATVVNQTYSFPVDP
FT                   PALITVAWSGLQVNIDSTTNAPATDNLALSFRDSAANEVLILFFKTSGSIVLQAPALGV
FT                   TTDVVLGDWSQLAGLTIKYRQDKLQIYDDAGNLLYELANINAPSLADIWAHTPDGTTQA
FT                   FTAGSITLSTEPDYSAMYDPSAITEAVAAVMPLLVVVAVFGVVIKILDRMVGIVGKLGR
FT                   "
FT   CDS_pept        complement(486458..486715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0728a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0728a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34748"
FT                   /db_xref="GOA:Q05E53"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E53"
FT                   /protein_id="BAF34748.1"
FT                   /translation="MIGRLRRALAGLRESIKHAATGFKARALAGVALALAVLGQTTTTD
FT                   MTSIINQMLPIIMSLFALLIPLIFLMKIFDVIERVFRSFT"
FT   CDS_pept        486804..487088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0728b"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0728b"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34749"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E52"
FT                   /protein_id="BAF34749.1"
FT                   /translation="MAALSPPKRVTLAFVHRETGSVHKKRQFEFRNEHRALIKMWAWVL
FT                   SYMEEYPPKSYRLVAYIHEGPYPEFIARKLREWNIRVIEPSGKGIEVYK"
FT   CDS_pept        complement(487176..487541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0730"
FT                   /old_locus_tag="APE0730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0730"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79706"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE40"
FT                   /protein_id="BAA79706.1"
FT                   /translation="MPVYQGPKSCYARKEGVYVRRARRPGIDTLAEAAAIAKLILRDLR
FT                   RGYTYENRSCKRIKMTKELAVRRLNFLKLLARRHRAPRMIVEATDFLVEYVLREWRLPR
FT                   GRVSRLARTMIVRRSRV"
FT   CDS_pept        complement(487552..488331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0730a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0730a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34750"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E51"
FT                   /protein_id="BAF34750.1"
FT                   /translation="MVTKLYKFNTKKQLLKWCEERGYSRRACEKAWTGPGYYYARSRNH
FT                   ISKHTPHLDKRRGKRVGRGAWRHTHDLAKTVRRLKNGVKQGAVKGAARLARKSGLKSRD
FT                   ARRALARAIAAKTLAQAVKRARRTWVRSPAIRRLAEDVWDWIPKRYKRGKDRVWTYITA
FT                   LALAKAIHDRAREKGVDPYQYDWKELIDWSLGYYYAKSLVKEALGKTLEEIAREDMARW
FT                   EHVRRMYEGSEWERMVVKELDDVARYELEHLDELIAP"
FT   CDS_pept        complement(488396..489571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0731"
FT                   /old_locus_tag="APE0731"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0731"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79708"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE38"
FT                   /protein_id="BAA79708.1"
FT                   /translation="MVSRGFLAGLLLLLLLPGLATDARALSAWGPGEPPGSYYKLHKAM
FT                   AILWWGCSFAGNVQIVFKAYDDDGWAIQVELREYSQDPVAAGTFDGIPYNLLHQAEYIP
FT                   TYDEAVIISLSQSLAADKYYALMIVSKPNGTPSLDEYYSIKITGEDTVPNLKMVRIWDS
FT                   NGDGSWEPYDPGSYPDPVFQIMADQIDCSSLVELKVLSVEPQESGVRVKFYLDGLQLGT
FT                   EFYAHIAADTNGDGVLDKVSRDAFLTFQGPGTYEIVVSELTYTPWHVRIVWTEWGTAYE
FT                   KVSEPRTETYIKGWGGVRTLVNVIMTVAPLAVQGTLVFLPYAGVLWSLWLLSSIFRTVE
FT                   ETSVEPVVDFFYRNYRILMGLFGIAKAALEASASLAAKAVELIKTLIDIVF"
FT   CDS_pept        489628..490233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0734"
FT                   /old_locus_tag="APE0734"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0734"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79711"
FT                   /db_xref="GOA:Q9YE35"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE35"
FT                   /protein_id="BAA79711.1"
FT                   /translation="MAAYGLPSVDELAVIALLLSIGLLAVIMGAIIGESLARASGVGGR
FT                   RPRPAVLLVKSPLEVELKDRVIETTRGDLIVRDGKELLVYRKPEGVKPVEVRLGRKTVK
FT                   AYLVDSKREVFYTIPEKVEARVGDGSVKLHPAMVDPKTLAEYIASKSLEKLLKPMRVGS
FT                   LEAVLYMALGGLMVLLMIFFVLPMLGYQVSIGGGGVFG"
FT   CDS_pept        490226..490624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0735.1"
FT                   /old_locus_tag="APE0735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0735.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79712"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE34"
FT                   /protein_id="BAA79712.2"
FT                   /translation="MASRRKGEGREEALPLVDPFEEDIDWEAAAEDEVTGAHKIAIQLL
FT                   AAPKGRAKLTLSDLSGGEVRAIATLRSIAQVIPDPVMLAYIDNYLLLKRSQKRQGVKEI
FT                   LAIVGAKGLRVLQAIRLGRTRTVREEEF"
FT   CDS_pept        490641..491384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0736"
FT                   /old_locus_tag="APE0736"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0736"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79713"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE33"
FT                   /protein_id="BAA79713.1"
FT                   /translation="MGGTPALEESKVKGNLARLLWKEMKEQDSSSVVVAFGRTGAGKSQ
FT                   YAMKVSHQFYGDWREVLRRLVFTPFDFQRAIEELDARDEWIPVLVWDDAGPWLELLKRN
FT                   SWHPLAIGVRGAFETARVRVGAILLTMTTDRSLPRSIAYDGYLYKFRAKLVKWGSQGDG
FT                   KPKSVARIQVRRERESEWGKFYWEEAYRDWVTLNVPVYGEYLELRKRFLRLYNKLIREA
FT                   PRLGPRQALEFIAREWERMRSGGEG"
FT   CDS_pept        491368..491670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0737"
FT                   /old_locus_tag="APE0737"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0737"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79714"
FT                   /db_xref="GOA:Q9YE32"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE32"
FT                   /protein_id="BAA79714.1"
FT                   /translation="MEARARLAWLLWLLLLQALDAATTVLAVRAGAVELNPLVRLLLES
FT                   PWALLTAKLLAGWAVWLLAGGSRAAMLLVSALYIQAVAANTLSLLKSWVVLSSMF"
FT   tRNA            complement(491919..492006)
FT                   /locus_tag="APE_tRNA20"
FT                   /old_locus_tag="APEtRNA20"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:491968..491970,aa:Leu,seq:taa)"
FT                   /note="codon recognized: TTA"
FT   CDS_pept        492098..493135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0739"
FT                   /old_locus_tag="APE0739"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0739"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79716"
FT                   /db_xref="GOA:Q9YE30"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE30"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79716.1"
FT                   /translation="MSQESCLGPAASRLLDEELAALAGDIDRENRVPDSLIEKAAAEGL
FT                   FDIGSVECLLQAVRRASRFSRGFAHVLLVHGSCRLAVGGEGRVYALGITEAGGGTDVRA
FT                   NIATRAEELGGGSYRLEGMKYFTSNALYASHFVVLALAGEEPALFLCEKQPRIRVEPLD
FT                   LSGFRGSGVGKVVFDGAVCERLTEPGVDGVRAALGYINVGRLGYASLALGIADRAIEVI
FT                   VEAASSKRVFGKRLLDYQGVQWRIASIAARRAALESLVVSALDGGGRVDPEKAAMAKVL
FT                   GGELALEAAWSAVQILGGRGLAMWGEAERMYRDAKVIDIGEGAKEVLMDYIAGRTVKKV
FT                   LGSRG"
FT   CDS_pept        complement(493143..493787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0741"
FT                   /old_locus_tag="APE0741"
FT                   /product="superoxide dismutase [Mn/Fe]"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0741"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79718"
FT                   /db_xref="GOA:Q9Y8H8"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="PDB:3AK1"
FT                   /db_xref="PDB:3AK2"
FT                   /db_xref="PDB:3AK3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y8H8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79718.1"
FT                   /translation="MVSFKRYELPPLPYNYNALEPYIIEEIMKLHHQKHHNTYVKGANA
FT                   ALEKIEKHLKGEIQIDVRAVMRDFSFNYAGHIMHTIFWPNMAPPGKGGGTPGGRVADLI
FT                   EKQFGGFEKFKALFSAAAKTVEGVGWGVLAFDPLTEELRILQVEKHNVLMTAGLVPILV
FT                   IDVWEHAYYLQYKNDRGSYVENWWNVVNWDDVEKRLEQALNNAKPLYLLPQ"
FT   CDS_pept        complement(493933..494244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0743"
FT                   /old_locus_tag="APE0743"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0743"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79720"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE27"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79720.1"
FT                   /translation="MSEQIITVIRVRLVGRRWRLSFLKALAEKLMEVLGGDTEVRINSF
FT                   IAQPSRLPITDVDIFSGSVEKLTDVRRAVEDVLQENNYPLGRLLTVKHVQVSMAAGEG"
FT   CDS_pept        494656..496827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0745.1"
FT                   /old_locus_tag="APE0745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0745.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79722"
FT                   /db_xref="GOA:Q9YE25"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR022443"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE25"
FT                   /protein_id="BAA79722.2"
FT                   /translation="MERLRTGVEGFDPLVAGGIPRGFFVAVVGEPGTGKTVFSIHFAYQ
FT                   GVREGDKVIYVTTEESRESVLKQAAMFGMDLGRAVDEGRAIVIDALLKSRSDEWSLEDV
FT                   SVESLVNKVLEAKRALGYGRARLVVDSMSAFWLDKPAMARKYSYMVKRVLYRWDFTTLL
FT                   VSQYAITTQSLPPWEPIVVRRGDEVRVTSIGEFVDSFLEGEGGLDIGGLGYYTLSLDTR
FT                   TLKPVWRRIRGVIKHRIRGRLLRVKASKGRSIDLTGSHSIYRISRGGGLEVVGSSDLRP
FT                   GDSLVTPASVELPESAPSSINAARELWSRGVEGIFVVGLPGEAAGYRGVERSRGYDGGH
FT                   AIPLETLVERYGDSVWSLVSGAKLAVSRGAAGDHPVPATIPLDTGFYLLLGFIVSAGSV
FT                   DVEGGHVTVTLGPGREGYVGDVVEAVNSTAPGAGVRISSGARGMEVTIRSRVLSELLAR
FT                   VFGAGPGPNRDIPSIVFRAPKPMKRVFLKGLYAGGGVFDRSSGSLIYATDSRSLLNGLA
FT                   LLLLNVGAGGYRIDSGDSGRALALIVENAGRLDAIGEVLEHLGFHGGREAVQGVGALER
FT                   ATAGLAGQATVAVQRPATRGGPGVDVAGVTGLEHLEASTEFVYDLSVEGDENFFAGLGW
FT                   ILVHNSAFGWGLEHVADGIIRFRRRIVGGALRRYVVVEKMRQTPHDLRVHRVEIEDGRG
FT                   MRIAGPLEARPEDLRMPEDLRRRLKGGGP"
FT   CDS_pept        496894..497982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0748.1"
FT                   /old_locus_tag="APE0748"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0748.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79725"
FT                   /db_xref="GOA:Q9YE22"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE22"
FT                   /protein_id="BAA79725.2"
FT                   /translation="MAGVCPSCGRTLEGSGVRRLCPDCYVERYGVARIPEAVKFVYCRD
FT                   CGAYRYQGGWNEGLESVEDTLREYLHMVLTVRMKPTEAVEEAWVESIELVQAFAGPGVY
FT                   TALVTVAGRAGGQSLVERKIITVEASQALCPRCTARSTGRGFEAEVKVRSTAGSLGRDV
FT                   KTGIARVLRRSRSIAGFVVKVDENREGLDIYLTDQTAARMLAGKLRSEFSAEVKESYKL
FT                   VGRQPSGRRKGRLTISVRIPEYRPGELISVEGRPHLYLGRSGRGLVTIDLDTGRERVVD
FT                   TSRTGVLAGVKRYEPGARLRRMMLLSSSGDSMVFLDVDKGMQEVVDAPRGSVRPFVESM
FT                   EPGRVYEVFIHGGRIYVLRETG"
FT   CDS_pept        498000..498335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0748a"
FT                   /product="translation initiation factor 1A"
FT                   /note="aIF-1A"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0748a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34751"
FT                   /db_xref="GOA:P57676"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57676"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAF34751.1"
FT                   /translation="MARGRGRHERRGEMPLPSEDEGTMLCIVQRVVGAGFLEVLCTDGE
FT                   VYMARIPGKMRRRVWMREGDVVLFLPWGTADKKGEVVYRYLRDEVRKLIDMNLLPEELV
FT                   EEVAGAE"
FT   CDS_pept        498332..499132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0751"
FT                   /old_locus_tag="APE0751"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0751"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79728"
FT                   /db_xref="GOA:Q9YE19"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE19"
FT                   /protein_id="BAA79728.1"
FT                   /translation="MRRRARWLRREREEEERVKDRDMFKIVDEVFDSITLSHLYRLYSR
FT                   KVLRELKGSISSGKESKVYWGVAWDRSDVAVKIYLSFTSDFRKSIRKYIVGDPRFEDIP
FT                   AGNIRRLIYEWARKEYRNLRRMRESGVRVPRPVAVEANIIVMEFLGEKGYRAPTLAEAV
FT                   EELDRGEAEAIAAEVLRQAEAIVCRARLVHADLSEYNILVWRGEPWIIDVSQAVPHSHP
FT                   NAEEFLERDVENLHRFLTGKMGFEFDFDAYLSRLKSCIHRGARG"
FT   CDS_pept        499129..499716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0754.1"
FT                   /old_locus_tag="APE0754"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0754.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79731"
FT                   /db_xref="GOA:Q9YE16"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR019964"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR039912"
FT                   /db_xref="PDB:1TUA"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE16"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79731.2"
FT                   /translation="MSGEQVKPRIYVKVKPERLGAVIGPRGEVKAEIMRRTGTVITVDT
FT                   ENSMVIVEPEAEGIPPVNLMKAAEVVKAISLGFPPEKAFRLLEEDQILVVVDLKQVVGD
FT                   SQNHLKRIKGRIIGEGGRARRTIEEMTDTYINVGEYEVAIIGDYERAMAAKQAIEMLAE
FT                   GRMHSTVYRHLERIMREIKRRERLKMWAREEL"
FT   CDS_pept        499774..500649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0756.1"
FT                   /old_locus_tag="APE0756"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0756.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79733"
FT                   /db_xref="GOA:Q9YE14"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE14"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79733.2"
FT                   /translation="MVERVAVVGAGRMGSGAARRLASRGYRVVVWSRSWEKAERLAREA
FT                   GLEAARSLVDALAESEAAIAFVSDDDALLNVVSQVRRSDGLIFVNSATTTPRASVSAAR
FT                   YLEGLGVQYVEAPVIGGPGALERGEAIVLAAAPRSALAPAVPLLSELGELVKVGESYGM
FT                   AAAMKLAFNNLLLTTLVGLGESLLILDAYGVDKTLFSSILERTVFSGLAGKYFERAVSK
FT                   PKPTFTVSLAEKDARYAFQALADRGYPRLVSQAVSNVYAMLSHMGFGDEDYVGVYRLLK
FT                   KAGAGGGEES"
FT   CDS_pept        500636..501706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0759.1"
FT                   /old_locus_tag="APE0759"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0759.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79736"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE11"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79736.2"
FT                   /translation="MRSLSVVGLGPAGAGAAAAASRLGVKPVIYEAMEKPGLKPCGRGL
FT                   PIVDGGLPVSIPRDSILRRIRGARMYVDGEFLFEMKGFLDGYIVDKTVMLEAIAVEAGG
FT                   EIHYRAKYKPGSSTVRLPGGGEARVEQGVFAGGHPYYGGAKIAAVQWIMKTGPRSDPVG
FT                   DMLEIHFDTELLGYAYIFPKEEGFIEVGIGGFATPRELRERLESFIHKRSDLRELERVK
FT                   LEGARIAIGGLDLGVVDGLVKAGEAAGFVLPLTGEGIRPSLISGYEAASALIEGGSPLE
FT                   KLRSLPIARAVSMQKRILDLVAGMSVEERRSLLKSLTPRAHAEIALGMFRKHILLKELA
FT                   RSPRALSLLGLVTRLI"
FT   CDS_pept        502217..502624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0760.1"
FT                   /old_locus_tag="APE0760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0760.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79737"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE10"
FT                   /protein_id="BAA79737.2"
FT                   /translation="MREKAWLWLRAARRDLGRAEYSLKVGDRAAATFWSQQAAEKALKG
FT                   LLLAFKGDYPKTHSIRRLLEDLGLDLGLSEGELEDAFELTQYYYLSRYPDVVEELPDEV
FT                   IGRRSAERAVNAARRIVEAAERALEEASKGD"
FT   CDS_pept        502674..502949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0761.1"
FT                   /old_locus_tag="APE0761"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0761.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79738"
FT                   /db_xref="GOA:Q9YE09"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE09"
FT                   /protein_id="BAA79738.2"
FT                   /translation="MDEVKLFGSFARGDYAEGSDLDLVVVSRDWEGVNYVERLSLLYKL
FT                   WDKPLDANFIPLTPEELAERLEASVTLKDASKYWITIYRRDRRREQ"
FT   repeat_region   complement(503006..503314)
FT                   /rpt_type=DISPERSED
FT                   /note="APE_repC03"
FT                   /note="type C"
FT   CDS_pept        complement(503018..503269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0762.1"
FT                   /old_locus_tag="APE0762"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0762.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79739"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE08"
FT                   /protein_id="BAA79739.2"
FT                   /translation="MSGTAGFITVSPGPPTEAPGGFPREPRGHRVRFINLKPYKFYWGF
FT                   PNMSYITKRYGLDRHSTSAYLIALRGIERYSQIQKVTA"
FT   CDS_pept        503669..504637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0763.1"
FT                   /old_locus_tag="APE0763"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0763.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79741"
FT                   /db_xref="GOA:Q9YE06"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YE06"
FT                   /protein_id="BAA79741.2"
FT                   /translation="MARIVVVGGLGYVGVNIAPALADLGELVVVYRGVVGGFRRVIASR
FT                   LESLGARLVRIDAPMTADELERLGGDVYIHLAGKISGGYRVQWESHVGLLEAIVEAAGR
FT                   IGSRVVYTSSVLAYGRLEDLPPGSLVYEEDEHLSGRRWWRSYHARTKAEGERLLVSSSR
FT                   RLGGRFSIVRPGLVVGSHAYHREWSMLFRLSRLGLYPRLDYTVNYVSSKALREVYRRAV
FT                   TGGLDGKWVHAVSYHAPYREAAMLVCTRLRGGLCRGLPVKPLFSLAGRLAPPSTALSAS
FT                   WEGVSNGYIFKSRYGVPVDGSLEEAFSELLEWLAGGGPSAS"
FT   CDS_pept        complement(504608..505327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0766"
FT                   /old_locus_tag="APE0766"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0766"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79744"
FT                   /db_xref="GOA:Q9YE03"
FT                   /db_xref="InterPro:IPR006382"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YE03"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79744.1"
FT                   /translation="MQGLAGSVRVAALDIDGTLTERRGAARLDGCSIAVARLLNDLGVT
FT                   SILMTGNSLPVARGVAVYLGLEGPVVAENGCVAVVGGERVHICSGRPPEGLVKRIMELG
FT                   FKPSWQNEYRYHEYSLIPVKAAPGIVERASAIAEEEGYRAIWSGYALHIQPPGGGKARG
FT                   VGEVLARIGAGWSEVLAIGDGENDVEVLARAGYSGAPGDAAEQAKRAAKIVARSPGARG
FT                   TLEIIQRVLGGARAPAC"
FT   CDS_pept        505445..506389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="APE_0767.1"
FT                   /old_locus_tag="APE0767"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="SPDSY"
FT                   /note="putrescine aminopropyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0767.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79745"
FT                   /db_xref="GOA:Q9YE02"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YE02"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79745.2"
FT                   /translation="MAGGSEKSVFLKWSWFLEWLTPDRATLKHIEDVIFQGRSRFQEIA
FT                   VVRVSGEGKVLVLDGKTQSSESDEFMYHEALVHPAMILHGSPRKVLILGGGEGATLREV
FT                   LKHRSVEKAVMVDIDETVVNVAREHLREWHRGAFDDPRAEVVIDDAWNYVASKAETGFD
FT                   VVIADLVDPLEAGPATRLYSEEYYRMVKDVMNPGGVFVTQAVSISHLTEYHAIIRNTVA
FT                   RVFKHVESYGVYVPSFDSMWGFVVASDDKDPRILGDRGFFETRLSHQLQGAELRFLDYA
FT                   SMLHMLNIPKMYREAIAREKRYATLDNQVFLPA"
FT   CDS_pept        506419..507420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0768.1"
FT                   /old_locus_tag="APE0768"
FT                   /product="bifunctional phosphoglucose / phosphomannose
FT                   isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0768.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79746"
FT                   /db_xref="GOA:Q9YE01"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR011857"
FT                   /db_xref="InterPro:IPR019490"
FT                   /db_xref="InterPro:IPR035484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YE01"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79746.2"
FT                   /translation="MEDLYLSWPKWFSEALARYSSLEGALEGVEEIYYCGMGGSGAAGD
FT                   YIEALLSIYAPQGPEFRVVKDFRPPRPPRHRGYGLVLASYSGNTLETVECGSLLSPAAG
FT                   RVVAVTSGGRLLEMAKERGWLVARLPGGILPRVSFPWMLAASTAMLSGALGVDLEALKR
FT                   LAGGLDTQGLKGEAERLAGFISRYRIASLVTCGPGIPLAVRLKNELAENAKMPSRLEIY
FT                   PESSHNDIVALEAAEGLYGAVFIWIEHEGSLCPAVLDVVEGIYREYGVDTISIESSARG
FT                   GPNATVAEYLSRTLVFGLASVRLALMRGFNPEETPPIDKYKRRLGEALRSQA"
FT   CDS_pept        507521..508675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0771.1"
FT                   /old_locus_tag="APE0771"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0771.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79749"
FT                   /db_xref="GOA:Q9YDZ8"
FT                   /db_xref="InterPro:IPR007254"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDZ8"
FT                   /protein_id="BAA79749.2"
FT                   /translation="MASAVSGQRQVGSELEEKAGRALVIVVDLDDDVGETLGESVIVGY
FT                   DRVLEAAVRFAIERPDDADANTMFAGLRLYRKLKGEYGDVEIAVVGGSRRLGVEAQRNL
FT                   RERVASIVSEMGPDVDIYIVGDGGEEALASHILRGVGRVAGIESVIVSQHLGIESNYML
FT                   IAKYLRKAVTDPHYSTLVLGVPGLVISVAALLMLAGFFSLALKISLLIVGLAMVVYGFK
FT                   LDDTVRTSLQSFVEELREAPHIRLGGLAVMTLLLLLGVSLTYISYVSEGATSAIVSLLT
FT                   YTIPLSMAGVMMYIIISRIIVGATEGRVDLSKNIAMLSMLGFTALAFYDLGASLRLVLE
FT                   SGQPVIANVIDAVASSRFIQYIIVGTGLASLTELISRALREARE"
FT   CDS_pept        508748..509086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0772"
FT                   /old_locus_tag="APE0772"
FT                   /product="signal recognition particle 19 kDa protein"
FT                   /note="SRP19"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0772"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79750"
FT                   /db_xref="GOA:Q9YDZ7"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="InterPro:IPR022938"
FT                   /db_xref="InterPro:IPR036521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDZ7"
FT                   /protein_id="BAA79750.1"
FT                   /translation="MVFLREKEGPSGGSGRRIILWPAYFDSTLPRRLGRRVPRDMGVPS
FT                   PKPEDVAEAARRAGFEAVVEESSYPRLWWRVRRRIVVLAPEDVSKTDIIKAVATELRKI
FT                   AAARRKRS"
FT   CDS_pept        509317..509676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0773.1"
FT                   /old_locus_tag="APE0773"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0773.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79751"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDZ6"
FT                   /protein_id="BAA79751.2"
FT                   /translation="MDNPVCGEACGAVMSMLESMGFTVSVSRESYATLTGGVARRDVVR
FT                   GIRTSPQPAKVSVYLRGDGSIGKVHIFVRGSLGGSRLEALEEAGASVDEVDGDTIITVK
FT                   KLRLEDLGGILAIVF"
FT   CDS_pept        509660..510844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0774.1"
FT                   /old_locus_tag="APE0774"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0774.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79752"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDZ5"
FT                   /protein_id="BAA79752.2"
FT                   /translation="MPLCFDGVLAPRGGEVLQRSGPLIYSTPGSAPLLIDLRGPKPPCG
FT                   VKLVCGPYVYGEGLAAEFLGDPPSFFKGDYNTLGPPEGLEDADAGRGGFVENAVFNPFS
FT                   WRPVMPIPASMPGCVETEFGPYSPPNLDPASSSEAGLKCAQPRGGGGEGSVDAGGAVLT
FT                   LNWVRRIGGLTVGGSEGFTAVASGDAALIIPHGSSVSVTLRTPAASYRVGMLYGLAFEE
FT                   PVLGGEYFGNLIVLSGPGLEVSIASPAGARVSLAPGVVEVYTREAFALVGEGVSRGFKA
FT                   LVELLYSYSLLDRAPARIGNFYSVKSFAYITRVDGRAIEFKAAALKGAGGGTVYLNPPF
FT                   RSRLVKVETLLGETEMPGGPRVSVPVAECGCARARIHASGGLLMRMVERRGPGL"
FT   CDS_pept        complement(510839..511570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0775"
FT                   /old_locus_tag="APE0775"
FT                   /product="protein-disulfide oxidoreductase"
FT                   /note="thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0775"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79753"
FT                   /db_xref="InterPro:IPR011903"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:2HLS"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDZ4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79753.1"
FT                   /translation="MARYYVLDLSEDFRRELRETLAEMVNPVEVHVFLSKSGCETCEDT
FT                   LRLMKLFEEESPTRNGGKLLKLNVYYRESDSDKFSEFKVERVPTVAFLGGEVRWTGIPA
FT                   GEEIRALVEVIMRLSEDESGLEDATKEALKSLKGRVHIETIITPSCPYCPYAVLLAHMF
FT                   AYEAWKQGNPVILSEAVEAYENPDIADKYGVMSVPSIAINGYLVFVGVPYEEDFLDYVK
FT                   SAAEGRLTVKGPIRAGEAEEL"
FT   CDS_pept        511794..512183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0776"
FT                   /old_locus_tag="APE0776"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0776"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79754"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDZ3"
FT                   /protein_id="BAA79754.1"
FT                   /translation="MHQKIELPCEYAAKNIFPSIRASIAKILVEEYKMSKYSVAKMLGA
FT                   TPTAVSYYISGKRGEKFVDRIIRDEEIYSIVREAASLLVEAHEREEKSDEKELMGKLQV
FT                   LMCKACSRLNMLAQKYGCPALMFTR"
FT   CDS_pept        complement(512300..513100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0777"
FT                   /old_locus_tag="APE0777"
FT                   /product="serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0777"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79755"
FT                   /db_xref="GOA:Q9YDZ2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDZ2"
FT                   /protein_id="BAA79755.1"
FT                   /translation="MGDIHGDYTTFSTIVERSLQTLEGGGYMFLLGDYIDRGTPEGQVL
FT                   TIYRLCRLTKEYPGRVVMLRGNHEPPEGLEPMPHDYPLALQTVYGSDGRRLYSLSRKLF
FT                   DSLPHAILVEGALLMLHGGPPTINLETASRDPALYLGSDGDPEVIAEILWNDPAELDII
FT                   RAPNPRGVGSLWGPGVTVHMARSLNIKRIVRGHEPAMRGYKLNHGGSVVTLFSRLGAPY
FT                   FNSQAAFLNCKLESIVTDDIKEFLNECIATVQPEHGEHTGFVAW"
FT   CDS_pept        513376..514365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0778"
FT                   /old_locus_tag="APE0778"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0778"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79756"
FT                   /db_xref="GOA:Q9YDZ1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR020886"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDZ1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79756.1"
FT                   /translation="MVQGLPGEFEDYLYRVIASLYRYAERLVVVDYPSSPTRRSIDLIV
FT                   SLPGSRVVLIKAIYDASLISKKEVEELSAVANSLGVSAVIIAERMGREDLLTGVVYDRY
FT                   GVNMVNLETFENFVSGREEVYVTRYKDIYTVSISSEKLREKRLEKGLSLGHLAYMLKTS
FT                   RKSIYEYERGVMSPSVEKAEKLVDILGEEILEPIDILTSPRKPVSKRDFDKPEEALVGE
FT                   KLLELGFKVSHAKRTVVDLVAGRSGEEGVGSRIMIVVKRSREGRERMMSRIMKGVKMGS
FT                   ILSSSLYAVVNREEKSLIKDIDYTKTIVKDVREFINDVSRGRVEENEE"
FT   CDS_pept        514511..515131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0781.1"
FT                   /old_locus_tag="APE0781"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0781.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79759"
FT                   /db_xref="GOA:Q9YDY8"
FT                   /db_xref="InterPro:IPR004948"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDY8"
FT                   /protein_id="BAA79759.2"
FT                   /translation="MQSRELREQLLGCVKSRKSLHVTGPPGSGKSTFVSRLAEALRVKG
FT                   CRLGGFMAPEVRRGGRRVAFKIVDIASGEEGYLAVADESLAAPGGRRARHGRYLVLVDE
FT                   AWRVMSHAIRNAFEHADIIIVDEIGPMELAVPGFREALTEILDSGKPLVTVFHRRLRTL
FT                   DPGLYKLLERGCIVWLDERNRGPLIRLVSEIASALSNEACGNS"
FT   CDS_pept        515091..516314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trm1"
FT                   /locus_tag="APE_0782.1"
FT                   /old_locus_tag="APE0782"
FT                   /product="N(2),N(2)-dimethylguanosine tRNA
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="tRNA (guanine-26,N(2)-N(2)) methyltransferase"
FT                   /note="tRNA (m(2,2) G26) dimethyltransferase"
FT                   /note="tRNA 2,2-dimethylguanosine-26 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0782.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79760"
FT                   /db_xref="GOA:Q9YDY7"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="InterPro:IPR022923"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042296"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDY7"
FT                   /protein_id="BAA79760.2"
FT                   /translation="MPVPSPMRLAVTHEGRSIIYIPSPEYAVASGRLEPAWLEVFYNPA
FT                   MEFNRDVSVVAASALRRTGLLTRSGVAFDAHAGVGVRGVRYAVEAGYVKVIMNDINPKA
FT                   SMLAALNARANGLEPGSYMIFNKESNSLMFHLSRERPTPVSLIDIDPYGSPAPFVDAAL
FT                   ALSGKGTVVAMTATDLAVLEGGKARAAVRRYMLRSVSKTPVSKETGLRVLLGYVARVAA
FT                   AHDKAVKPLLAYYADHYYRVYVAVERGARRSDSMLEENLGRLVYCPETGVALALSYAED
FT                   PASACGGSYVVAADPAWIGSLGDQAFLEAMLNIAVEAVWLGTRPRVEKLLNTLHGEAPL
FT                   SPRSIYVSLTSVASKARVNTPKKSKVVELLRSMGYRAVATHFSGEGVRTDAPWGEVLEA
FT                   VVKLGSSG"
FT   CDS_pept        complement(516322..516687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0784.1"
FT                   /old_locus_tag="APE0784"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0784.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79762"
FT                   /db_xref="GOA:Q9YDY5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDY5"
FT                   /protein_id="BAA79762.2"
FT                   /translation="MVRNVEVYEKRALELIKQTEGILQSELWKLLGLDSREGSRIVLRL
FT                   ARKGIIRREQVVINGRKTYRLFPAEPTDRKKLNIIVDIGSILDIPCVVCPYIDECGEGG
FT                   FYSPESCRLIDEWVHGR"
FT   CDS_pept        516952..518844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0785.1"
FT                   /old_locus_tag="APE0785"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0785.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79763"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDY4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79763.2"
FT                   /translation="MKAWEIARKPRVVVYPGDPLTYVRAMMRREEEPIAVVVVESEKSE
FT                   KVVGYITWNEVIQVTSHYSHLRAKDAMLDYPVAFKDDDIGDVYKRMVEEKVYAIPVLES
FT                   RDNPNLVGVVTVADIVRALRRAGFKPMAETVAEVMTVEDLDRYLAEPGERVDRVWSDLV
FT                   YRRMPGKIVVRSREEPVPWGLVSPREFVSTSRWFFHRESERGLKTVAKVRRIMLRGVPV
FT                   ATPETPIEYVADVMAEHDYTVLPVIDEKEGRVVGVVTIFDVARAYIEGAKPGRVRPVAR
FT                   PVVPIEVKPEERVAYVSTERMLQQVMVERPQPVEIAGLTASEIARSELPAITVNDSIEH
FT                   ARRVMLRYRSNYVLVVDEDGNIKGVVSKWSMLKAIGLRGPLWRRRVYDKFFIDFVMDTN
FT                   IERIKPDASIEEVALKMASSRSEVVIVEGDDGKPIGFITKDDLVEAYKRLMAGRSKVEN
FT                   IMTPGRIGIVHPHHSLYHAVNKMHNFYLDALTVYDGREVIGVVSANRLPFVAYEDAMGR
FT                   KSRRLIWVRKLVKGSARRGRYVKVLPLVVLDVTTELRGVYVSPDDDVVKAIELMEKYNV
FT                   DGIPVVDKDGRVLGVVTKTDVVRELARTARIRIERGLPTRVEESRREEEAAKAG"
FT   CDS_pept        518996..519397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0786.1"
FT                   /old_locus_tag="APE0786"
FT                   /product="small nucleolar RNP protein Gar1p"
FT                   /note="H/ACA snoRNP protein Gar1p"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0786.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79764"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR038664"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDY3"
FT                   /protein_id="BAA79764.2"
FT                   /translation="MADRRRQRRTSKAGVGGRRVEYKRVPLGFIKAIVKTGHVVVEPSE
FT                   KVRRNPPRGRFQVLLAGDGEVGYVSDVIGPINSPFIVVRVRERGVIEKLSPGAELIMLV
FT                   PPKKPPRKGAPRRGSSRGRRGFKKGKARG"
FT   CDS_pept        519505..520416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tfb"
FT                   /locus_tag="APE_0787.1"
FT                   /old_locus_tag="APE0787"
FT                   /product="putative transcription initiation factor IIB"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0787.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79765"
FT                   /db_xref="GOA:Q9YDY2"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDY2"
FT                   /protein_id="BAA79765.2"
FT                   /translation="MHSSCENVIVTPEGEWVCLDTGEVLRESSFAEYIAVSRHSSTPET
FT                   ATPVSFKTHDMNIGARMSDFSSARNPLRRSLRTSKYATSSISRSEVPTITALQKLKEMV
FT                   EILKIPTSVHETAALILRSYLDSVSRRPGRVEQYVAASIAKAVEIHGIPISSGEIAKAA
FT                   GVEVESVQKAILQMSQTDVVKSLVRKSIAKARFRGYSTKMRRIEEFINRLVTNLGLDPE
FT                   VKRIALEFVKVSLKAGSGASIKTFHGKKSAALAAAAVYLAARLLNYDVSQKKIASILEL
FT                   KESNIRKHYRFLIDNVAIIVYV"
FT   CDS_pept        520535..521128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0788.1"
FT                   /old_locus_tag="APE0788"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0788.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79766"
FT                   /db_xref="GOA:Q9YDY1"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDY1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79766.2"
FT                   /translation="MAVTVAVGTSNPIKYRAVLRAFSRYYDVRVVMVSVDSGVGPQPSG
FT                   VADVVGGALARAVRAVEKADSYFGVGVEAGPIEFPASGGYVETQVAAIVDRDCRATIGM
FT                   SPSFEVDRRVLALMLDGVEMEKAVGVERHGGLGESVGFVGVATSGAVTRQDLTEHAVIM
FT                   ALIPRLMGYGSIATVEEIAAQAGASVECRSTRAI"
FT   CDS_pept        521170..521580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps8e"
FT                   /locus_tag="APE_0789"
FT                   /old_locus_tag="APE0789"
FT                   /product="30S ribosomal protein S8e"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0789"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79767"
FT                   /db_xref="GOA:Q9YDY0"
FT                   /db_xref="InterPro:IPR001047"
FT                   /db_xref="InterPro:IPR018283"
FT                   /db_xref="InterPro:IPR020919"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDY0"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79767.1"
FT                   /translation="MGIYQWRDKKKPSGGKRRYYYKVKRKYAAGRPPTYTTLSAAEEEE
FT                   RKPVRARGGSYKIKAKKVAFAVVSNPKTGEARKARILRIVETPAHREYARRGIIVKGAV
FT                   IDTTLGRAVVTSRPGQEGVVNAVLLEEQGQKQ"
FT   CDS_pept        complement(521974..522867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0790"
FT                   /old_locus_tag="APE0790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0790"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79768"
FT                   /db_xref="InterPro:IPR039604"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDX9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79768.1"
FT                   /translation="MQGRSIAEFKKEEEELLKTIEELKEEIVRLKEERRKLINEVKALR
FT                   EERRKASREKREYVEKLRSLREERKKILDELAQLKEERKKTRDELVIKRDQLRVLRGLL
FT                   EKEGGRLAKISLKRLQRRLQELEMMQMTRVLRPEEEKRLVEEISRLEELIERVRKAKEQ
FT                   ALSTMELQAEVKALVIKLKDLNQRIDELRQQAGSVKEELATLSSKIEEYNERIKKLSEE
FT                   IEKRSTRIDELSKEIDNLYAKYREVMTRLKDIRIAMARGMELSEVEKRREEIKKKMEKG
FT                   EPLTLEELKLIYGFYD"
FT   CDS_pept        complement(522983..523771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0791.1"
FT                   /old_locus_tag="APE0791"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0791.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79769"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030228"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDX8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79769.2"
FT                   /translation="MIGYIIVTGTAGAGKSSLVGALADRITSLGANVATLNLDPAAEKL
FT                   PYDPSVDARDYVSVAELMDKGLGPNGALVAAVDSLINHVLDIREEIDYYSPDYVVVDTP
FT                   GQLELFAYRVGGPLVLRGIMGDYNGVNIFLIDSIFIDNAISLVSALLLASSVAVRLGLP
FT                   QVNAVSKADMLLPEVREEVIPRLGEPGFLEFLLEKDKTYEGAGKALAEELARAIETTGF
FT                   IGEVLQASVLEPETVTLLAAKAQQILAGGDDYKIYDITGQ"
FT   CDS_pept        524923..525633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aoxA"
FT                   /locus_tag="APE_0792.1"
FT                   /old_locus_tag="APE0792"
FT                   /product="cytochrome c oxidase (aa3-type) subunit II"
FT                   /EC_number="1.9.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0792.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79770"
FT                   /db_xref="GOA:Q9YDX7"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDX7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79770.2"
FT                   /translation="MSMDVIPTEAIWWRLFLLFTAVGVLAAGTVTAFFIYSLFKYRSSG
FT                   QALGEDQGTAGRIYRIMVESPVSGKSKYLLFVTGIIVMGLIVATIDETLYLEKSPPVED
FT                   ALVVMVIGFQFGWQFEYSVGGETVTTLNYLVVPSDTLIEFRVTSRDVFHAFGIPEFKNK
FT                   IDAIPGILNSMWIKTPDEPGKVYNAYCYELCGIGHSLMVGKVIVVDKEEFYNAYNSGPD
FT                   VFSEYVNNVISKYK"
FT   CDS_pept        525646..528093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aoxB"
FT                   /locus_tag="APE_0793.1"
FT                   /old_locus_tag="APE0793"
FT                   /product="cytochrome c oxidase (aa3-type) subunit I+III"
FT                   /EC_number="1.9.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0793.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79771"
FT                   /db_xref="GOA:Q9YDX6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDX6"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79771.2"
FT                   /translation="MVSRLRGFLAWVYRWITTTDHKDIGLLYLVTSIAFLLIAGSLALL
FT                   FRVQLAIPKSNFLTGDAYYEAVTVHGLIMLLWFASPFAFGLANYIVPLQIGARDLAFPR
FT                   LNALSYWLYLLSGLVLLASFFTESGAPNVGWTLYAPLTARIYTPGIGLDLAALAIFLFS
FT                   LSVTLGTINFLVTIAAMRAPGIGWFKMPMFTWSILFTVILMLWAFPPLMVGGALLLLDR
FT                   NLGTEFFLNPAGGALLWDHLFWFFGHPEVYILLFPALGAMADVISTFSGKPIYAKRYIL
FT                   TAFLIATIISFVVWMHHMFITGTNIYTRLFYSITTILISIPFEMAVMSFIFTLYKGRLV
FT                   YTVPMLFAVGALLNFIIGGSTGVYLGSIAIDRGFRGTYWVVAHFHYILVGTVTLGLIAG
FT                   LYYWWPKITGRTYSERLGKIHFALAMLGVALTFLPQFALMDMPRRYFTYDIPEWVPLNQ
FT                   LSTLGAFIFGGSMAIGLVNFLYSLVKGGSAAPNPWNSWTLEWFTNSPPPKHNFDGVPVV
FT                   RKDNTVVFVSEEALSKYGKDAIVEGRVDVSNVPLSGGQSHSSHGLTHHGTTDPLVLAAG
FT                   LTLALFGLFVSKPLSYLGAIVFLLSLARWLWKDVKNVFAEELPGYVEHWPFPKDKIRSA
FT                   MWVFIASEVATFGSIFSAYFFIRFNPVGKFLTEAWPPGYLVHDVNVGLINTIILFTGTM
FT                   LFTLAYLGVKRDNYLITLSGLLGTLFMAIYFLTVKYFEWKELLIAGLGLDAGMYMQAYY
FT                   VTTGAHALHVILGVLATTYLLVKLFNGNLRGRQALSEVLAVGIYWGIVEIVWTLVFPLY
FT                   YLV"
FT   CDS_pept        528108..528419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aoxC"
FT                   /locus_tag="APE_0795.1"
FT                   /old_locus_tag="APE0795"
FT                   /product="cytochrome c oxidase (aa3-type) subunit IV"
FT                   /EC_number="1.9.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0795.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79773"
FT                   /db_xref="GOA:Q9YDX4"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDX4"
FT                   /protein_id="BAA79773.2"
FT                   /translation="MASGGGFEDLAREAAKYFGVWIVLVASAVAEVYLVLEGIARNPFV
FT                   FVLAVALFQSSLIALFFQHLRDEPIIIRGITVSGAVLIAILIISAVTSVLTCTPYFPG"
FT   CDS_pept        528673..529365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0796.1"
FT                   /old_locus_tag="APE0796"
FT                   /product="putative SCO1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0796.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79774"
FT                   /db_xref="GOA:Q9YDX3"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDX3"
FT                   /protein_id="BAA79774.2"
FT                   /translation="MGSGELNSILEAIGPFKWAVLVSLLVVVSGLSIGLYTAVTGLYPK
FT                   ADVAGGEYATVYSVGQRLFPVTIPSTQGTVSVPIEGKVNIIVPQYVRCPDICHYETLIM
FT                   KSLMIKLFQENSLDDVVFVTVEVDPWRGSLEEADMYIKESTASLGFTPPWIWVGGNMEP
FT                   LETLYKQLGLSVQLDSSTGLIVHTAGFYIVDRNGILLYYVKVEDEGWKNPGKVADVLEY
FT                   VVNDALSK"
FT   CDS_pept        complement(529343..529921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0797"
FT                   /old_locus_tag="APE0797"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0797"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79775"
FT                   /db_xref="GOA:Q9YDX2"
FT                   /db_xref="InterPro:IPR007158"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDX2"
FT                   /protein_id="BAA79775.1"
FT                   /translation="MSLYVVISPTGRTDGNIPARGYAGPSGRLDVIARAYNAILEPNAT
FT                   LAALLMGGPLPPRLLIAPLSCKDIVRSERSFMIEASRALRGRRSCFTVNDEGVEALASL
FT                   LRRFKPRILLAEKGGDISSHWGEMCSSSPTFIAGSHLDPPHGLIKHLERSLGGFLRVSV
FT                   GPLSLHTDHVFLLVSALRLPMHATSIEHH"
FT   CDS_pept        530002..530595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0798"
FT                   /old_locus_tag="APE0798"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0798"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79776"
FT                   /db_xref="GOA:Q9YDX1"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDX1"
FT                   /protein_id="BAA79776.1"
FT                   /translation="MASLRGLKASVMALIILAFLAVLVMVSRWLWINIMALDPGPIHPA
FT                   LAVVGGFIVGVGVAELLYTYIYFSPTTMLSNTIDDIVEIVGDILKGRAPWKPGSNVECR
FT                   EHNIVADGPYRCVRHPVYTAALTMFLGASLVKHYFLLASALMIAAYTILGVFEEARLNA
FT                   RTCGKYMEVMSDKPRLNPLSLLKCMLREIAGGTG"
FT   CDS_pept        complement(530597..531679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0800.1"
FT                   /old_locus_tag="APE0800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0800.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79778"
FT                   /db_xref="GOA:Q9YDW9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDW9"
FT                   /protein_id="BAA79778.2"
FT                   /translation="MARRIAVVGGGVAGLMAAWWASNYGYDVVVYEADLSSLTATRVSA
FT                   GIIDPTIDISLAPVALETLSLLKRLGLGLESRLLWLHERGSCRRLERLLSDKGIIERSV
FT                   AGEESIRLGRYTVNLGYGEELHVINTIIVDTGEFYSLASSASNVDIVEDSVEYVGCGSV
FT                   GLKRGGSREFDAIIVAAGPWTGFISGLQALSNMLRVYRCEALIIRAGGGPFAVVDDILD
FT                   FYLSIHASGDGVLGNGCCVEIASPLDGYRYSGDVLDAVISRSIERLEGLGEAELITPVS
FT                   APCVVGRDARPVLGMLPGCSRVYLLAGLDGVGVTLAPVLARLVVESIATGSQEPIPPEM
FT                   AASRPTSSSESVVKEPVEEC"
FT   CDS_pept        531813..532616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surE"
FT                   /locus_tag="APE_0801.1"
FT                   /old_locus_tag="APE0801"
FT                   /product="5'(3')-nucleotidase SurE"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0801.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79779"
FT                   /db_xref="GOA:Q9YDW8"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDW8"
FT                   /protein_id="BAA79779.2"
FT                   /translation="MLKAIVTNDDGVHSRSLRALAESLASRGWDVVVAAPLGNWSGYSK
FT                   SIGRFRGNRVYRFESRGVRFFTGDMPPAALVGTAIDIAGFEPDIVVSGINYGPNLGIYD
FT                   FFSSGTIGGALEAALRGFKSVSISSACREEETDCLPEALSISLAVVETSVETLSSSAGL
FT                   MVVNIPRSPRGFKVTRPCRRVPRFSGEIGEEGSLLVEKFDHSRLFSSEHDSCDGRLFSM
FT                   GYIPVSLYKIDNGWIHPLDPSRDGYLKAVEDILNYKIFPSAGKQF"
FT   CDS_pept        complement(532575..533801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0803.1"
FT                   /old_locus_tag="APE0803"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0803.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79781"
FT                   /db_xref="GOA:Q9YDW6"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDW6"
FT                   /protein_id="BAA79781.2"
FT                   /translation="METADADIVLLLQKTGGEVSRVVREIESLGYSVATVRSPPTKDSL
FT                   RSILERFPRATIITPGGVPGDFLEFGGRVVKGTYSLKPLPKVLRIVEPQDLSPVLPAEK
FT                   LLGGRFVEVVKDVLGEVASGINGFNPPASPPPVFVLSEVYVDGFPSVFDAILEAAYRAA
FT                   QGADVVVIGASGGDSESFASVFAAAARDLGIEAGVDPPSHDFLEAGLPPGSPKPVVYMS
FT                   VWEGGEAPNVESRFTTILPRYRSNDTLQMAEDILRSCKWGVREGLNPIVDPVLRRPGAL
FT                   PYPFESLAALKIARERGMECPAMVGINNVYEMIDADTTGSIPVLTLASAESGASAILVS
FT                   EESTKSRGATAEARIASYMVSYALATGSPPKDLGFGLLESKEKSPGYRPPSGCYALKLL
FT                   PRRWKDFVV"
FT   CDS_pept        complement(533865..534953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0805"
FT                   /old_locus_tag="APE0805"
FT                   /product="tyrosine recombinase XerC/XerD"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0805"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79783"
FT                   /db_xref="GOA:Q9YDW4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR033686"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDW4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79783.1"
FT                   /translation="MARAGSIESLPPPPRDIREYSLEDAARLFLTILESTGWSSKTIKV
FT                   YRAALKDFLKSYGRVRVGDASHMTYVQWMSSVSERVRKGVISRTTAHYYSIMVRRFLKW
FT                   AGVEGVMRPFSRGERRFSGSLSWRDVEALLSASRDIIDALIVSMLAETGLRVSELLSLR
FT                   LSDVDLGRGVVRVVGKYGKERIVFLGPLSRMLLEEYLASNPLPPDSRIIELSYQAVYKR
FT                   LKSLAKRAGLDPRKVRPHILRHTFATEALRRGMSLAALQRLLGHSDIKVTQLYLHMTYD
FT                   DVEREYYQTFASPMLTQPLQSPQQTGMYPPAMVYDTYPQHRFQHPQGYGHPHTIQAGMT
FT                   PDTSRGYGRVVPSRRRGGARVR"
FT   CDS_pept        535148..536770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0807.1"
FT                   /old_locus_tag="APE0807"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /EC_number="1.2.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0807.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79785"
FT                   /db_xref="GOA:Q9YDW2"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDW2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79785.2"
FT                   /translation="MALWRIEKPKNEPFLEFRPGTKERELLKKKLEEVKSKTVEIPLII
FT                   GGKEVKTGETVEIRAPHDKDAVLAVAHLAGEEEIRDAIEKALDAWTKWSEMEWYHRASV
FT                   FLKAADLLAGPYRLEADAVIMLNHSKTPWEAEIDLAELVDFWRFGAYYARFIFEQQPEQ
FT                   APGELNRVEWRPLEGFVFAVPPFNFFSIGGNLPTAPALVGNVSIWKPSRWVIYSNYIIM
FT                   RILMEAGLPPGVVNFVPFNTKYSSIVLSHPDFAGLHFTGSYSTFVRLWKMIAQNLDKYR
FT                   NFPRIVGETGGKDFIVVHPSADITEAVVATIRGAFEYQGQKCSAASRLFVPKSMWPRFW
FT                   EAMKAELDKVKVGPVDDFTVFMGAIISEEQFRKIVSYIEYAKQHPEEYQIIYGGKYDDS
FT                   KGYFIWPTVVLTNNPKGKLMTEEIFGPVLTVYVYDDDKYDEILWVVDKAAPYGLTGSVF
FT                   AKDREAILKAEKALRYAAGNFYINDKPTGSIVARQPFGGARWSGTNDKAGWFTNLLRWL
FT                   NPRSIKETLVPPKEWRRPYMGED"
FT   CDS_pept        536937..538352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="APE_0809.1"
FT                   /old_locus_tag="APE0809"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="ThrRS"
FT                   /note="ThrRS-cat"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0809.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79787"
FT                   /db_xref="GOA:Q9YDW0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="PDB:3A31"
FT                   /db_xref="PDB:3A32"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDW0"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79787.2"
FT                   /translation="MASGQDKTHIDYAYELDITVKPDSRVPVFNREFATFTGAGVPLFS
FT                   LGGGPIRYALAEVLAKFHARRGYYVVETPIIASTELFKVSGHIEFYRNNMYLFDIEGHE
FT                   FAVKPMNCPYHILLFLNEVAKHRSKLPLPFKVFEFGRVHRYEPSGSIYGLLRVRGFTQD
FT                   DAHIIVPGGRVIDVVYDVFEEMKLVLERLFKLGVSSETFKVRLSMSDKSLIGKEFMGSK
FT                   EEWEGAEEALREAASRINEKYGIDIVELEGEAAFYGPKLDFIMMVEESGVSKEWQMGTI
FT                   QFDFNLPRRFRLYDVVREEFGIEEVYIIHRALLGSIERFLGVYLEHRRGRMPFTLAPIQ
FT                   FAVIAVKTGGEVDREIEDLASSIAKGLLDKGFRVAVKGSSKTGLSSDVRHIESTAKPAV
FT                   NVFIGAKEVREKVLDVRVFDLESMKRRRLAIAYGDAADAVENLAAVAEELESPVRSLSG
FT                   QAPRIPADFSFML"
FT   CDS_pept        538405..539388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0812"
FT                   /old_locus_tag="APE0812"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0812"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79790"
FT                   /db_xref="GOA:Q9YDV7"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDV7"
FT                   /protein_id="BAA79790.1"
FT                   /translation="MVYDRCVELGKEIGRLVESMDVDQFLNPEYYPPADAPREVVASYF
FT                   LVMVAMDHRLSRPGKPYEAVVDGKLYHGADLLYRLGSKKLQEDPGFFTAERLSRVTVED
FT                   VKEWLSVGNASPPDPDVRAKLLRDLGRKLMALYQGSAWMLIVESKGYLRRGVGEGFVDR
FT                   LKVFTAYQDPVEKKAFLLAKFLERRGVARFADPHNKELPVDNHLVRLALRMGIVSATED
FT                   LLEAVKRQREVDTLDDVALRLASRRAWRIVAQHGGIDPFILDDFLWAFGRLCCTRDAPT
FT                   CRTGCSAKCRGMGWCDGGCPLSRVCRAYSDDRLMVPEHRFLLTWWY"
FT   CDS_pept        539402..540478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0813.1"
FT                   /old_locus_tag="APE0813"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0813.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79791"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDV6"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79791.2"
FT                   /translation="MEGLVAEVMRESGEGCTVYSSIAGPIALGHGGLATRKFSLRFSQH
FT                   KPYGGKAERVFVSVGVLLSKTVKTPLKWKLAVDGSTLSREIKPQVTVDLEEAKYAKMVI
FT                   DATPLLSSKFSERSVHNLFTYYDGAQPITLVDVFMVAVYRPLEDDNTSYHFKASYHTGA
FT                   LALEPGDVAKVYSTLGRAQDDAFRVAVAGVQVSSPQLRVYLVAGGSRRDYAAGPGYKLL
FT                   RVDIPYRGVEVPVAVVNEPVDTPVYPRLSIVGDILVYESRIDGLRVGIRDVSMEYSNKQ
FT                   TVVKAVVYNEGSVELKRISIYVLPSPRHKVSIDSLKPGEHRSVRLLQAPGDRPPQWIAV
FT                   EASAAGVPFYREYPIKHS"
FT   CDS_pept        540892..541725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0815.1"
FT                   /old_locus_tag="APE0815"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0815.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79793"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDV4"
FT                   /protein_id="BAA79793.2"
FT                   /translation="MLGRDKAALLWKRIDIIGDIAVIKKPIHGGVSIEDLRLVAGELLR
FT                   RLPHVRSVWLATGPVGGLFKVRRDLLHLAGEKRTSTVYREHGAEFLVDISKVFITPRLS
FT                   FEHLRVARLVKPGETVVNMFAGVGVFSIIIALKSRPSKVYSIDINPDAYRLMIENIRLN
FT                   RVEDVVEPMLGDSARIVSESLRGVADRVLMPLPDLALDYIGHALDALRGRGWLHVYLHV
FT                   DYERGKGHLRRACKLVEAEVERRGWRVVEAKARVVRSVGPKLLQVVVDAVVRRDG"
FT   CDS_pept        541718..542284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0816"
FT                   /old_locus_tag="APE0816"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0816"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79794"
FT                   /db_xref="GOA:Q9YDV3"
FT                   /db_xref="InterPro:IPR003827"
FT                   /db_xref="InterPro:IPR022908"
FT                   /db_xref="InterPro:IPR036602"
FT                   /db_xref="PDB:2DVK"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDV3"
FT                   /protein_id="BAA79794.1"
FT                   /translation="MGSIEEVLLEERLIGYLDPGAEKVLARINRPSKIVSTSSCTGRIT
FT                   LIEGEAHWLRNGARVAYKTHHPISRSEVERVLRRGFTNLWLKVTGPILHLRVEGWQCAK
FT                   SLLEAARRNGFKHSGVISIAEDSRLVIEIMSSQSMSVPLVMEGARIVGDDALDMLIEKA
FT                   NTILVESRIGLDTFSREVEELVECF"
FT   CDS_pept        complement(542538..542666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0816a.1"
FT                   /old_locus_tag="APES035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0816a.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79796"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDV1"
FT                   /protein_id="BAA79796.2"
FT                   /translation="MNPGPPPCKGGVLTRLDDGPWAPVVSDLIRAGSYRFTELLQV"
FT   tRNA            542607..542684
FT                   /locus_tag="APE_tRNA21"
FT                   /old_locus_tag="APEtRNA21"
FT                   /product="tRNA-Val"
FT                   /anticodon="(pos:542642..542644,aa:Val,seq:tac)"
FT                   /note="codon recognized: GTA"
FT   CDS_pept        542891..544132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0818.1"
FT                   /old_locus_tag="APE0818"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0818.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79797"
FT                   /db_xref="GOA:Q9YDV0"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDV0"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79797.2"
FT                   /translation="MLPEPKDVPQEARRQLLNLLAERGKVKPSTLGVSRAYFYQMRRGL
FT                   RPISDSILERLLELATDDDLAGIPFFAPYVDYQRVKGYDVDRLVRLVAEWARANPASAK
FT                   VFLDSLSAELERLGLVGKAIKVSERHVREFEGYLEARVRSGDMDPGTAGDRLRYLRMAL
FT                   EELGYVLTKQALRGLIRRYQASQPGVADHIYKSLKLFVKEVVQDRELLEAIPYPRVRWG
FT                   SPEAPQWSDICRVVEALPHAGAPRALLLLLASTGLRVETAYSLPLDSLKLSERLVWVWS
FT                   LKRSKRTYFSFITERVKGELEVYLEARRRHLEILGRGSGKLFPYKPRRLREAIYEAMDR
FT                   ELGRRFQLKLIRKRVAEHLSHHLSTLELNVIMGHAPREVVEKHYLLRDQIEDLRRKYDK
FT                   AMAKVPCLGGGEAG"
FT   CDS_pept        544129..544380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0818a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0818a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34752"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E49"
FT                   /protein_id="BAF34752.1"
FT                   /translation="MRVENASLGDRLSRLSGKMIRRVRLSWCNNEEHRTVDIFEDLMHM
FT                   FLCDGYHVAIILEDGTVVELFADDNGHINIYEKRGKVG"
FT   CDS_pept        544519..544908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0820.1"
FT                   /old_locus_tag="APE0820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0820.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79799"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDU8"
FT                   /protein_id="BAA79799.2"
FT                   /translation="MDVEYQRLYGIEFRVKGVRGLYGDGRFGKAMAIAAFLRTLSVLWF
FT                   MPRGMRPHVEVSKDFGDVWLEWSGEGERRVYIEFMLCGEGCEYDAEGVLEMVGFDSKTF
FT                   RSLLNAFLKEARLRSLQATAPQGVG"
FT   CDS_pept        544909..545889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0821"
FT                   /old_locus_tag="APE0821"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0821"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79800"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDU7"
FT                   /protein_id="BAA79800.1"
FT                   /translation="MAVPPASRACRGGGGRGWGLEIVLADLRRGFSNLLEWELLSIVEL
FT                   KRRGLGLSEIAKAVYGTSRKRYRVFRILRRLQRMGVLDCLLEGSCCALGGEGDGGHVAP
FT                   AEDAQHEGDDGSGEATSEATWEGLPGRLGRTQKLVIAALAIQLEATPSMIAAYVNHAYG
FT                   KRVSRNAVWHALKRLSARGVVERLPRGYYRLRRLSSGILVENLRVRGRMVWSTREEGRP
FT                   ATLEEALITAALRDRTWPVEQAELLSHGPRKLLEKARLLERLGWRMTVMYIDRKNGAPR
FT                   LKLEHRLWNTPIPARPEELYSWVNLYREASSLARDLAEHILARTR"
FT   CDS_pept        complement(545948..546649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0824"
FT                   /old_locus_tag="APE0824"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0824"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79803"
FT                   /db_xref="GOA:Q9YDU4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDU4"
FT                   /protein_id="BAA79803.1"
FT                   /translation="MKHPKNLGRNRQLSERSVEDELIDLLLLALSNLDIKYTALAQELA
FT                   SRMGSRGIIIVALFKENEKLPAYELAFSIGLGGYGIVFIRRELADKLPEEVIKFIVAHE
FT                   VAHIVKNHAIASYTTRQLTKISFDSLKDSIKNLNRTKKSEKPTANLLLIIISLALLAQT
FT                   TKYEATTIKEQELEADTLAAKTTGCKPALIFAEILNHLKKQGINTSHETTLGAPALTLD
FT                   ERINNIKRICQ"
FT   CDS_pept        547079..548005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0825.1"
FT                   /old_locus_tag="APE0825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0825.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79804"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDU3"
FT                   /protein_id="BAA79804.2"
FT                   /translation="MVLSFNIEGRLSEVLMAISATLTASGAIIAAQSLAQLEIQEALES
FT                   RREHKKRLDKLAERIIRGDAGRIVSNAIGLEKTKFDILYSEPCDTLEALKDEEPYLLKD
FT                   LDTHLEGKPISKLLDVCRKHKKSVKSLDEELDEIASRVVDFVVQELGQQYKILETYDNS
FT                   FKEFVKTKVLAPTIRTIHNNESQWTLENIVKEARRIQDEIKMEVKLKDTYKGGMSGIDV
FT                   YMYAFKLVYVKAHLPTEGPAVRNNVLRVFKEVFEQKLASYAKDLVDKVEETSSLTRSAE
FT                   EIKKLTVNRLYELREKTYLPNLCQYVK"
FT   CDS_pept        complement(548559..549350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0826"
FT                   /old_locus_tag="APE0826"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0826"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79805"
FT                   /db_xref="GOA:Q9YDU2"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDU2"
FT                   /protein_id="BAA79805.1"
FT                   /translation="MINRSHETQRQLLTREHRNPELEGNYNPHIRSFSNHKNKIWYCYS
FT                   LSILWEMMDLKPKLVSVILFVVSLVIIVVSWLLYIKGFIPLWDVTSGVLTIISVIISLF
FT                   VLGAIYYQAYYTRELAQQQVIESMKPDIAASLLTLLKAVAEAKKHNYSDPFKGYIIICW
FT                   GLPEAIKSRSLAITPLTSSSQGHDIFSMPRPKEALEIIKRAAETTGSTEILDRTRILLK
FT                   QLDNPITEETSKTINELVGFVQKTYLVQIAEEALNLCHQKR"
FT   CDS_pept        549567..549731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0826a"
FT                   /old_locus_tag="APES036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0826a"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79806"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDU1"
FT                   /protein_id="BAA79806.1"
FT                   /translation="MVLENVLGGFEQSFSNTLIIRFRLLRAVSSLHLVCCMAHIVCRVG
FT                   WCLCMWIGL"
FT   CDS_pept        549704..549979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0826b"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0826b"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34753"
FT                   /db_xref="GOA:Q05E48"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E48"
FT                   /protein_id="BAF34753.1"
FT                   /translation="MSVHVDRFVAVVDYIIDIVAGVLMAFFMVVFGWFLKGAYEVHRAG
FT                   ACDGLCMNLFVLSLIGFMLATALSLFFSRSILRKLGGASDGPRVCA"
FT   CDS_pept        549957..550436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0827.1"
FT                   /old_locus_tag="APE0827"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0827.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79807"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDU0"
FT                   /protein_id="BAA79807.2"
FT                   /translation="MVLEYVRRLVGAREKPDPRELLGLVEAVDAGQQQGGAPPFDLYTL
FT                   LEDEKVGRELWPYILGFVARDTKLTYFTERDEEYLFWKIEAIATKIEMALNSQTPPPDR
FT                   FPRVEDYVKVVEAQRLLADNLRVLMLAAVRRSTLGFERRLQAMRHFVFSYSDRRF"
FT   CDS_pept        550445..551401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0830"
FT                   /old_locus_tag="APE0830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0830"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79810"
FT                   /db_xref="GOA:Q9YDT7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDT7"
FT                   /protein_id="BAA79810.1"
FT                   /translation="MGALMLLGMALGGLAGLGAGYLLYPSRPDLALLAGLGAGSALGWA
FT                   MGFFYWSFGVPPAFKQAMRAARTGFLIVAVGADKKARLLPGFSDGFVVRPAPRPYRDKY
FT                   AWAADGESSYPIHGGRGTQLLVTFMGYPFPLEAGKAAAVSKFRERGFRSIEDLKTAVEL
FT                   PTVEEIEARMRELEAARASIEKMDEGEVRRLYGEDKRQLLAEVDRELERLERVRELVKE
FT                   YGGGSSLTVNVDGATVRASDLISYLVWRHHPSEIDRIVKAETNAVLSRLSAVDWLRQLL
FT                   PVIIVTGMFVLGIIVVVYMLKGGGPPAPVESIAIGGG"
FT   CDS_pept        551405..551809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0832.1"
FT                   /old_locus_tag="APE0832"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0832.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79812"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDT5"
FT                   /protein_id="BAA79812.2"
FT                   /translation="MGYSRFRTVKSLQPGFIAVISEVALEAVKAKIAASRNPFAAYDYA
FT                   EALDALISVLPPEAKQDITKRLGVDVDIVVEEALGSCSRDPNAHPYVNEARCLRRVKED
FT                   LDKLLRVVFDVAHRRGLFVVEREVLYGGEA"
FT   CDS_pept        551865..552668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0833.1"
FT                   /old_locus_tag="APE0833"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0833.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79813"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDT4"
FT                   /protein_id="BAA79813.2"
FT                   /translation="MAENAREFYERPEEAEESGVGWSILAGWMESAFRTGGFNSVIVYG
FT                   KQGAGKSVYAIKVVYDLLRRLGVVPASSTSRIVFKRYMVFSASHFIGKIKNARGARLPA
FT                   VIWDDAGVHGGSYLFFTDVFLAKALGDLFRVARTRVANIIFTTPSPRDLLKPFRSYDTI
FT                   IVYVHEMDEVWSRAHIYKMRLLPSGDVRVQKKAMEDFRRRLRTYDEYIRIRDRYVDEAI
FT                   DALEELMLVKYAERAMKRARLFEKAARLGGWRGFEAEDQGSYRDD"
FT   CDS_pept        552807..553472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0836"
FT                   /old_locus_tag="APE0836"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0836"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79816"
FT                   /db_xref="GOA:Q9YDT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDT1"
FT                   /protein_id="BAA79816.1"
FT                   /translation="MPSKAETAALLRGLGYSYLEIARELYPGDYRRYRETGDRRLYQLL
FT                   KKRVWKLLRLAGGGGSRGNGVVDPPAGWTLEVEFDESGWERDSPTPRAPPELPHPRERK
FT                   RGLRGFERQVVEYEQLLYYYYTRHLKGYDSSGVIWGTIKLVHGRAFRGFYEEHGVNVWR
FT                   REKAGRVARAYVYSVMVVSLWLHGYWFYSELRERLRRALDVDREDVAKVLPLVMGTVV"
FT   CDS_pept        553499..554215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0837"
FT                   /old_locus_tag="APE0837"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0837"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79817"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDT0"
FT                   /protein_id="BAA79817.1"
FT                   /translation="MLPPRLRGNPVLSRYARFYKTPSPPAPAVTRGAPGPRPTGSRPPR
FT                   SGSRASGRGRDLVDALLKEGLAYRDEERGYVVLKRPDAFKILEGRRASRSRPKTASVGW
FT                   EELERRRWDRRVERAASFAYTSTPGSAILDDVHSQDTLNRWMEQWVQKLVSEGYSEKSA
FT                   RSMAANMLGGDFREDFEAAVRQMMNELGPGSRLYTWYGEGGWHVTVFNPRTGRKKSLSL
FT                   KEFASSWEPDFVTVWD"
FT   CDS_pept        554231..555496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0840"
FT                   /old_locus_tag="APE0840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0840"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79820"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDS7"
FT                   /protein_id="BAA79820.1"
FT                   /translation="MLRRRVLMDGGGSAGSAPSSPGSSRPPDYSLYESQPRPAPASWSP
FT                   LGVLASALDAPYSFVQERGWGVVERLRRRALREKAEGDYAEGFLWALGASAASFGVGVA
FT                   AGVTGLFSPRAWREAFHAFMHPGETVRAVASDPLSWPYLAGSVVGPAKLGRAVGRRLGR
FT                   VREPDLASTSEGSLTLVAAKGERLRWAARLEARGPTVGVKGVKPRPPPDRLVTLETPRG
FT                   RVELLESRRGSTVRRVYRAEYRDVGKKLLGVEEWSVEGWLRPRYRYRGLLVDPETPGAA
FT                   VLLEARRPLLRGVDLPPPRLWVEPRLAAPAGAVGLILGLGAAGTGARGGLEGGAAGRPA
FT                   EAGARGLVSGSSLAGGEAAASTLAGASAASSPAEPSAASAGRGGPEAPPLLGSGSRGRR
FT                   GRRGKLAYSEILYPGGVLLELL"
FT   CDS_pept        555521..555811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0840a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0840a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34754"
FT                   /db_xref="GOA:Q05E47"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E47"
FT                   /protein_id="BAF34754.1"
FT                   /translation="MAARAWVVAVVGFFVMWLMFQVVGWVIGVIWGVWQQLDQATAGTM
FT                   IEPPQDWKNMLNSLYSNMLGIWNYLPVVVLLSAVVYIIIESLRRRPEEYYV"
FT   CDS_pept        555824..558604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0843.1"
FT                   /old_locus_tag="APE0843"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0843.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79823"
FT                   /db_xref="GOA:Q9YDS4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDS4"
FT                   /protein_id="BAA79823.2"
FT                   /translation="MRPGPVLILLLVVLSTAAPLADAGVQDWVTPGLVLDASPHLWLRM
FT                   ADTLVQRLYDPGLNLFRETWGTPEGRCWYWNTEQGEAAQIAVYLNDSTLLSSLLAAYKQ
FT                   YLIYESQSGQVYLFSRYTPCSTIRQLSLDPQNFSLGNLIVNIGGDLAGTRTDVPDYHRV
FT                   VALSLDIYKDPTNIYEQDKAWPNMWYTANLKSHEVWYLAPGDTTDYKGIWDTSDGSLGT
FT                   GSITSYSVRVEQATDPTTNTTYDVGVAERTMEDANLSYTQRFVLEPRKPYVKVELTVTN
FT                   KSQVDTLSNVRVTLAFDNLDWWLYKYVYIPGVGLIDASTSGTQINTGEKEYHLARTWEG
FT                   FWQPVTDSSGRAWWPSIIYADRPLGMNRGLLVLVDGNYGVNFWGYGNYQAPQKDLYGVP
FT                   AYTDWYYRWLKYEVVVGDLPPGASKTVEILIVPMASYAPGLEDLYIEMASKLDQLEGRD
FT                   FSYAVNTGTGAFKGLAMARIILAYLNQGDHQFAQRILDTVGQVMEAWGWMVSTRALSNY
FT                   ILSLVYLYDYTGDRTYLDRAEAAAQTLLQAQIRDPQDPRNGGFLDIVYPYGVATYLDVN
FT                   AEAAHALLALWERTGDTAYREAVDYWLQNWFRREQDTGRWYYYRYKSLEDAPSEYWYKG
FT                   YLDEKQPYAQGYFLQALAKLYWSDERLLVSFNRIMELLSDEYWELTWEGADETNVETQS
FT                   SAAAGLREYLLALAGGAGAAVEYVRGGELASVVYEKYGSMVDPSTGLRFTLGRMVITVS
FT                   KPPLALATVAVYLPSGLLLEVLVDGVPARQVQQLADLALSPESYYFDGSLVYVRLQSAG
FT                   EVAIVYQWVESGESNVYSPEVSTPVVEQPPTVTPPSVGVTLPQWLEPYKGLLAVGLIVA
FT                   SAMLATEASAPVFALAAAGLAGVFVASGWLTIPQAVLGLAFAAAGLGLIVMRKRG"
FT   CDS_pept        558639..559010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0847.1"
FT                   /old_locus_tag="APE0847"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0847.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79827"
FT                   /db_xref="GOA:Q9YDS0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDS0"
FT                   /protein_id="BAA79827.2"
FT                   /translation="MRALNMAVFIFLLSLSMSAVKEAFGLPHVGPVWSVGVEDVEAYGR
FT                   VEYSGDWWGVSVFSAVKNGVELLGGVVGGALMLGSTLQAFIPFQLPGVLVMGLNILGSF
FT                   AAALAFIQFVRGVSTRGME"
FT   CDS_pept        559007..559300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0848.1"
FT                   /old_locus_tag="APE0848"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0848.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79828"
FT                   /db_xref="GOA:Q9YDR9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDR9"
FT                   /protein_id="BAA79828.2"
FT                   /translation="MMASATLPPPPDVLTGVGLDQLISSFASWWSGATFGLFGPVLAVL
FT                   AVVTVFLKTRSASATAVVSLVLAAFLGREWLMLVAALSLAALLWQVWRASTD"
FT   CDS_pept        559331..559648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0850"
FT                   /old_locus_tag="APE0850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0850"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79830"
FT                   /db_xref="GOA:Q9YDR7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDR7"
FT                   /protein_id="BAA79830.1"
FT                   /translation="MQGFIAYLVGFAVVAGVAVALGITLGFFADIASSLTYTTTTTSVD
FT                   PSTGQTVTITQTNYYVPQEYMNVIDMAQSLGGTGVTLAIAALIVGLALLLIAVIRQTGG
FT                   V"
FT   CDS_pept        559676..559942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0850a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0850a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34755"
FT                   /db_xref="GOA:Q05E46"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E46"
FT                   /protein_id="BAF34755.1"
FT                   /translation="MQGFTAYLVGFAIVAGFAVALGFIFGIFNQIVAQLNTDPNNPMIS
FT                   QEFVDAINLAQSLGGTGLTLAIAALIVGLAMLLIAVIRSYSGV"
FT   CDS_pept        559993..561267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0852.1"
FT                   /old_locus_tag="APE0852"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0852.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79832"
FT                   /db_xref="GOA:Q9YDR5"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDR5"
FT                   /protein_id="BAA79832.2"
FT                   /translation="MRLSAVLAGGLLLLLLVAPIPGWTPAAAQAGVFLEIVLPDGSGYR
FT                   FGPLILERGDLVAPSFYRLVLDGSGYVEFDLAPEAGTVAALVRPYKTPDWNAIASNDEA
FT                   LSWRLYVSQASDAYEFMRRDSALNAYVAGDGAARDGVLVWVLAYTYSDRLEIHATGSGS
FT                   ASWTGSPAGPAAKVLIGSNMFNGSEVPAQRWIGEIWAVVVHSQPAVDPRGYEVPASGLE
FT                   LLFDPGWYLGGGLFAGLSGSGFVYGRLVGDAVLEASAPRIWVVRDAYTDQYLHVSLTPY
FT                   GSRLRVLDASGEVLAEYSVISDNRVGDLVLDYQVPWPPAPGSGGGDGGLGALDLLAVPV
FT                   VLLALAAPGVALASGPVWGFTFAVFAGVAGWVSLSRAGGLGVEGSVWQGLALLALVSMV
FT                   LAVVLSAVKLLAWRGGLREPRGLDL"
FT   CDS_pept        561264..561488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0855.1"
FT                   /old_locus_tag="APE0855"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0855.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79835"
FT                   /db_xref="GOA:Q9YDR2"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDR2"
FT                   /protein_id="BAA79835.2"
FT                   /translation="MMRGACRLLAVFTVGLAVFSLTVLTGLLLDALDGVLGDDAAYTGV
FT                   AVVVGSMLGGAALILYRGEPRGCGGGAAH"
FT   CDS_pept        561510..562358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0856"
FT                   /old_locus_tag="APE0856"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0856"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79836"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDR1"
FT                   /protein_id="BAA79836.1"
FT                   /translation="MPRRIFLNMVAAAVLLAVVVLSLAAPAADARITPRPQVVKNPSFE
FT                   SGLDFWDQLAGVADVTSSLSYSGVYSAYFVRQSAEGYARLSQMLPSGYDEYDFIARIYV
FT                   PSRALGSPQTLYGAALEHDNLLVIGAGLLIDGYKCYVSVNAIDIFDIPVDCSQIVDRWN
FT                   IVEVVITETSLGYRARVYVNGFMFFESIGFPPPTNRVSLLWAGEGESSYFDLIELYDLS
FT                   SGSASASLDDWGHPWAVIMGEQGDPASRWWTPVPGDTPSRTLWEAVYGAQTEGASPASR
FT                   A"
FT   CDS_pept        562446..564050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0858"
FT                   /old_locus_tag="APE0858"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0858"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79838"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDQ9"
FT                   /protein_id="BAA79838.1"
FT                   /translation="MKNAVAALILATILLAPLLQAVPASAAPSYSEVYSAYIEGKRYIE
FT                   RLARTVYDPATGEPVYSFIAEYPSLPVWGRYGEYEWVPGMPFYQLCSSGVHGFYKVHLS
FT                   LASETLGSTYSRWVYDYTLQFVLSTSRGATVFDLAVLRVAEEHYGGSWRVTVSTLSYGS
FT                   WEGLGSCGAINGRDITVYLASMPLGTVGSLYTSPATFSFDSSTVLPAFRFSARHVLMLG
FT                   TLFYDAFGVGNLYMDNAARDILYEVFKTPRDPLDLYGNALPAAGYTVSIDIPALDSDSE
FT                   DHEYFFDAMLFELYPGYYETGYDRIFRWTLYNGWVDASGPGVYYPLYPYKSKVVSYAEL
FT                   FGVNGGDGFLSVLERPLTCGLDAETDPLLNAWKGIYYAVTGSWGAATSQWYDIVDDWDG
FT                   VGVLACYSENYSTVRLAAAVMLGTLLAERGYIGWGTVDAMVEALLKAQWRGSGYYKPTD
FT                   TWEYMFKIDHAGGFIVAYNVAPDGSFGVTGFRPDYLELITEGNDMDPEYIGPLPTNAET
FT                   TLAAITALKMYMDARYS"
FT   CDS_pept        564324..564830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0859"
FT                   /old_locus_tag="APE0859"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0859"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79839"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDQ8"
FT                   /protein_id="BAA79839.1"
FT                   /translation="MHQPEKDGDKNEIGPVEAAACVVDATLVIYSNVYPGVLHIYDDGS
FT                   YETLEVTDWIAWEDVPNYLYDVVFYKTGKTTGTTAMRMEGYMSEVQSDLYPCRVYKAIF
FT                   ADVVAALSGDSGSPAYRKLGGHAVLLGYVVANSDDWDGIVRTMILSVDNLWGAFGVRPY
FT                   VCQWC"
FT   CDS_pept        564811..565827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0860"
FT                   /old_locus_tag="APE0860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0860"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79840"
FT                   /db_xref="GOA:Q9YDQ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDQ7"
FT                   /protein_id="BAA79840.1"
FT                   /translation="MCASGARALLLTVLALPLLALVAGAEAPTLVGESGPFDVYRVGEG
FT                   FYVALIDDGFFDEVRGRFYLYWAGSPEEHSRLTESPFTPVVEDLGASLGPGEEGAIGPY
FT                   SREEDFDCRWGVAPDGRWWVRINGEKRYVSEPEASRALRGLGVEASAFSVGRLVVFDRQ
FT                   NGVITERLDTVAKVYVHGPRDALLDPRLGEAVREAVLRDCGVPVNVVVAVEEAWSLKKW
FT                   ALREETYERISTAWDRLGLPLYGVGGMLGFPLLVGVDGLEMRSRGVTLDWVLSVLDREI
FT                   PPGLAVLVVVRDYKPTEGSLLPGQAGGSGVGPEAGVAAAALAVAVAAALVAFKRRRT"
FT   CDS_pept        565904..566224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0862.1"
FT                   /old_locus_tag="APE0862"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0862.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79842"
FT                   /db_xref="GOA:Q9YDQ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDQ5"
FT                   /protein_id="BAA79842.2"
FT                   /translation="MSVLRLTWYKVLPLYMLGAVLGYLVFSAVLSIGSGSSMFDPLWLY
FT                   IVLVTAFLSPLSMLVWGFLSLTAWLLDRKLGPYAMFVPLVAGAVMGPLTLYILVRGLLV
FT                   YP"
FT   CDS_pept        566269..566676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0864.1"
FT                   /old_locus_tag="APE0864"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0864.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79844"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDQ3"
FT                   /protein_id="BAA79844.2"
FT                   /translation="MLGWLRRKAGELRRRRRVRSRIVSHLVSKGVARRDAERLAPLVMR
FT                   GELTVSEAVSLGKRLGRDRVARVERRLRGEERRKNDSKGGDRFLGLSRSILGFTLGTSG
FT                   SQPIDLFGGQTGESKRRRRRGGREPGQPPLW"
FT   CDS_pept        566712..567041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0865.1"
FT                   /old_locus_tag="APE0865"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0865.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79845"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDQ2"
FT                   /protein_id="BAA79845.2"
FT                   /translation="MRLRRRRRRGSRCPVPRENPRTGRKTKYLGHRVRDVGGSGLDSPR
FT                   EFRGILREVTRDYREGCISKRTARGRLLLLYRLTYPRYNRKARRIPASTRRRLREEIRR
FT                   AMESL"
FT   CDS_pept        567135..568112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0867.1"
FT                   /old_locus_tag="APE0867"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0867.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79847"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDQ0"
FT                   /protein_id="BAA79847.2"
FT                   /translation="MFEGSEYLYPLYRHLYGLGLTREEWLRAREAFRERARRCPRCAFM
FT                   DVGLAARHARSLRQWMRSPNRYDIPGVDSPEVGWWLESRDLLEPYSEESKSILGEVERA
FT                   RRAVELYFGEPVATRVRVRYEEEMDKPGVLGYWEHRPGWDYGVLAVKRGLGERFKDVVV
FT                   HELVHAWSLGRYSDVPYGEKAGNPAWNMRVVEGSTETAAKRVLSLLGLKPSAVAYSALV
FT                   ERLSEGGAERGVEAALEFLRAARERRRPRGEYMREAVLLKHTEGPDVYVSKPPERLPGE
FT                   ARDLLSPKPFPAELALDRTLRPFAEALKTLRRQRRRGGRRRRWG"
FT   CDS_pept        568103..568360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0867a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0867a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34756"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E45"
FT                   /protein_id="BAF34756.1"
FT                   /translation="MGLDPFVIQAREGDREAWTRANRLAAGLMAIGYPVEVKPLPRSSR
FT                   ERLVIVTPLGGRIADPGEGELRDILDYPHIHAGYIVDAEH"
FT   CDS_pept        568627..568878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0867b"
FT                   /old_locus_tag="APES037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0867b"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79850"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDP7"
FT                   /protein_id="BAA79850.1"
FT                   /translation="MQEDRVGGRLESPGGEGSRTRGDGRFFSQVGYKILKIMNSNVRVS
FT                   VCVFNYLSFTNVYFSLGCSIGRMWNTDKRLCLVDCFNI"
FT   CDS_pept        568890..569357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0870.1"
FT                   /old_locus_tag="APE0870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0870.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79851"
FT                   /db_xref="GOA:Q9YDP6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDP6"
FT                   /protein_id="BAA79851.2"
FT                   /translation="MSSMIRHRESYILSLIVGVLSASILWLASKGVISPSVYPIMASVS
FT                   ATLLGFVFTAEQLAIMILANENSTVAKILRKHNPGYINELLGLADLTMVSLFSTAIVSG
FT                   AASIFAFYPKFIAYTTMFLVGVSMMSLLILILNVQKLYHDHFNVDLSSNNR"
FT   CDS_pept        complement(569321..570364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0871.1"
FT                   /old_locus_tag="APE0871"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0871.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79852"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDP5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79852.2"
FT                   /translation="MASHEYKRNIYAYGVIAEAYTEDKKVIKLNYQFITDVVKYAQSTS
FT                   YPLNSNNNPFSPEKIPIITDIKELPANGEKYLGIVYGYLRHEGLSHFYDRKSRRHASLS
FT                   KKLSDDEDLYEYAHMILIKPGIALVEVTSFVPKHGILSTLFRGAAQEYCQRIGPQKIHV
FT                   LLKNCDKIRIAIRQLYRPDTEELLKLYSDSTIKQIDIKLKISNKARLTNQRTIDMLLEK
FT                   LGIDITKIRGQLYEAIQHAGRGKDQELDFTIDELLELFNSIREELGEESLQRFKITFGS
FT                   PRRVVDLVEDALVFREVSIPKARSGGRYLRSTDTTASLNILKELALKNSELIRESYRLF
FT                   EERSTLK"
FT   CDS_pept        570844..571044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0871a.1"
FT                   /old_locus_tag="APES038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0871a.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79853"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDP4"
FT                   /protein_id="BAA79853.2"
FT                   /translation="MRERGRAKTKRVQVTFTQEQWELIERFRGVMGNDDAEIVRNIVLS
FT                   WLAEKSVVSYRIKEKGGGAES"
FT   CDS_pept        571041..572450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0872.1"
FT                   /old_locus_tag="APE0872"
FT                   /product="DNA (cytosine-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0872.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79854"
FT                   /db_xref="GOA:Q9YDP3"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDP3"
FT                   /protein_id="BAA79854.2"
FT                   /translation="MSRYSTISLFSGAGGLDLGFVQSGRFRIVFANEILLPAAVTYSRN
FT                   LGLRLEVCGDEPRVEAQPGTIMACDVAKLDFTGLSGVDADVIIGGPPCQDFSIVRGPDW
FT                   DRRGINVKRGRLYAHFVRALASLQPKAFVFENVPGLVSANRGLAYKVILEDFARLSIRW
FT                   DEIKRIVSSNGNGGKVEGYEIVFTGIVDFSKLGVPQKRERLVIIGLRKDLAGGGFETIS
FT                   RLRARIDHVLSGKRWLLHRYPLTPIEVFEGQPLDRLGDKYKEVMLKWEGVWDEVGTERA
FT                   FEWKRRVWDRLTFDIISDYLSFNGIKHADKQELEEALMQHEVLLKELGYYGRPVYSLKL
FT                   PDSTTEPPYEGKAVVERMKRIPPDENHEFVRGTRWEVEGRGISLVYRRIHPLKPSYTVV
FT                   AYGGGGTHGYHYDRDRATLTLRERARLQTFPDSFLFYGKKPEIRAQIGEAVPPLAAKRI
FT                   AEALAEVLDAV"
FT   CDS_pept        complement(572452..573504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0874.1"
FT                   /old_locus_tag="APE0874"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0874.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79856"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDP1"
FT                   /protein_id="BAA79856.2"
FT                   /translation="MNQQTCTSAIVRAVNSGKLPREYLLYEDIKRRTRHVDTLCEGALR
FT                   GRDIEAFSSLDEWIDWLRWSTVVLDENDYLEAAVHALDLAPRLAGTDYGMSRQRDLGQL
FT                   WTDTIRGFLGELAFVKWLEREYGIKAMLDYRKGPLEEFLPSDIKEVEKDGVRRPPNLKV
FT                   SIKTTKLRGIWLDVPYRQVDHSDVFVLVRVGVTRMHFLAFLKRISAIRDKMLSRALELG
FT                   VITEGEAESIWDLIPDFTGIPAYIAGFFDKREYGSAIGRRTAIFLAEGVMKRKKFVINK
FT                   FIGYWNPKEDVYKNTVVEHLQRLGVIPSRRDVKIEFEGIGEFTKTLHFLVSSGALRRKR
FT                   EEWERIISQL"
FT   CDS_pept        573589..574260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0875.1"
FT                   /old_locus_tag="APE0875"
FT                   /product="U/G and T/G mismatch-specific DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0875.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79857"
FT                   /db_xref="GOA:Q9YDP0"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDP0"
FT                   /protein_id="BAA79857.2"
FT                   /translation="MLFLDKGRIEALRRRLIEWYRVYGDKDLPWRNTADPWAILVAAFL
FT                   LRKTTARQVVRVYEEFLRRYPNPKALASAREDEVRELIRPLGIEHQRAKHLIELAKHIE
FT                   ARYGGRIPCSKEKLKELPGVGDYIASEVLLAACGSPEPLLDRNMIRILERVLGVKSAKK
FT                   RPHTDPKMWSTARRIVPKDPDMAKEFNYGMLDLARKICTARKPLCTECPLNDICIYYNN
FT                   D"
FT   CDS_pept        574307..574792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0878"
FT                   /old_locus_tag="APE0878"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0878"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79860"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDN7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79860.1"
FT                   /translation="MSKTLESPWMLYRRKGSYGPDVEVVLMMPISVAIEDKLSLEVALR
FT                   EFGQVLNYYMTGPYDAVFIRINDVASVDDRRLAILERMASQHGIGVLVGGPPYSAFTES
FT                   DVLKLPAVISMKGNPLRVYRRGRPMSPVIRRAGDFEQLIESASRYRSFFRAESAVGR"
FT   CDS_pept        574798..576231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0879.1"
FT                   /old_locus_tag="APE0879"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0879.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79861"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDN6"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79861.2"
FT                   /translation="MRRGRERRRIPEHVVTDPFIDVAFVYSLIKDSERLDVIKRQAQVY
FT                   VDIGSKGVETATFKKYKEEAASFIIEAFGAVYKNVDKELERKFAGYDDKTVAQVKAERA
FT                   WTSLIALLASAMLMKRAGVGIGYFIPSQYADISRLEPILKVLIYEKARSRGRAASRVLE
FT                   AALKDLGVDRKLEELAEIAPTLWWVNLIMESEIIEGLLKFHYLTYVFRDRINAFVAEVE
FT                   DTLSTIEEHQADYDYGEIEVLKGLLSRCVELRGQYINKLQNALLFIKSLRPSVLKIAKP
FT                   EQWEWFIKDETLTYATMVYLAETQRLSGAGRISLSITRLLEPKKGVYAGVASALASLLA
FT                   LSPVFMQYNIEARGKAVITPADIVVAVLRLIGRHGRARDFTVGVEDAVAEIIQFWREAD
FT                   ILRRVSIYAEEDATQDMQHILDSFNASMALLLSTGIDGVHPVTSKRVLLKLPPRMIAYD
FT                   SLFVRPNAFFEMVRKVWGG"
FT   CDS_pept        576234..577838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0880"
FT                   /old_locus_tag="APE0880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0880"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79862"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDN5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79862.1"
FT                   /translation="MEREVCVNQLLKFLDSIRGRLSFRMVERLFSRGLDENPIFEAISK
FT                   SGALAKNVIIILGGRGCGKTLVMRYIKHYFEPEGWDYKYFSGDQFKEADAQELMKIISE
FT                   TRDLLENSEDYKVIVGIDDVVEASEAIRDTIKNQLVPLVVDYAGRIKLVISGQSERVVG
FT                   TTTVLHILEDTLGRSPKAEMLFGEYPGEVLRKQFRESYVRKDPIKLFRGAAMINLDAYW
FT                   SRFRSLDMAEELADVIVRLAEFYKYNSGVGECGEVSEELLKYKRGLALIALASLPKTLY
FT                   PYDKIVIEYISPEPDTPSPALNGLGISDLIYKFISGELRGLSEVAERLYSRLSQQRVAA
FT                   DVDDIKEAIMESASELTYASVVRGALPEALGIEVPEAEQGRKRKPLRPRLDFIYIDREV
FT                   GGQPSRVNIIIHVLKPDAKGYVVSSSLYKLARLVELNIPSEAEGNYLAVIVPSRAHMRA
FT                   VYRYAEIKRIGRDILVVLADSLGELDNSVVKTLADKNASEEELRLLRHIFLGTVLFNLR
FT                   DDKNVPQLIYYLAPTVF"
FT   CDS_pept        complement(577907..578191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0880a"
FT                   /old_locus_tag="APES039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0880a"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79863"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:2PG4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDN4"
FT                   /protein_id="BAA79863.1"
FT                   /translation="MDDETLRLQFGHLIRILPTLLEFEKKGYEPSLAEIVKASGVSEKT
FT                   FFMGLKDRLIRAGLVKEETLSYRVKTLKLTEKGRRLAECLEKCRDVLGS"
FT   CDS_pept        578331..578576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0880b"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0880b"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34757"
FT                   /db_xref="GOA:Q05E44"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E44"
FT                   /protein_id="BAF34757.1"
FT                   /translation="MLGGVRLITPAAQILLALARADSPLSYGEIVEITGLPPATVDLNV
FT                   KKLLAEGLVERRGRRYVLTAAGRARVESLIAEVVGG"
FT   CDS_pept        578583..578834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0880c"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0880c"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34758"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E43"
FT                   /protein_id="BAF34758.1"
FT                   /translation="MAKIVVYSVEEFRRALSRLARPQTHVIVSDGATSIVAVPRTTSRH
FT                   RHYLQYSSTSVEEIGSLVEHARREGFEVILGHVQEVAG"
FT   CDS_pept        578834..579262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0883"
FT                   /old_locus_tag="APE0883"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0883"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDN1"
FT                   /protein_id="BAA79866.1"
FT                   /translation="MGLGEVAAEVERLLGRVEEVRLEVLRLLNALPYSNCTLDYRWVRN
FT                   SSGAKYWYWYAVCIVDGRRRHVYLGKAPGERVSEIEKAGRARRLIVLHRRLLKARRRLK
FT                   AAADRAERVLDAALRDAREALEEAEQALARLKEETARV"
FT   CDS_pept        579279..579509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0883a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0883a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34759"
FT                   /db_xref="GOA:Q05E42"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E42"
FT                   /protein_id="BAF34759.1"
FT                   /translation="MEIEVVVTTGRGRGMKIYSFKAPPSMIAEFDRLARQAGLTRSEAI
FT                   KLLIKHAVANPELLRRLAGRNVPRNTELTPF"
FT   CDS_pept        579522..579803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0883b"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0883b"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34760"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E41"
FT                   /protein_id="BAF34760.1"
FT                   /translation="MAVLTRREFLLGVLWLGPRTAGEVVELAKVYSGRGPALFSPEDVE
FT                   KAVEHFLVAGLARLDSGGRLVLERESLHPGLREAAEHAAREVERLWRR"
FT   CDS_pept        579791..580021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0883c"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0883c"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34761"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E40"
FT                   /protein_id="BAF34761.1"
FT                   /translation="MEEVTILYGRRGRRRAEALAWFFERLGLRVVLREDGGEGVSVKYA
FT                   GVWWEDPDEAIRHIVSRRYTRREAPTLFDAP"
FT   CDS_pept        580035..580361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0885.1"
FT                   /old_locus_tag="APE0885"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0885.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79868"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDM9"
FT                   /protein_id="BAA79868.2"
FT                   /translation="MAGVDYRLQPYLPILNALTPAQAKAWDYLVEYVRATGRICFSYNT
FT                   LARYWPAAQTKINIQTLDRRLREFAQLRLLERREIKKDGRRRARTIFCLPEDLASFYLD
FT                   AGRG"
FT   CDS_pept        580367..580612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0885a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0885a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34762"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E39"
FT                   /protein_id="BAF34762.1"
FT                   /translation="MLSVSFTGRISKRRGQVLVLLPRDYWQLFQGLRGKKVRVRVGEVE
FT                   YTGRITVIEERVYVSLPFSALALRERSRYHLIRLEV"
FT   repeat_region   complement(581182..581492)
FT                   /rpt_type=DISPERSED
FT                   /note="APE_repC04"
FT                   /note="type C"
FT   CDS_pept        complement(581194..581448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0885b"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0885b"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34763"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E38"
FT                   /protein_id="BAF34763.1"
FT                   /translation="MCRARLGSSRSPRGRLRKPLGASLGNPGVTGVRFMNFKPYKFYWG
FT                   FPNMSYITKRYGLDRHSTSAYLIALRGIERYSPIQKDTA"
FT   CDS_pept        complement(581840..582673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0887.1"
FT                   /old_locus_tag="APE0887"
FT                   /product="mannosyl-3-phosphoglycerate phosphatase"
FT                   /EC_number="3.1.3.70"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0887.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79870"
FT                   /db_xref="GOA:Q9YDM7"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006381"
FT                   /db_xref="InterPro:IPR012815"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR033980"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDM7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79870.2"
FT                   /translation="MEARPCSGVIFTDLDNTLVGPGGEAGEAGEVYLEALDLGYRVVPV
FT                   TSKSIYEIVELWDSIGVPPGERIALAESGGAIYGPRGSLARPTGFNSEVGLEYTALGKP
FT                   LASIDALLDSLAETCGAVRLSKADATEAQLITGLPRERAALAARREYLEVIWSRSQECL
FT                   DTILSTALRYRELTYVHRAPRTVQIAAHRGKGMAIDAALQEPLLRPCAKVVVTAGDSSH
FT                   DIPIIERGMLAFRVDYNRDWSRLVKPIYMVIPYEAPKAWTMLIETVKTRSNTPSL"
FT   CDS_pept        complement(582706..583872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpgs"
FT                   /locus_tag="APE_0889.1"
FT                   /old_locus_tag="APE0889"
FT                   /product="mannosyl-3-phosphoglycerate synthase"
FT                   /EC_number="2.4.1.217"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0889.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79872"
FT                   /db_xref="GOA:Q9YDM5"
FT                   /db_xref="InterPro:IPR012812"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDM5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79872.2"
FT                   /translation="MMLSLPAKFEVFGAVRIYDVSRVLSLDGRPKSRPTNLVYVDRGEL
FT                   EDAAFRTVIVVPVKDEDLLTLENVLRSIPTESPVVVVSASTREPVDRFSNEVELARLIS
FT                   RSLQRDIAIVYQFDPAWSEALSGTPLESMVGASGRVRKGKGEGMLLGFIVAAALGADFV
FT                   GYVDSDNYVPGSALEYSWIYYSALSRATSSYSMVRIVWPYKGKLAASDMYLRKRGRVST
FT                   ITNGVLNYTLSIYKRIETDIIKTGNSGEQALTVKLGMEMNWGSGFAVETYQLVWMLENC
FT                   YLGLQAGKCPIAPDYIEVRQVSPLNPHIHAERGDEHIAEMTAVSLGTIFHSSLASEEVK
FT                   SRILDQLKSLGLAEEPPKPSTYRPAGTDPKKVFASFIAESSDSYYFAV"
FT   tRNA            584144..584222
FT                   /locus_tag="APE_tRNA22"
FT                   /old_locus_tag="APEtRNA22"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:584180..584182,aa:Arg,seq:gcg)"
FT                   /note="codon recognized: CGC"
FT   CDS_pept        complement(584257..584727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0890"
FT                   /old_locus_tag="APE0890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0890"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79873"
FT                   /db_xref="InterPro:IPR021799"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDM4"
FT                   /protein_id="BAA79873.1"
FT                   /translation="MTNIISVLNIEITVPHAVYEEVVTKGRGRPGSKELETLINQGKVE
FT                   VLAPKNRALVEALHDPLGKGESEAIALAVEHGCMLALDDRIARSKAKSMNLKVIGTIGL
FT                   LRLAYSKGLISKDKLIQALRELKEHGFRISDKIINEALKKLNLKAYQEQCEQ"
FT   CDS_pept        complement(584796..585035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0890a.1"
FT                   /old_locus_tag="APES040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0890a.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79874"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDM3"
FT                   /protein_id="BAA79874.2"
FT                   /translation="MSREVVVKVKVPSHYVGDIEREVKLAYAVDLFLRGIVSVERAAEL
FT                   AGMSLYDFLVELRRRRIQAYPYSDEELREELGIE"
FT   CDS_pept        585788..586276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0891"
FT                   /old_locus_tag="APE0891"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0891"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79875"
FT                   /db_xref="GOA:Q9YDM2"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDM2"
FT                   /protein_id="BAA79875.1"
FT                   /translation="MADFANIFLGWLHILGVVIWIGGSIVLDVILRPGSIKSMGLTQEQ
FT                   AARLGQAISKRFSPMVWISVVVVAATGVLRGARMDVLGYDALTGTTYGLILSAKLILFL
FT                   AMMVIGVMIGRTGLKLAKAGDPEESLKAQTKIRKLSEVNIAIGIVVILLAVALRYGGI"
FT   CDS_pept        586409..587476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0892.1"
FT                   /old_locus_tag="APE0892"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0892.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79876"
FT                   /db_xref="GOA:Q9YDM1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDM1"
FT                   /protein_id="BAA79876.2"
FT                   /translation="MDAVGPGEARRILDRYGADRVLLVGPPGVGKSTVVRSYAEDSASR
FT                   EGLEFVDLSEARSLEDLDTDSTYAFLHIYAPLVRAEDLAFIARRGEGYDWTLPSRLAYL
FT                   TRPGVRGLVFIDEITNVALPEVQTILFSMVLDKRVAYNRLSSGVEVVAAGNSPRDSPVS
FT                   QWPPPPLLDRFRLLIRVKPPDLEEWVSWMNSVGRPWDRRVAAVLKVKPVLMYRPPEDEE
FT                   DKFPTPRSWSQLAWELAKTGAHGDEAVRIAAMVVGRRAAEEARQFLQPDPASLDLSTFP
FT                   RLDERERLTLLSVEAGRLASQDVVELCRTLEKVGSYGAHYAVWLLMLSGVDTVEAARSC
FT                   SYVEDLLSRLSSYLG"
FT   CDS_pept        587604..588800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0895.1"
FT                   /old_locus_tag="APE0895"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0895.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79879"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDL8"
FT                   /protein_id="BAA79879.2"
FT                   /translation="MQTPQGYRAEGVQPRLPQGPRAGTEGEDGLDGCGDKISEAVAAAL
FT                   LVAPEAMLQVEIEGCSDVTSVKPGRLSLAKTLSNTRPATILSHIVTSAARAWALGEIQG
FT                   IPGPADAKLAAIECWGYIVARQAGVKPDLSALERFLAGAILLGNTPRSPLDAFRMISEL
FT                   ARRATPRGLAARLFILILRKSRAKVAAVAQSGTTRVEGLQYGGPSEMLNRAKIYMALSR
FT                   AAARRSWSRGWLRPPKRLVTLGDGVLLPGQSWGPVNRHAVLLDVSASMEGKMRVAVEAA
FT                   AHALRYPARTRVLALFDYDIRREIVNPRPVVFASSEDLSPAGGTRLSKPLSRYMPCRAD
FT                   LVTVISDWGLIEDDLNSSLALMRKHLACGGSLVLVSVSPFVKPPRGPWITLDLMSKDY"
FT   CDS_pept        complement(588816..589628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0896.1"
FT                   /old_locus_tag="APE0896"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0896.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79880"
FT                   /db_xref="GOA:Q9YDL7"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDL7"
FT                   /protein_id="BAA79880.2"
FT                   /translation="MHHRRGQANPITVVILVAVTIALAMGVYSFFQSQAGIFQRERILV
FT                   TVLAETASSIDVSIVGWVYDDSESPTIACYYLDVKNLADEPRKYVLTVLPLSQTFNELY
FT                   VPTSDISLIPVDQDTPSDGVNIYFFRVEDASGDGLLDVVGSGGSIIETSIPSCSYWRTP
FT                   DGLNDLSSSLPTKLLEPDDILMAGGPPSLAELSISHANVALAKPIPALELLLNPREART
FT                   LLIVITVDDWDQTGEILPIPTSLTLATLAPFEGDHYLATAFRLPPEVG"
FT   CDS_pept        589726..592311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0898.1"
FT                   /old_locus_tag="APE0898"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0898.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79882"
FT                   /db_xref="GOA:Q9YDL5"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDL5"
FT                   /protein_id="BAA79882.2"
FT                   /translation="MARKISSAPMRGKARRGQAEVIGGLIIITILLVFLLPLALQSIRD
FT                   VVDVGSKAREAEVRVDVKLKEELAIRGATQEEMGSTDYWPAVWIENTGTVPVTLRYMFL
FT                   LHKSTGEPLSIIDMSRARPGNPGMIKYMFLNPVMTSEGPKDGEPLPPTGEYISLAPGDK
FT                   LLVVFDSTKLPASPFQIRIRVLSAEGVLHPKTGGYGQGDLVPQAPGEAGVSGEEGGLTG
FT                   ETIAIWKGAFTPYAGFKLIGGEELKSKGSLRAFIPQLVMDKDLGVTFESAAVYSDPDYP
FT                   GLYKVVLIPGSSESFTLHLYSKSNSGSLSKVSTITCSFSGGDYVEFRGFIGTFHIYSSG
FT                   GGEQKSVMLHGHATDILVNGTSCVNGPYGLIDISDIVVDSTSEVSDFDSNGITELVLYS
FT                   YKNGPNYTPTDVNADGLDIHGTSSCDLGGVSSSAKGGGKGGGGGGGGSGSSEGDDCVDD
FT                   ALVWSYVVTRDITNQDFIRVTVKVNYYWTRVPEDISTLPTRKLRIFSVAVWEYNDDADK
FT                   WILKHLRDIGFDEELPKQFKFTTIFPIERDKKYRVGILFYDSYRQVGRSGTNATFFDFT
FT                   YGLEYLIVEYGRFNPLFSSTPPIYIVAIRDESKISGLGGDGTSELEAQDLLLDKIKSLL
FT                   EAQGLVDYVVIRDAKELCSLLLDQSLNQLPAGPPEGAIVIWLQGEADPVTVTSGVCSQA
FT                   VSSSDLKARLIYNHWIFVQPAGTPLFGSESVLQDASSGKVLLAGPGTAQITPSGLEAQV
FT                   DFGAYNMPSEAEFQYLLDVVNPDCVVDEGTFYQNTDTGYYGTLAFWADCQQPGSVELFG
FT                   IFIVNPASIDWGYNGGGLIPEAVAEITVFSALKTYKEVLEQLLNTQGQS"
FT   CDS_pept        592653..593039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0900.1"
FT                   /old_locus_tag="APE0900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0900.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79884"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDL3"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79884.2"
FT                   /translation="MTSSAGAEGVEVRVTSRVIYVPFEDGSKAFLRYRIEDGKIYLIET
FT                   YTPPQHRGKGVARRMVEKAIEIAREKGLEVVPLCSYAVYYFLKNREARGLLAEPYRSMS
FT                   DEDLKKYYEERLAAERAKNAGEKG"
FT   CDS_pept        complement(593115..593801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0902"
FT                   /old_locus_tag="APE0902"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0902"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79886"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDL1"
FT                   /protein_id="BAA79886.1"
FT                   /translation="MEALYRSVEQLVLNNMGLDYLGLSSDEIRDVLEPIVLEAASKLSR
FT                   PTAEGIARKIIGQKHLFLKALASRLAESVDRLTRERLEFIVQNAPEIAGKAAPALYDVA
FT                   RRLGADDIVEELRMLWEAYGSPTKARCPKCGFKALTPELWCLVCKRTSSEEEFKEYIGF
FT                   QGLLERWASRAPEEIVEEVLRSSIIYYEDGALAAPSEPKTPLAVPLTLGSREKSIVKKR
FT                   LETRLR"
FT   CDS_pept        594001..594750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0903.1"
FT                   /old_locus_tag="APE0903"
FT                   /product="misacylated tRNAala hydrolase AlaX"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0903.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79887"
FT                   /db_xref="GOA:Q9YDL0"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDL0"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79887.2"
FT                   /translation="MKTVLLYQQDSYLREFEARVEEASGGRVVLDRTAFHPGPHGGLDT
FT                   DTGYIFYGDKRYRVVRAAVEGDVVAHYLDSDTATLEPGAVVKGVIDWERRYRMMRLHTF
FT                   SHILAAVLYEKHDVLVTGGHITPDYGKDDFSIEGGGWREVIEEAFREANEIASRCIEVK
FT                   VYWLPREEALKIPGIVKLANKLPPEVETLRIVEIPGVDVQADGGPHVRNTCEIGRVVIT
FT                   KLESKGKRRKRVYYTLEEALEPTPEAP"
FT   CDS_pept        594850..595206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0906"
FT                   /old_locus_tag="APE0906"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0906"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDK7"
FT                   /protein_id="BAA79890.1"
FT                   /translation="MAGLGRRWVLYKEAKRVLEDIGELRLHSPKTIYTGDMEEALEEGS
FT                   EVFRLIESGGNPGWYAVRRPYSGVNIEFYLLSRMSAALRLRMMELNKLYVTGLDYFHKR
FT                   LDSAVSRAYSLVEA"
FT   CDS_pept        595386..597050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0907.1"
FT                   /old_locus_tag="APE0907"
FT                   /product="thermosome alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0907.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79891"
FT                   /db_xref="GOA:Q9YDK6"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDK6"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79891.2"
FT                   /translation="MAATGYPVLILKEGTQRTYGREALRANILAARVLAEMLKSSLGPR
FT                   GLDKMLVDAFGDITVTNDGATIVKEMEIQHPAAKLLVEVAKAQDAEVGDGTTSVVVLAG
FT                   ALLEKAEKLLDENLHPTIIIEGYTKAMEEALRLVDEAAVPVEVEDDSVLRRIAETTLAS
FT                   KFVGTGPERDKIISMVIDAIRTVAEKRPDGGYEVDLDYVKIEKKKGGSLLDSKLVRGIV
FT                   LDKEVVHPAMPKRVENAKILVLDAPLEVQKPELTTKIRVTDIEKLESFLEEETRMLRDM
FT                   VEKIAATGANVVITQKGIDEVAQHFLAKKGILAVRRVKRSDIEKVAKATGAKIVTSLRD
FT                   LKPEYLGYAELVEERKVGEDKMVFIEGAKNPKSVTILLRGANDMLLDEAERNIKDALHG
FT                   LRNILREPKIVGGGGAVEVELALKLKEFARTVGGKQQLAIEAYAEALETIPTVLAESAG
FT                   MDALEALLKLRSLHSQGYKFAGVNVLEGKIEEDMTKINVYEPVLVKKQVIKSASEAAIS
FT                   ILKIDDVIAAAPPKKKEKKGKTGEEEEEEGGGSKFEF"
FT   CDS_pept        597205..597987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0912"
FT                   /old_locus_tag="APE0912"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0912"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79896"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:2Z1N"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDK1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79896.1"
FT                   /translation="MDLGIQGKLAVVTAGSSGLGFASALELARNGARLLLFSRNREKLE
FT                   AAASRIASLVSGAQVDIVAGDIREPGDIDRLFEKARDLGGADILVYSTGGPRPGRFMEL
FT                   GVEDWDESYRLLARSAVWVGRRAAEQMVEKGWGRMVYIGSVTLLRPWQDLALSNIMRLP
FT                   VIGVVRTLALELAPHGVTVNAVLPSLILTDRVRSLAEERARRSGITVEEALKSMASRIP
FT                   MGRVGKPEELASVVAFLASEKASFITGAVIPVDGGAHI"
FT   CDS_pept        598062..598373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoK"
FT                   /locus_tag="APE_0914"
FT                   /old_locus_tag="APE0914"
FT                   /product="DNA-directed RNA polymerase subunit K"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0914"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79898"
FT                   /db_xref="GOA:Q9YDJ9"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDJ9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79898.1"
FT                   /translation="MAERYTSYPRIVDDVKIGPPYLTKYERARIIGVRAFQLSIGAPPL
FT                   VDPERAGSRNPLDIARYEVDNGILPVSIYRYLPGGGGQSLSLSRLVELAREILGSEYV"
FT   CDS_pept        598442..599509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0915.1"
FT                   /old_locus_tag="APE0915"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0915.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79899"
FT                   /db_xref="GOA:Q9YDJ8"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDJ8"
FT                   /protein_id="BAA79899.2"
FT                   /translation="MIDCVEVVSRYFEILEVKRGAGRLAVSLGLPLRGGDLEDIMSSLY
FT                   KDLTTAGCYPYFSREEAGLILYIHRPEAGARRWAMALALAAATIATVYMSGLALADPSK
FT                   GLSWSPLAYLVGLLLPLLVHEMGHWLVMRLNRVPASLPYMIPAPPLQLGFLGTFGAVIN
FT                   MRWLPPTLDSLTVMAVMGPLAGFVAAVPLAVVGLQHSLLLPPHEAAARGDLIGIPLMPL
FT                   VMVLLGDALGFPSDSVVVLSPLAFASYVVFIVTFLNLIPVGMLDGGHIVRGVVGERVHQ
FT                   AISLFVVVASLLASVYIPQLSLFALLALLIYMMTGGRHPGAAIRISTPGWKSVASTLIY
FT                   TLLLVLTLPLPLSLS"
FT   CDS_pept        complement(599458..600330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ocd"
FT                   /locus_tag="APE_0916.1"
FT                   /old_locus_tag="APE0916"
FT                   /product="putative ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0916.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79900"
FT                   /db_xref="GOA:Q9YDJ7"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDJ7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79900.2"
FT                   /translation="MGSVVEPRSLIRLLEELLRSEHAEAPRSSISLEGSWLGAMVAGGM
FT                   GYFSAKIVGVYPGNPSRRLPLVRGVLLLFRSSDGEKVLDIPAEEPTGWRTAAASALALS
FT                   KLGFGGGGVLGVIGAGVQARYHLRVLTSVFRFDEILVASRRVETGERLAREFGGRRVGR
FT                   RELLKRSHVVIAATNSTDPVVEGGLLRRGAYVASVGAPRPVRELDDQVKRRAGCMLVDS
FT                   DIACEESDDACGVETVTLRDYVRGVASCRWGDVYVYKSVGTPVFDLAAAIHIYERLRGS
FT                   GSVSTSSRV"
FT   CDS_pept        600515..602017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livK"
FT                   /locus_tag="APE_0917"
FT                   /old_locus_tag="APE0917"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   branched-chain amino acid-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0917"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79901"
FT                   /db_xref="GOA:Q9YDJ6"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDJ6"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79901.1"
FT                   /translation="MNVAKIGAVLLALALIAPVLFATPALYTAAAQPTTITIGALLPLT
FT                   GDLQSYGVRAQAAVQVAVEDVNAYLESKNAWFRLDLKVEDTQTKPDVAVQKFNSLVAQG
FT                   IKFIVGPMTSAEVKKLKDLADQNNVLIISPSSTAIELKIAGDNVFRFCPTDDVQSKAIG
FT                   ALARDLGLKGAVIINRADTWGNGLMEATKEVLENEGVEVASVYSYNPESPNFSGIASQA
FT                   NGDVESLVSKYGKDKVAVVAIGFKEVVELFSAAADYETLESVLWIGSDGTAQLSEFTTD
FT                   PLAREFSVSTLFINPLFSPAATEAQEKVRQEVVAKIGEEPDAYSLAAYDAVWAIALALL
FT                   QAGPMDNPDEMVNKVKELLPQITTSDEFAQFAATGKFPLDEGGDRATADYDWHIVAKIG
FT                   GEYKWVKAGVYKGVEDKNEWVTIEGLGKTFPQLFQEKFTPAETETETSPSPTQAETTPT
FT                   PTPEETETETAEEGGVSTTLIAAIIIIVIVIAAAAYFFLRSR"
FT   CDS_pept        602220..602984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livG"
FT                   /locus_tag="APE_0919"
FT                   /old_locus_tag="APE0919"
FT                   /product="branched-chain amino acid ABC transporter, ATP
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0919"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79903"
FT                   /db_xref="GOA:Q9YDJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDJ4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79903.1"
FT                   /translation="MAGDIILRVEDLEKRFGGIVALDKVNLEIERGKVTLLIGPNGSGK
FT                   TTLVNVISGFYKPDGGRVLFKGRDITGMSPHEISKLGLVRTFQIPKPFTNLTVLENVLT
FT                   AADSPGENVYLAGLARRLWLGFEKRAAARAFEILGWVGLDHMWDRRSGELSGGQMKLLE
FT                   IARAIMKGAEMIIMDEPAAGVNPRLAGSIMERIKYLAREKGITFLIIEHRIGLVKEYVD
FT                   RVYAMSMGKVIASGKPDEVLNNPVVLESYLGG"
FT   CDS_pept        602987..603700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="APE_0921"
FT                   /old_locus_tag="APE0921"
FT                   /product="branched-chain amino acid ABC transporter, ATP
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0921"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79905"
FT                   /db_xref="GOA:Q9YDJ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDJ2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79905.1"
FT                   /translation="MGDWIIKLEDVSAGYGKLQTLFDVSLEIPRGLITVIVGPNGAGKS
FT                   TLLKTMFGFTTVYKGRVLFENTDVTHMPPHDRAKIGMTFIFQLENIFRELTVYENLRLA
FT                   GYDLPEDVFRDRLEEVFSMFPRLKERLGQKAGTLSGGERQMLAMAIGIMRKPKVFLIDE
FT                   PTAGLSPKLAKEVLSYVRILNKEGYTVVLVEQNVKASLEIGDKGVLVVNGRIAFDGPAE
FT                   ELLARKDLAKMYLGV"
FT   CDS_pept        603714..604778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livH"
FT                   /locus_tag="APE_0922"
FT                   /old_locus_tag="APE0922"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0922"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79906"
FT                   /db_xref="GOA:Q9YDJ1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDJ1"
FT                   /protein_id="BAA79906.1"
FT                   /translation="MVDVKVVFDMLAYSGVIALLSLGITLAYITTRVFNFAHPRIANVG
FT                   AYAAAASMALYVDLVRDEGIGRFKVSLGPLEVTGLVAPDVLAVGIVFAVIAGIITALAE
FT                   YYLVLRPLIERGADFLKLMIATLAFDFFVIATLFILGTHISVKELVSGVFGRETTSLSL
FT                   HAFDARIDLAVLGYKLRGIMLFSFLGSLAIALMLYILLFKTKLGVKMRASIENPSLAEV
FT                   LGINVQQVYTIAWIISGATAGFAGFLILFMGDIVKPVTASSPADEIIVSAFAGSIVGGV
FT                   NSVFGSIGGGFIIGAVEILISSVITDVTGIDVTRYNKMLSMLAVALTLLFAPQGLAALY
FT                   SEKIQARLPRLRGG"
FT   CDS_pept        604791..605954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livM"
FT                   /locus_tag="APE_0924.1"
FT                   /old_locus_tag="APE0924"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0924.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79908"
FT                   /db_xref="GOA:Q9YDI9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDI9"
FT                   /protein_id="BAA79908.2"
FT                   /translation="MPSVDITFLVEFIVAYVAVYYVLTSSLNLKAGVTGIPDFGQAMFF
FT                   AVGGIVVGNLAARIAAALAGMDPSLVIAENTTTLEVLNSEFFPNRPLESIAILVVAIAS
FT                   ALALGGLLGLLASYPALRLRGDYLAIMLLVTAEALRIYTTYSVWLMGSTPTVGLTLPSL
FT                   LAWTGDPGLASILLTLAIAVAVYIYMERLYNSPAGRLMRAVRDDEDASKALGKDVAKVR
FT                   RNAMVVGSALAALAGVLYSINPLLAGSSVAAVSIFDRMLWTFWPWALMILGGMSSNRGV
FT                   AIASVVTGAAILGPIRLYKAELARLLRVDALGFDTDKFAAGLEFILIGPLILAILFLRP
FT                   QGIIPEPPSRTLPEKDIEEIKARTAGQTGSETPQGEEEPPASDTEAR"
FT   tRNA            606038..606114
FT                   /locus_tag="APE_tRNA23"
FT                   /old_locus_tag="APEtRNA23"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:606072..606074,aa:Ile,seq:gat)"
FT                   /note="codon recognized: ATC"
FT   CDS_pept        606207..606680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0928.1"
FT                   /old_locus_tag="APE0928"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0928.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79912"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDI5"
FT                   /protein_id="BAA79912.2"
FT                   /translation="MSFERTVDSRVGPLDSTTRAFLFSDLLSSVDIFVASVTASMVSSD
FT                   ERLLSVALTELEYLLGETAHLRDIEGSLEVVGGAKAGIYQILASLGPEGLRTLLASSIE
FT                   ALEGYGSPEPSLAAELARLSGWRVDPGRLEHVTAASAVLLTVAAAFLKEVSSF"
FT   CDS_pept        606787..607980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0929.1"
FT                   /old_locus_tag="APE0929"
FT                   /product="putative 3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0929.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79913"
FT                   /db_xref="GOA:Q9YDI4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDI4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79913.2"
FT                   /translation="MGRAVAIVGTGHSKFGVRNDVNIAELAWEAMREAASEAGIELRDV
FT                   DQVVVGNAGGWSSEYLSSIVLLEYAGISGKPVYRVEAACATGSAAIKAAHDAIAAGEAD
FT                   LVLVVGVEKMNESPTPIVVEMIGRAGNYFWEFENFGLTFPGYYALYATAYMSEFGATEE
FT                   DLCRVAVKNHHHASMNPKAHFPRAITLEQCLQSRYVAWPLKLYDSSPITDGAAAVVMAS
FT                   EDLARKLTDSPVWIHSIGMASDTSNLSKRPDFLVHRASRLAAERAFKKLGIEIEGSYKH
FT                   FDFANVHDAFTIAEILAYEAMGFAKLGEGYKLVREEQTYVGGLIPVNLDGGLKAKGHPI
FT                   GATGVSMAVEHVRQLQGRVEKGRQAEIKRGRSLAHNVGGTGHYAFVTVYGLDKPRSR"
FT   CDS_pept        607994..608533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0930.1"
FT                   /old_locus_tag="APE0930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0930.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79914"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDI3"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79914.2"
FT                   /translation="MSQKRLMDEFMSQVEAFAEEMKRSMGLPILLDQKTGVAMWFDQRE
FT                   LRIRFAISIEKIRRFFEGLTEGKILATKCVKTGKIYFPPQVDCPDAPDSEVEWVEIPRE
FT                   GVLLTYTVINTKPYTFSHYPDYVVGIGKVAEGLNILAWVRGDPRKLRRGMKVRLEVVKR
FT                   EPEGYLTYEWVPVEEG"
FT   CDS_pept        complement(608538..609422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dphB"
FT                   /locus_tag="APE_0931"
FT                   /old_locus_tag="APE0931"
FT                   /product="probable diphthine synthase"
FT                   /EC_number="2.1.1.98"
FT                   /note="diphthamide biosynthesis methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0931"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79915"
FT                   /db_xref="GOA:Q9YDI2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="PDB:1WDE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDI2"
FT                   /protein_id="BAA79915.1"
FT                   /translation="MARGREAVTLLLVGWGYAPGMQTLEALDAVRRADVVYVESYTMPG
FT                   SSWLYKSVVEAAGEARVVEASRRDLEERSREIVSRALDAVVAVVTAGDPMVATTHSSLA
FT                   AEALEAGVAVRYIPGVSGVQAARGATMLSFYRFGGTVTLPGPWRGVTPISVARRIYLNL
FT                   CAGLHTTALLDVDERGVQLSPGQGVSLLLEADREYAREAGAPALLARLPSVLVEAGAGG
FT                   GHRVLYWSSLERLSTADVEGGVYSIVIPARLSGVEEWLLAAASGQRRPLEYDRSVYETV
FT                   EENCKKGVYMEPV"
FT   CDS_pept        complement(609398..610360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0932.1"
FT                   /old_locus_tag="APE0932"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0932.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79916"
FT                   /db_xref="GOA:Q9YDI1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDI1"
FT                   /protein_id="BAA79916.2"
FT                   /translation="MNGGSGGLRLGVLSVFDPWNSPLCVCPFKYSLNPYTGCSIGCRYC
FT                   YATAYIGVKPSTPKRRLVGRLERDLGRIPPGALVNIGTSSDPYPPEEEKLGLTRRALEV
FT                   LAPRGYRLLITTKGTLYAWRDLDILSRANAAITPSITGLGGNSLLRAVEPGAPGQDERI
FT                   AAAAAAVRSGVPVGVRVDPVIPYVNDDPHELKELVGRLAEAGVRFIVTSTYKARPDNLS
FT                   RMRRALGAEGERLYRLYRERGVYMHGYIYLPEEVRRRLLKPVIEEAARLGLEYATCREG
FT                   FTGREWFNAESCDGSHLIPIRISPRRAAAMEKWLEGGRP"
FT   CDS_pept        610658..611482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0934"
FT                   /old_locus_tag="APE0934"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0934"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79918"
FT                   /db_xref="GOA:Q9YDH9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDH9"
FT                   /protein_id="BAA79918.1"
FT                   /translation="MSSIVTLQTGLIYLVASSFAVGVIAGYLVYMRLLRWFSSKVEEIE
FT                   QDFLLSALPRRPDSPGGKTLYARAGSLAMAPESPLEAFPGGEDLGIAGGFEDVERLEEA
FT                   LFKVWALVKTIVEGAIGRRFEAVIIVADDDEYGGVPVAIYPETSVAYVDDDIPGDEVSV
FT                   VIEGSTVSVVLPLSVYKVLVDVVEDGETATVKSIRQAKTLYSIAKKIASSSSGDERIAA
FT                   YIAYKTLVNLSKKGVVRFEGSTLDSIPFENDELRLKIKEQVRLESDSTGIRM"
FT   CDS_pept        complement(611982..612995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0935"
FT                   /old_locus_tag="APE0935"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0935"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79919"
FT                   /db_xref="GOA:Q9YDH8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDH8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79919.1"
FT                   /translation="MKFLRCKEIPPSTGKTVSIIGAGPAGLGAAGFLRCRGHEVVVYDM
FT                   MPEPGGMMMFGIPDDRIPKDNIRKSVRELVEGGARIILNNKVGRDISLEDIIKASDAVL
FT                   IATGTWKPRRLGAPGEDLPWVLPAADWLVEVHMARYGYLPWAKVPKVGGRILVVGGGLT
FT                   AADAVHVPLTYPEFKDGVEKVVLSYRRTRDYAPMRKNEFERLIKMGAEAWELTQPIAFY
FT                   EEGGRKVVKFVRMELKASDSGRPKPVPIEGSEFEAEFDWALLAIGEVPTPPFNNGCCGI
FT                   ELNPDGTIKTDENFMTTRKGVFASGDVRHGPSLIGKALKSGLDAAQKVHLYLTGQL"
FT   CDS_pept        complement(613140..613826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0938.1"
FT                   /old_locus_tag="APE0938"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0938.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79922"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDH5"
FT                   /protein_id="BAA79922.2"
FT                   /translation="MRECSCRGSGLTTSSLLCSCRGEDLVVKDYSRKGVKWLITLPYAP
FT                   VYRYIYSPEGRLRNELKWYRSLRGAYPVPRIVAYCIGEKPLLIREYVDGEPVSNSLDED
FT                   AWKALGSGLARLHFSLGMVLGDPNPGNFIYSLGEAWLVDFEQADDYTPQKAAWDLLVLA
FT                   ATTITLASPLKWRFVEAALSSYREAAGDRWSEVLESLGGVRLKLLNPLLVSPLHALRFY
FT                   RLARSL"
FT   CDS_pept        complement(613838..614140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0939"
FT                   /old_locus_tag="APE0939"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0939"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79923"
FT                   /db_xref="InterPro:IPR007547"
FT                   /db_xref="InterPro:IPR040459"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDH4"
FT                   /protein_id="BAA79923.1"
FT                   /translation="MGRRRSDIYEAVRRVLNYPLEDRGDYSIVYRHRVEGVGEVLREAR
FT                   LESVARVDKWAVHLVNGDSIPLHRIVEIRGPRGETVWRRGLGWLEDLSSRRRTAD"
FT   CDS_pept        complement(614127..615140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0940"
FT                   /old_locus_tag="APE0940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0940"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79924"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDH3"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79924.1"
FT                   /translation="MTVYTKDFTGLLKTLEAGGRVLIVYLMNPDGIISAYHVMRLLKPQ
FT                   ARDEAVLKPVAGWRARIEAPGERFDLALYLGVVPEGGVEAASTYALLYRRTSGVRHAIV
FT                   LDPGVPDALSIDSKLSIGAGDYHPLMAAASMVSVAWDASRGNMLYRRFMEEAGLDPSTD
FT                   YWIPEAIASNLEGVEEACKMEAASWYPRLFSYDTAEPAKSAFEDAMLASLRAQEDFEAD
FT                   ELASSLEGGGDRVCGWRVGRLDYNGFIHKRVARVLWSRLGEPVFVYGVNRCGGQRVFSL
FT                   ASGPGGLASAVEKASPYWYGGEGGGRAFYSGYLEKHPSREDLARILCREAGQGGEA"
FT   CDS_pept        complement(615181..615984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0941"
FT                   /old_locus_tag="APE0941"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0941"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79925"
FT                   /db_xref="GOA:Q9YDH2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDH2"
FT                   /protein_id="BAA79925.1"
FT                   /translation="MTRVTPSRAATYAILAIMYLPIALLALQSLNSSPYIGVWEGLTLK
FT                   WYGMMMGDERLHAAAYNSLAIAAASAVSSTLLGVAAGLAVRRHGKVGLVDAIMYPPLVL
FT                   PEIAEAAALLLFLTALDVDLGLKTVVIGHTAFNIAYVYVVAAPALQRSSSLEDAARTLG
FT                   ATPARTLVTITIPLAAPAIYAGFTLAFILSFTDFIKTLFTRGPGIETIPILLWNRARRP
FT                   GLSEFSSFSYLAAITMVLLAVSLAVALAYVILSTRLGGRRFRGDT"
FT   CDS_pept        complement(615985..616758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0943"
FT                   /old_locus_tag="APE0943"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0943"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79927"
FT                   /db_xref="GOA:Q9YDH0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDH0"
FT                   /protein_id="BAA79927.1"
FT                   /translation="MLRSSSIAGYTALLAAPAALYLLAFFYAPLAYLAVYSGEEGFLGP
FT                   YLEVLTRPHYYVVIANSAAVAAATALAVMLLALVPSYYIALEAGGRERIVLLALFVSPF
FT                   IVDVLLRTLSIKLVLTLVGVKPGWTATFIGLVYENLPLGILFAFAGVSGVSRSLVEAAR
FT                   TLGAGRLEVYRSVVAPLALPWLAAGFVVVFLISFTDYVVPSLLGGTTGFTVGSLIYHLI
FT                   LSGDRWDLGSAVTLMVTLLSAAAAYLVFRQAYRVL"
FT   CDS_pept        complement(616742..617770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0944.1"
FT                   /old_locus_tag="APE0944"
FT                   /product="spermidine/putrescine ABC transporter, ATP
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0944.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79928"
FT                   /db_xref="GOA:Q9YDG9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDG9"
FT                   /protein_id="BAA79928.2"
FT                   /translation="MGGVEVRLDNVHASYGEVEALRGVSFSFPESSITAVLGPSGCGKT
FT                   TMLKVIAGLLKPRRGRVFFGGVDYTGLPPERRSVGFVFQDLALFPHMTVYDNVAFGLRA
FT                   RGFSGGEVRRQVEWALETVGLTPPREFMGRRVTGLSGGQQQRVALARAIAYEPPVLLLD
FT                   EPLSHLDFKIRQRLLAELKRLQRKLGSTMIYVTHDQWEAMELADTLVIMRDGRIVQHGT
FT                   PSEVYTRPANVYVATFFGDANIIPKELLTPGSGGEWAIMVRPEDLEIVRNGSPVPQGWP
FT                   RLEAVVEDLVFQGPLIRVELRWRGGRLRAVVPRRTASSLPRPGEAVSVTWSPDRGVDVA
FT                   LE"
FT   CDS_pept        complement(617865..619079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0945.1"
FT                   /old_locus_tag="APE0945"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   spermidine/putrescine-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0945.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79929"
FT                   /db_xref="GOA:Q9YDG8"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDG8"
FT                   /protein_id="BAA79929.2"
FT                   /translation="MKRAILAGVAAGLVIVAVLAPLVAAVLMGAAASASDRTIKVLNYS
FT                   EYIDYEVLRIFEERYGIKVVYDEYESAEEAWPYLKAGGGGYDVIIIAHSHVRLAIEQGL
FT                   VRKLDKSMIPNLSNLDPRIASHPADPTQDYAVPYMWGTTGVAYVEGCVEEPPSTWKEFL
FT                   SKSYLEKYSGKVSLLSEFSEVVEAGMIALGLDPSDRSSWTEENIDRVVELIIELKPYLA
FT                   GFYGASQYIPGLVNGELCLAQAWNGDALIAADENPEVGYVAPEDGTLFWVDYMVIPRDA
FT                   HDVEAAHLFINFLLEPEIAAMNVKAVWYAPSIKKELLEPLAEGDEELREVLDNPLVYPP
FT                   SNAKLIPSPVLDSEMQSLVEDARSRILASQPSNLDSTLVIVVGVVVLVVAAAFLYRLSR
FT                   GRAGG"
FT   CDS_pept        complement(619287..620204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="APE_0946"
FT                   /old_locus_tag="APE0946"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0946"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79930"
FT                   /db_xref="GOA:Q9YDG7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDG7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79930.1"
FT                   /translation="MALFDPKVATLAPPKRVRFVIRKYDPESGRSWWQEHEVETYRGMT
FT                   VLDALLKIKEEQDHSLTLRYSCRMAVCGSCGMTINGTPRLACQTQVAQVAREDAPVVRV
FT                   EPLYNFKVVKDLLTDFTEFFEKHRRVKPYLIRRDVDEQENPTLEYKLLPEEYEQFYQYS
FT                   LCIACGLCVAACPIFASDTKFLGPQALSQAYRFVVDPRDEGYVERLEIVDSIDGVFGCH
FT                   FAASCSAVCPKEVDPAGAIQRLRSLLLKYRLGLYKKRINGVVPPMEAKKERVPLPPEAQ
FT                   PLDGVDVEKLEETPPEIPVEKLVA"
FT   CDS_pept        complement(620226..620579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="APE_0947"
FT                   /old_locus_tag="APE0947"
FT                   /product="putative succinate dehydrogenase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0947"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79931"
FT                   /db_xref="GOA:Q9YDG6"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDG6"
FT                   /protein_id="BAA79931.1"
FT                   /translation="MAVKSSYMQLLQYVTAALLVVLVSWHLALRLPWLHGVESFVHTLM
FT                   PEVVYREITSFSLLLLLAYTALIHGVNGLRIILLEVHHGELWDKAVNAAAVLALLVFGA
FT                   LATYTVVGVEPPA"
FT   CDS_pept        complement(620593..620952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="APE_0948.1"
FT                   /old_locus_tag="APE0948"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0948.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79932"
FT                   /db_xref="GOA:Q9YDG5"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDG5"
FT                   /protein_id="BAA79932.2"
FT                   /translation="MHRITGVITAFFIFFHIISTSAPARSGWEAWLEEVANLDGITPIS
FT                   ILFYIAMGAVLFHGLNGVRLLLVEALALGIGRPEKPKPPYIAPSLRGFQRRLIHIVFAL
FT                   WIILWIALGYVLFLT"
FT   CDS_pept        complement(621140..622891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="APE_0950.1"
FT                   /old_locus_tag="APE0950"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0950.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79934"
FT                   /db_xref="GOA:Q9YDG3"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDG3"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79934.2"
FT                   /translation="MPKPEIIEHDVVVVGTGIAGLRAAVEIKRRYGDKLDVGLVSKIHL
FT                   MRSHSISAEGGTAAVIYKEEGDSYALHAWDTIKGSDFLADQDAVWIFVKLMPEEVRLLE
FT                   HWGMPWSRRPDGRLAVRAFGGHSVKRTLFAGDKTGFYEMHTLYNKLLQYDGWERYDEWY
FT                   ATNIVVEDGEFRGVFAINPRDGDIYLFKAKAGIIATGGAGRLYNFATYAHTVTGDGWGM
FT                   ALRAGLPLKDPEFFQFHPTGLIPSGILITEGARGEGGYLLNNRGERFMLRKECAPKMAE
FT                   IAPRDIVSRCIIREILEGRGFKDDVSGLEYVLLDLRHLGEEKINERLPAVREIAIRYAG
FT                   IDPVEEPLPVRPVAHYTMGGIRTDSYYRVLDAEGRWVRGLFAAGEVAAASIHGANRLGS
FT                   NSTAECLTSGRIAGMLAAEYALKAEARGVEPERFEKEEAWVYGLVKRESGTPSYAIKRE
FT                   LRDTMGKYFYVIRDEEGMRRGLLTILKLRKMFREDVYVEDKGRIYNTDLIAALETANML
FT                   DAALAVAKAALNRAESRGAHYRVDYPKRDDENWLKHTLVTASGEDDVRIDYEPVRITTW
FT                   KPVERKY"
FT   CDS_pept        complement(622982..623413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="APE_0951.1"
FT                   /old_locus_tag="APE0951"
FT                   /product="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0951.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79935"
FT                   /db_xref="GOA:Q9YDG2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDG2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79935.2"
FT                   /translation="MGGQVIEVEVAGVRFLLRKDLRYTESDEWARLEDGVATVGITDFA
FT                   QKELKDIVGVELPEKGRKVKKGEAVATVESIKATADIYAPLSGEIVDVNEKLLDQPELI
FT                   NDDPYGEGWIFKIKVEDPGEFESLLTPEQYVESVRKRKE"
FT   CDS_pept        623521..624243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hxlA"
FT                   /locus_tag="APE_0952.1"
FT                   /old_locus_tag="APE0952"
FT                   /product="hexulose-6-phosphate synthase"
FT                   /EC_number="4.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0952.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79936"
FT                   /db_xref="GOA:Q9YDG1"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDG1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79936.2"
FT                   /translation="MTGHSRVPGRLGSSLAECGYVLQVALDYTSLWDAVSLASRIGARR
FT                   GVALEVGTPLLKAHGARDSVAALRGVAGEEAPVVVDTKTADASDVEADIVASSGGDAFT
FT                   VVAAAHDVTLKQAAEAAVQRGVAVYGDLVVSRDPLLDARRVVDAGVHIVLLHLGLDVQR
FT                   ALGLTASSRVDLVRRIASEIDATIAVAGGVKPREAGALASAGASIVIIGGAITGSPDPG
FT                   REVEKALESLRGEGFRCR"
FT   CDS_pept        624234..624947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0954"
FT                   /old_locus_tag="APE0954"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0954"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79938"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDF9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79938.1"
FT                   /translation="MPLEPGSLSSLEAKDLPGRALPVLPFGSVEQHCSLPLATDALLAE
FT                   AAARGACELLEREHGVACLLLPTMYYGFSPEWAGYPGTLSLSLSTISGVVRDLLESLRS
FT                   WGFDRAAIINGHGGNTSVLEAAAREASRSLSMVVGVASYWAFLPAQDLGHGGDVEASLL
FT                   KHLAGVEAPRDGGCRSVRISQVGRWIISPGVRGGVGAYSHGSGPVTRVGVEEMLRGLSR
FT                   FLYSVWRQPVEEQSI"
FT   repeat_region   624960..625268
FT                   /rpt_type=DISPERSED
FT                   /note="APE_repC05"
FT                   /note="type C"
FT   CDS_pept        624975..625256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0954a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0954a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34764"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E37"
FT                   /protein_id="BAF34764.1"
FT                   /translation="MPSCNKLWQVVSGTAGFITVSPGPPTEAPGGFPREPRGHRVRFMS
FT                   FKPYKFYWGFPNMSYITKRYGLDRHSTSAYLIALRGIERYSPIQKVTA"
FT   CDS_pept        complement(625330..626217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0955"
FT                   /old_locus_tag="APE0955"
FT                   /product="voltage-gated potassium channel"
FT                   /note="KvAP"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0955"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79939"
FT                   /db_xref="GOA:Q9YDF8"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="PDB:1ORQ"
FT                   /db_xref="PDB:1ORS"
FT                   /db_xref="PDB:2A0L"
FT                   /db_xref="PDB:2KYH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDF8"
FT                   /protein_id="BAA79939.1"
FT                   /translation="MSVERWVFPGCSVMARFRRGLSDLGGRVRNIGDVMEHPLVELGVS
FT                   YAALLSVIVVVVEYTMQLSGEYLVRLYLVDLILVIILWADYAYRAYKSGDPAGYVKKTL
FT                   YEIPALVPAGLLALIEGHLAGLGLFRLVRLLRFLRILLIISRGSKFLSAIADAADKIRF
FT                   YHLFGAVMLTVLYGAFAIYIVEYPDPNSSIKSVFDALWWAVVTATTVGYGDVVPATPIG
FT                   KVIGIAVMLTGISALTLLIGTVSNMFQKILVGEPEPSCSPAKLAEMVSSMSEEEFEEFV
FT                   RTLKNLRRLENSMK"
FT   CDS_pept        626278..627063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0957"
FT                   /old_locus_tag="APE0957"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0957"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79941"
FT                   /db_xref="GOA:Q9YDF6"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDF6"
FT                   /protein_id="BAA79941.1"
FT                   /translation="MSQEASVDGRFGVASSPTIEEAAGLLEKLLDGSSMVVVAGVCSSE
FT                   YEGRGASVSTEGDKLLIVKPGGAVILHGPRGFRPLNWQPSTSHTEVATADGLLTLKFYR
FT                   RTPREVLKIACGSIWYIAWVRFPEEGAFWMYMTEDDLRKAVALHPRELLGEDIRFFAEE
FT                   KRTPSGKADLYGVDERGNIVIVEVKRVRADESAVRQLEGYVRDYPTQAKVRGILVAPDI
FT                   SDAARRLLESRGLEFRRVDLKKAYSLLKPGRGRSVLDFL"
FT   CDS_pept        complement(627081..627365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0957a"
FT                   /product="putative small nucleolar RNP protein Sm"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0957a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34765"
FT                   /db_xref="GOA:Q05E36"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E36"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAF34765.1"
FT                   /translation="MAAKGGKQLVNPFKYLKEHLNSQIYVKLKDGSEYVGKLVATDTTM
FT                   NLILDDAIEVADNGTRLVAKIGRVLIKGSMVEFISFDASTAAEKALTGV"
FT   CDS_pept        complement(627391..627918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ogt"
FT                   /locus_tag="APE_0959"
FT                   /old_locus_tag="APE0959"
FT                   /product="methylated-DNA-protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0959"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79943"
FT                   /db_xref="GOA:Q9YDF4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDF4"
FT                   /protein_id="BAA79943.1"
FT                   /translation="MARPGHSGRVTPGLISNPEVKPAALEAPVGSERPCRGLQAGAGPL
FT                   QRPVPTMSPATSSLIVYTLLHLIPPGKVTTYSSLARASGLSPRAVGRILARNPSPIAVP
FT                   CHRVVRSDGSIGGYSMGGPRVKAALLKLEGVRLYRSGGSWRVHPEDIVDLSSILLDPPE
FT                   GSAEALSTVKAD"
FT   rRNA            complement(627802..627920)
FT                   /locus_tag="APE_rRNA01"
FT                   /old_locus_tag="APErRNA01"
FT                   /product="5S rRNA"
FT   CDS_pept        complement(627961..629115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0960"
FT                   /old_locus_tag="APE0960"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0960"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79944"
FT                   /db_xref="GOA:Q9YDF3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR007330"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036181"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDF3"
FT                   /protein_id="BAA79944.1"
FT                   /translation="MRAVPYLEGSAKKYALAAVDAEKRGDYEAAIVNLNKAIEYLTEIV
FT                   RNYPDYPLAHIYRRLIAQYRRKVKDLEKKARMIPASGDEVYVDTQEKDGGGEDEAPEFV
FT                   LKEKPSVTFDDIAGLEEAKKAIREAIVFPVKRPDLFPLGWPRGILLYGPPGTGKTMLAS
FT                   AVANEIDGEFLYVDAANIMSKWLGEGEKNVKKLFNYARNKAKEGKPVVIFIDEVDALLG
FT                   VHGSEVGGEVRVRNQFLKEMDGIQDKGSRLHVYVIAATNKPWKLDEPFIRRFQKRIYVP
FT                   LPSRETRKRMLEMYTRKLRLAGDVDLDRLAEMLEGYTGSDIADIVREAYMATVRELFEK
FT                   GKVDGEPRPITMSDFQEILRRRRPSVDHRLLKTYEEWTERFAAV"
FT   CDS_pept        complement(629165..629980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0962"
FT                   /old_locus_tag="APE0962"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0962"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79946"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDF1"
FT                   /protein_id="BAA79946.1"
FT                   /translation="MVIDIVRKLGIISWSPGAKAGHEPGYGEEGVDYDEILARLQLTKT
FT                   EVDSMKNIVLAEINRFYDRMLDAARRRDYDALHIHAAEIVLKKRILKALTMYSRLIELA
FT                   IVRIQDARSIESLAKALAPLEFAMRAMDEYLAATSPEIAARLTSIVQSTERVVRSTALT
FT                   VNNIPVPAATVEIDPEIKREIRRVLSEVSKEVDDLVPDPERIVGGRGGGEDDIDQKVYE
FT                   YVKRSGGVVRISKIAAELGVEKEDIIKSLRRLQQKGLIRIASGREATHS"
FT   CDS_pept        complement(630141..631010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0964.1"
FT                   /old_locus_tag="APE0964"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0964.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79948"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDE9"
FT                   /protein_id="BAA79948.2"
FT                   /translation="MGSLRRIAVPSSIAKELLGRCREWSRGERPPAKVRMGGLVFGLQC
FT                   IDERAVLVSESGSRFVVDEHAASLGERSMAVVGSTGFMGVAEAYRGSYYKLVPLPGGKP
FT                   PTLEINGIHMHRVAGTDPWSDALAKASLVVKRGFRVLDTCTGLGYTSIAAIARGASLVY
FT                   TVEVDEIVLQLAALNPWSHRLRDKRIRIILGDAVEVVRDFGDSAFDALIHDPPRFSKST
FT                   SSLYTLELYREFHRILRRGGRLFHYTGEPGRIRGLNLPGRVARLLREAGFEVLGFRRRA
FT                   LGLVAVKM"
FT   CDS_pept        631540..632403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0965.1"
FT                   /old_locus_tag="APE0965"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0965.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79949"
FT                   /db_xref="GOA:Q9YDE8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDE8"
FT                   /protein_id="BAA79949.2"
FT                   /translation="MSSLIGYALAYAASLLFAVSDVLVRKASRDISPAGILFLSLTSGI
FT                   PSLAVVSILLGEPTLPGMWYLLLYCAIGAGHFYFGRLFFYTAVAGLGASSAAIIVSATP
FT                   IMSSFLAVLLLGEDLRPPVLAALILVTLAAYIAARNPSGRPLQNVSRSRAVLAAAAATL
FT                   IFASTTVAVRWIGFHADSPVLGVVASYTGAYPLALATVEARRVSWGKPALYTALAAGVV
FT                   VAFAQASRYSSLELIPVPEASVLFGLFPVNTAVISAVAGGEDERPSKKHVVAALMSVAA
FT                   VAIMFS"
FT   CDS_pept        complement(632429..634603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0966.1"
FT                   /old_locus_tag="APE0966"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0966.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79950"
FT                   /db_xref="GOA:Q9YDE7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDE7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79950.2"
FT                   /translation="MRTPLARAPLLALVALIVLGTLAASFPGFTEAPAAAASQETPEPW
FT                   QAVLESLENEARILDPTWAKPVSAQPGGSIEVELSVYVEVAAAYAVNVETGARIELTVE
FT                   SLEKVSDSITIQDGAVVGPALAKLSIPQDAAPGLYNLYLTLTTGDMVWMPRSLIIYDTP
FT                   PDELVIMHLTDIHFGAIDKGILNDVKFARDVALVNTLKYELGLDLVVVTGDISDIGINV
FT                   SSYRNWAFAMNQLLVPTMTVPGNHDWAQVPGLESFLLDFYGKYNVPARYWAAKWGNFLF
FT                   IGLDSQSEGYVEPEGLDFLENVLSQYSGEDVVAIILVHHPIFSDPGRYKGDPESFRGAL
FT                   YGSWESKFELVERFFDIINRYDMVKVVFSGHIHRDADAIYFRQDNTPVYFITTTTAMHG
FT                   HPQGYFWGAKVVRVTADGQVEVISLDREYRLEKGSIDTTGFKVYASYGTEGKSYSWTYD
FT                   IEEFGVKLERLTLVYPLSKAVPAEVYTSNLIADGLSPVDVKIVDQGLYYLGIATFNIES
FT                   PKGKTIMYAEPDDTPPQIEVQSVVPSKPFRGSIVTIQVKVSDIGWGIEEVQAEVLGLGE
FT                   EVPVFSGLDPSIYMIRTQAVPGMEGIKIIAVDLAGNASEVVIELEVPAPQTTTTTPPAE
FT                   TATETTEETETTETTATTTTSETVETVTTTEETSETTTAGKAGVEETATTPVSPGETAG
FT                   RLDSSLIILGAAVAAAIIIVAAALYRSRAG"
FT   CDS_pept        634776..635978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0969.1"
FT                   /old_locus_tag="APE0969"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0969.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79953"
FT                   /db_xref="GOA:Q9YDE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDE4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79953.2"
FT                   /translation="MARPGLAVLLASLFIVPLLLSAASLASPGGVIVAVDVSHGQGTEG
FT                   LDTIVSSCAGCTWVLILADESQEANITPDILDLFQEKRYGGLTPENLSDVDVLLIGQAT
FT                   SLLSNDEVSAIASWGSQGKKAVWVAGDSDYPAQGSETAQQVVNQVLEALNSNIRIDYVS
FT                   VEDDESNAERSYRVVGIVDPEGVFSFLKEGLPNGGKVLFHGPGGLFVIGTDGAPANPVK
FT                   EPEKKPENVYVIVRTTENSRSVQHQDPSNGGLPAVLYDPLSDFYNTGPFPLMMAEVKDN
FT                   VLIFASSETMYGGYEPMTAPEYYGVQLDGPQFVAKVIATMVGFTQGTFIVVEKVITQTE
FT                   TVTETVTKTQTETTTKTETATVTETVTQTTTVTETNTAVIAAAVIIILAALGAAFFLLR
FT                   R"
FT   CDS_pept        636199..637671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0972.1"
FT                   /old_locus_tag="APE0972"
FT                   /product="sodium/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0972.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79956"
FT                   /db_xref="GOA:Q9YDE1"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDE1"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79956.2"
FT                   /translation="MAGQAVLVSLFVLLLYLALGSLITLYARRRMARGEGEFYLAGRRL
FT                   TGFLSAMTYAATTYSSFMIVGLVGLAYFTGIGSLVFELAYLVATVILLSLFSRRVWRMS
FT                   RERGWVSPGEMLADLLGSPWVALTASLVFLVSLVPYASAQLKGIAETIVAIAGYSPGDN
FT                   TAYMVAVGVALLILLAWSLLAGVRGVVLTDAFQGLWMLTAGSLLFLWLASRVFSKSGAS
FT                   EVLSAMESAGLFDMWSATLLIGFVTPWVFFAVTNPQVVQRLYMPKDEESLRRMILYFFL
FT                   FGLYYTVLVVAIGFLARAGVELGILSIEPQGRDQVTPQLLSLAHPLLAALVFTSIVAAS
FT                   VSTADSIILALASSASRDIGLLVLRLDEKGRLRLGYAAAALFTVLMAVFAATRIGYIVQ
FT                   LSVLSSVMLLGLAPVTIAAWVGLRVHPALAVASIATGPVLVAANVLYSLAVGGEVSLSP
FT                   AKQVLGVPISVWVLAISLALTAAGIALVRGRR"
FT   CDS_pept        637739..638755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0973.1"
FT                   /old_locus_tag="APE0973"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0973.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79957"
FT                   /db_xref="InterPro:IPR010581"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDE0"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79957.2"
FT                   /translation="MKRVGDLEDLAGLRVLVFGAGGGGDALGAVHLYRRLERIGAEPVL
FT                   GSIVWERRVVDPTPGPIPVWAIEGSQRLAEHAAIVRGWERVERQGVRFTPQIVRAARAL
FT                   GVEAVALGVDGGSMGLAEALDTLARFYGLDAIIALDSGGDALATGCEEDLWSPLADAVS
FT                   LSSLLDVKVDVKLLAVHGYGVDGELPRSYVLKRIADVAREGGLVAFTGITRLDAELLEN
FT                   MERDFVSEASKAPLWAFRGEWGERSIRGGTRVVELDPLQATTAIMDVDKVASITSLPHS
FT                   VAGSRSIYEANARLNERCIYTELNLEEDLARHPGLSAVEARSRGRSLLRRLGCRPLC"
FT   CDS_pept        complement(638752..639105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0973a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0973a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34766"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E35"
FT                   /protein_id="BAF34766.1"
FT                   /translation="MPTVHLSLPDSVYSELKKRAAELGVQVTDIIKFYIKMGLNKGFAA
FT                   ESSEESTKTLLALSRKLDKLEKDYRMKLTLLEGKYRQMEDAITYLIERVEILEETVMSL
FT                   KAYSTIRTANKEG"
FT   CDS_pept        639257..639430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0973b"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0973b"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34767"
FT                   /db_xref="GOA:Q05E34"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E34"
FT                   /protein_id="BAF34767.1"
FT                   /translation="MRVVSFKIEEDLLELLEEYARRKNLTKSEIIRRALEKYLREKPDM
FT                   KPYVGKVMKIYA"
FT   CDS_pept        639585..640484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0974.1"
FT                   /old_locus_tag="APE0974"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0974.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79958"
FT                   /db_xref="GOA:Q9YDD9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR016436"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDD9"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79958.2"
FT                   /translation="MKMLTSLQREVLETLVSLYERHKRMIKSKEVAEALGKDEGTVRNV
FT                   IMWLKSLGLVESRTGPAGGYMPTLKAYEVIGVQTPTLSHVTYGQVIVEKDGNQYRYAAL
FT                   DMEIMGIFGSDTMKAVVTVSGNIAPIEKGDLVRVESVPVRKFALEGRVEKVSREARQLM
FT                   IVISKMTVIPNIKVNSLISRKLLTVRHDMTVREVAKFLYSHGIRGAPIVDDKNNIIGFI
FT                   TTTDISMLIARGEDLDATVDKYMRKTVFTINEDESIYEAMRYMDFNGVGRLVVIDYAGR
FT                   PLGIITRTDILKALIAVK"
FT   CDS_pept        complement(640593..641381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0975"
FT                   /old_locus_tag="APE0975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0975"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79959"
FT                   /db_xref="InterPro:IPR018693"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDD8"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79959.1"
FT                   /translation="MEDRPRGVSIRRRISILMDVWERMLQEWEKGGLTRERAIEILKEV
FT                   YGRERIKPLKGAANPPDLFEKELASLYVVGKYGMGLESDYPELFDKVFHDEIRYEEAIK
FT                   ILLTEKPSTARMKVETLLGGSFDENTIARMLRLKLAEVYFGFSSQDSLKNLLKRLSEAF
FT                   PEYKEMASKYARFYIAFKIADDIQKGEVRDRLTKEATKQALALEFSWLGRKVLPDDTYI
FT                   RVIAEDVFKLNNRALDSILPKSKGRKGKRREERRIQPQEK"
FT   CDS_pept        complement(641706..642008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl14e"
FT                   /locus_tag="APE_0976.1"
FT                   /old_locus_tag="APE0976"
FT                   /product="50S ribosomal protein L14e"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0976.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79960"
FT                   /db_xref="GOA:Q9YDD7"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR023651"
FT                   /db_xref="InterPro:IPR039660"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDD7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79960.2"
FT                   /translation="MAKVVEVGRICVKTRGREAGRKCVIVDIIDENFVLVTGPKSLTGV
FT                   RRRRVNIDHIEILDKKVDIQKGASDEEVLKALEEAGLADFMREPVRIARITPFTL"
FT   CDS_pept        complement(642059..642577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="APE_0978.1"
FT                   /old_locus_tag="APE0978"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0978.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79962"
FT                   /db_xref="GOA:Q9YDD5"
FT                   /db_xref="InterPro:IPR011892"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDD5"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79962.2"
FT                   /translation="MISGPPGSGKSTYAKRLAEDLGLSYYSTGTIFRSIARERGLSLAE
FT                   MSRLAEEDPRIDLEIDRRTLDVASRGGVVIDSHLAAWLLRDKAQYLVLVKAPVWVRVRR
FT                   IARRDGVPLRRALAETVEREWSQRLRFKRYYGIDVSDTTIFHLTVDTSMYSVEDTYRLI
FT                   LEGARRRGL"
FT   CDS_pept        complement(642574..642846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl34e"
FT                   /locus_tag="APE_0978a"
FT                   /product="50S ribosomal protein L34e"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0978a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34768"
FT                   /db_xref="GOA:P58026"
FT                   /db_xref="InterPro:IPR008195"
FT                   /db_xref="InterPro:IPR018065"
FT                   /db_xref="InterPro:IPR038562"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58026"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAF34768.1"
FT                   /translation="MVRPGLRSRSLRRVYRRTPGGSTVVHYERRKPGPARCARCGRPLG
FT                   GVPRGRPPRVRRLSKTAKRPERPYGGVLCSTCLAEMIFEAIAGSS"
FT   CDS_pept        complement(642889..644184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0979.1"
FT                   /old_locus_tag="APE0979"
FT                   /product="putative amidase"
FT                   /EC_number="3.5.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0979.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79963"
FT                   /db_xref="GOA:Q9YDD4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDD4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79963.2"
FT                   /translation="MRSSSKLLDSALENGLKLLRAREPGGGASGVCRRLERLNASITCR
FT                   SGLEDRSPEGLLSYKDTYPLPGEPAGWGTGLPLDTGGEPQVLKALTTGGFEPYARTSMD
FT                   ILALGTSGFNPVLGDVLNPRNPRYTTGGSSGGAAASALLAPGLLALASDAGGSARIPAG
FT                   YTGVLGLKLRRIDYRGYRGMAPSVEAPGLLSLSMTTLVRGLEALGYRGVGERAALAAGA
FT                   AAEGLARITLLTPEDLGLLCREALDPGACSAFEEQVEAARSSGAFLIAGVKLHSLYKTL
FT                   EPPRAVVTLAEAADWAGKFCREECVSRLPERLKGLLRLGGMLRPWRGEAARVLERVRTS
FT                   TQIPGSTVLATPAVATGGCIPVEEAGRLAYTRRAIVFTSLANTLDLYSLSIPLGPSRLD
FT                   CGAPAPLLLSSSSLEALLAAALLLPYRAEAIH"
FT   CDS_pept        complement(644279..644707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0980"
FT                   /old_locus_tag="APE0980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0980"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79964"
FT                   /db_xref="GOA:Q9YDD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDD3"
FT                   /protein_id="BAA79964.1"
FT                   /translation="MVVYLIPVATGFLSVYLAKVVYNRLVPREAVLWAMEVSRRYRGLE
FT                   REAARSRRAAKKLREAAPEAKRARSIIFKSIIVKIGLLMAVYTVLGVVALTLVPAIPSP
FT                   YKLPLITLDTPEGPVLSSLFAHFFSFLYAALLYRDEMV"
FT   CDS_pept        complement(644738..645346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adkA"
FT                   /locus_tag="APE_0981.1"
FT                   /old_locus_tag="APE0981"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="ATP-AMP transphosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0981.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79965"
FT                   /db_xref="GOA:Q9YDD2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023477"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDD2"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79965.2"
FT                   /translation="MRHPFKVVVVTGVPGVGKTTVIKELQGLAEKEGVKLHIVNFGSFM
FT                   LDTAVKLGLVEDRDKIRTLPLRRQLELQREAAKRIVAEASKALGGDGVLIIDTHALVKT
FT                   VAGYWPGLPKHVLDELKPDMIAVVEASPEEVAARQARDTTRYRVDIGGVEGVKRLMENA
FT                   RAASIASAIQYASTVAIVENREGEAAKAAEELLRLIKNL"
FT   CDS_pept        complement(645349..646722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="APE_0983.1"
FT                   /old_locus_tag="APE0983"
FT                   /product="preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0983.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79967"
FT                   /db_xref="GOA:Q9YDD0"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR019561"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDD0"
FT                   /protein_id="BAA79967.2"
FT                   /translation="MGVIDVLAAVGERFPAVRKPERKPTLYRRLAWTGVILVLYFIMSN
FT                   IPLYGIPPQNIGGQVDLQRIIFASSAGTLMELGIGPIVTASLIIQVLVGAKIIKLDLAD
FT                   PEGRRKFTSAQKVLALAFAALEAVAFTVGGRYWVGTAIEPGPLDYALVSLQLFLGALLV
FT                   IYFDEVMQKGWGIGSAISLFILAGVAQGVVWSIFGTIPGVAQDYGLVPAIISNPDLTLL
FT                   ARPNGFPDLTGFFTTLAAIILLVYLQAMRVEIPITSERFKGIRSRVPLQFIYVTNIPIL
FT                   LVGILVSDLLLVQRLLADYLGVESRAYQIYSSIVYYLSPPRGVVQSIADPVKTAVFIAS
FT                   WTVLSIVFGYMWVEIAGLNPREQAERLIKGGLAIPGMRSDPRVLERVLRRYIYPLTFLS
FT                   SLIVAALVIVADIFGAYGTGTGLLLAVGIINQYYAMITRERALETYPLLRRILGEEVV"
FT   CDS_pept        647069..648070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0985.1"
FT                   /old_locus_tag="APE0985"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0985.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79969"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDC8"
FT                   /protein_id="BAA79969.2"
FT                   /translation="MSQEALGVRYGEGLNKRLEVSIMIFNLIIKDSIRKQAEEGKSLKE
FT                   IADTLSYLDVADRGFVMMVSELGGVYLSSAPLMNTNILYLSVASRVLEKSVEEGVDLER
FT                   VYERLDKASKVLASTLARLVEKGFRQSVSTLAKEAQGRRLYIYGSEFFSRVAYQEASSQ
FT                   GADAVLIAASPWDALISRLAEELEAPLVYYPNVNLEFATSGGRGFYVAVEVESILEDSL
FT                   LALAGTRAIASLARMWGGTTGAVSTPLGPSLWTPEFMRSLRAGEIVPSYIMVTEWGESL
FT                   TFKALDPIPRSGVDALYVGERKFPRDTDNITLSSESSRLVREALEEVQIEIG"
FT   CDS_pept        648195..648911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="APE_0986.1"
FT                   /old_locus_tag="APE0986"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0986.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79970"
FT                   /db_xref="GOA:Q9YDC7"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDC7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79970.2"
FT                   /translation="MEGRYKPSLEGSIARAVDSLRNGMPVMIYDGDRREGEVDLVYYAG
FT                   SVTWREVYTLRTLAGGLICFVTSERVGRLLGLPFAQELLLSQESLAPLASKTPGYGDPP
FT                   AFSIWVNHVSVKTGISDEDRGITISGLHRVVEKAYSGLVGEARRMLREEFMSPGHVPIL
FT                   LARSLDRRRGHTELTVALGRLAGLPPSFVIAEMLGERWSLGLREAEAIARERRIPLLRG
FT                   EEIVEACSRGEVCRGG"
FT   CDS_pept        648886..649353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribC"
FT                   /locus_tag="APE_0988"
FT                   /old_locus_tag="APE0988"
FT                   /product="riboflavin synthase"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0988"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79972"
FT                   /db_xref="GOA:Q9YDC5"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR006399"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDC5"
FT                   /protein_id="BAA79972.1"
FT                   /translation="MGKCVGVADTTFARVDMGSVAEEVLRRRLPGYRIVRHTVPGIKDL
FT                   PGAAKRILSMGCEGVITLGWVGRREADKLSYLAASVGLIMVEVLTGKIVIDVTVHEDEA
FT                   EAPEELAAIAVDRARKHAENLAALIREGPEALVKHAGMGLRQGYPDAGPIK"
FT   CDS_pept        join(649439..649712,649751..650541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0989.1"
FT                   /old_locus_tag="APE0989"
FT                   /product="small nucleolar RNP protein Cbf5"
FT                   /EC_number="4.2.1.70"
FT                   /note="H/ACA snoRNP protein Cbf5"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0989.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79974"
FT                   /db_xref="GOA:Q9YDC3"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR026326"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDC3"
FT                   /protein_id="BAA79974.2"
FT                   /translation="MAEEAVDARGEGARFIEKVKSICGNTSRILYKYDEPTDPRYGYLP
FT                   HERPLDVYLRYGMIVVDKPPGPTSHEVVAWIKRMLGVSRAGHGGTLDPKVTGVLPVALE
FT                   RMTRIIGTVMHSSKEYVCVMQLHRPVEEDRLREVLKLFEGEIYQKPPLRSSVKRALRTR
FT                   RVFRIELLEYTGKYALLRVDCEAGTYMRKLCWDIGLVLGVGAHMRELRRIRTGPFSEDS
FT                   GLMVRLDDVAYAVIRWREEGKDDLLRRVVIPGEYSVCHIPKVLVRDSAVESLTHGAQLA
FT                   APGVAAVEEGVEKGGMVALMTLKGELIGLGKALASAQEMLEAERGIVVSPTRIIMERGL
FT                   YPRMWKRQQAPQGA"
FT   intron          649713..649750
FT                   /note="small nucleolar RNP protein Cbf5 (H/ACA snoRNP
FT                   protein Cbf5)"
FT   CDS_pept        650565..651299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtaP"
FT                   /locus_tag="APE_0993.1"
FT                   /old_locus_tag="APE0993"
FT                   /product="S-methyl-5-thioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0993.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79977"
FT                   /db_xref="GOA:Q9YDC0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDC0"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79977.2"
FT                   /translation="MRKPVHLEAGPGDVAPLVVAVGDPGRAERLATGLLEDARLVSSAR
FT                   GLKVYTGSFNGSEVTIATHGIGGPSAAVVFEELRMLGAEVLVRLGTSGGLSKDLRLGDV
FT                   VVAAGAGCYWGSGGSIQYAGERPMCLPASPDPILTAGIYRGLSSRLGDRVVLAPVMSSD
FT                   AFYAETPEAAGRWRSLGMAAVEMELHTLFSISWIRGFRSAGVLIVSDLLLPEGFKRITP
FT                   GELARREVEVGRALLEVLTGGV"
FT   CDS_pept        651358..652134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0994"
FT                   /old_locus_tag="APE0994"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0994"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79978"
FT                   /db_xref="GOA:Q9YDB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDB9"
FT                   /protein_id="BAA79978.1"
FT                   /translation="MVSALYLVFILGLFSSVKSVLASAERLALELESQGGFETGDAAAL
FT                   VAYITGGLRSIIAENALGIGAALFLWILGTILFSREWERIAGYWPSIARRAFSIFTWLS
FT                   RLGALAAGVATGLVLSRLSGDMSSIAAGVRLSYIVATLYLLPLLPPVVYSLLSLKYPPP
FT                   SSRAGVLLLLAGAVLYVYSMYSVIQAFRPISAVAGPLEEVLRGGLNQHSETELVNGFIE
FT                   ALRILMDRVRNTLVALALASAFYTLGFAVIGFRRRS"
FT   CDS_pept        complement(652096..653442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0996.1"
FT                   /old_locus_tag="APE0996"
FT                   /product="glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0996.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79980"
FT                   /db_xref="GOA:Q9YDB7"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDB7"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79980.2"
FT                   /translation="MPIDTGPEGQRRLVSILREAVGRVLEASRLDWRVRRLLEERGLCR
FT                   SRAVVLALGKGSLQMARGALECLEPEGGVVVKPRGMTGNVEGLEVVEGSHPLPDEWSLR
FT                   AGRRLLEWAGSAGEGDNVVVLVSGGGSALAEVPMEGLALEDLREVNMLLLKSGASIHEI
FT                   NTVRKHLSRIKGGRLAATAYPARVLGVYASDVPGDRLDMIASGPTVPDPTTYGDALAVL
FT                   ERYGLRDSAPPRVVALLEAGARGEVEETPKPGDRRLSTTENRLAASNMDVLEDLAAWLG
FT                   GRGFNTLVLTSRLEGESREVGRALASIALEALDRGVPVKPPAALLAGGETTVTVRGGGR
FT                   GGRNMELALAWSLAMAYWSPEAPAAILAMDTDGIDGRSDAAGAVAWPWLPVALRDAGLD
FT                   PYQLLADNDSERAFAYAGSLVSTGLTGTNLNSVVVVLLGPPPKPDDGEA"
FT   CDS_pept        complement(653484..653780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_0996a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_0996a"
FT                   /db_xref="EnsemblGenomes-Tr:BAF34769"
FT                   /db_xref="UniProtKB/TrEMBL:Q05E32"
FT                   /protein_id="BAF34769.1"
FT                   /translation="MSGTAGFITVSPGLPTEAPGGFPREPRGHRARFINLKPYKFYWGF
FT                   PNMSYITKRYGLDRHSTPAYLIAPRGIERYSLVFLPLMGARVSKSIAESGPPG"
FT   repeat_region   complement(653537..653825)
FT                   /rpt_type=DISPERSED
FT                   /note="APE_repC06"
FT                   /note="type C with 20 bp deletion"
FT   CDS_pept        complement(653787..654242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1000.1"
FT                   /old_locus_tag="APE1000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1000.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79984"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDB3"
FT                   /protein_id="BAA79984.2"
FT                   /translation="MVSRRAAALALLAALAAVGAVAGYAYLSWSASRAAGEIVVRIVDI
FT                   DPIGGSVVASIENPTSFGFRVERLEVRVYASSGSGLEEVAVLTSKSPVYLAPGSSSTVY
FT                   MDVSVGILRALAAVIGGAELVVEVEVEAKPYLGPIPFTQTVPSCNKL"
FT   CDS_pept        complement(654283..655446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1001.1"
FT                   /old_locus_tag="APE1001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1001.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79985"
FT                   /db_xref="GOA:Q9YDB2"
FT                   /db_xref="InterPro:IPR016570"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDB2"
FT                   /protein_id="BAA79985.2"
FT                   /translation="MGGAAAPLTSRLYSLAACNIHLAAALAMLGLAVAVHHPGLESPIY
FT                   SDVVHLYLSRVAPLEGGGTLLPYRDFHLEYPPLVGLLWLLSVNTRIPGLTGLESHYIVQ
FT                   ALAAAAMGLLSVEAVRRLAGVKRALAAALLPSMAVYSVYNWDLLAAAPMLWGLYMFRRG
FT                   RVTAAGLLLGLGGAAKLLPLLAAAPLPVVAGRRGVKAAATAFAVTAASFLAVEALAPGF
FT                   IEAFYRHHAGWYIEGSWLLVFGDPFSEELRRVAQALAALAVLAALAASRLLRLDPVTAA
FT                   FVTLSAYLLGTYVYTPQMNLLPALLALSTPLFTPSLYPILLAQDTAATAVILTWHTTPN
FT                   PLDPLAPPTIATYVKTTLLLAIAAALLDRAYKEGGSRGEQGQAGRQP"
FT   CDS_pept        complement(655464..657056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1003.1"
FT                   /old_locus_tag="APE1003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1003.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79987"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDB0"
FT                   /protein_id="BAA79987.2"
FT                   /translation="MAGGWGGLAGDALRLYSALKGASGWLGVRAGGSRGAVEVVRAFLE
FT                   ESLGVSSRLHEFWVDAWVLRSSGLDPAASWHSVGPYVLGGDVEGRPLVLEGDPSHASSW
FT                   RGVDAGGRVVVARAPGVVDDLKAAALLAAEAGAEALLVESRDPRVIVTGGDWGYSVSAG
FT                   SPTPIPVAVVPLGYSRRAEEAGVVRVWVDACVERRRDYNVVAVDGGRGGVVLAGAHLDH
FT                   WYTGFTDNILGVAQAVETAGRLRGRGLAAGVVVFGAEEHGMPGMASWYWAAGSRSYAGL
FT                   LRESGAAEEVEAYVNFDVAGYRCLVASGAPQLVGHALEAGAVERCCECPECDSIMMAWA
FT                   GIPTLSLHSLWCPGVQEAYHTPRDTPDRASWDTAWTAVEAAVRTVTRGPEWPRLTHHFR
FT                   SSLSGAGVRGRRLLYILESLARRAGWGALFREASRSLLKVVHYGSLRWESRPLEALYMP
FT                   EASLFKRIMGDIERGRPPLAVVEVGRSERQLYSLSPTPPPRAPPRSILWEQLEANMERL
FT                   EEEVEDLRMRLVR"
FT   CDS_pept        657145..658074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1007.1"
FT                   /old_locus_tag="APE1007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1007.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79991"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDA6"
FT                   /protein_id="BAA79991.2"
FT                   /translation="MEGCSGLTVAGLGVSTVESVPLYHYRPGGLVLRLYTGPHGSPRPG
FT                   GGASSRCLEWGVEVCEWMSRPGSFPAYTVGLERLRGLAGRWGVEAAVLDGLESWLHAPC
FT                   ARRLGLPLAARTQGLLEPGAEELGLLEALAAEYTYLLGGGGSNLALARTVEEAVGKGVW
FT                   VEVVVYMPRPVESSLLAPPLQAAREAGAPLHLVVLDHGGGGPLSRLAAEVERLHWPVYI
FT                   HSPPYSRLDTRCPRCGTVVATRREGLLDAMQLASGGRCPRCGAGIPVKGGWRGGTPRWF
FT                   RRLAPEGVYWIDPRILGGRPAGDPGESL"
FT   CDS_pept        658128..658400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1007a"
FT                   /old_locus_tag="APES041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1007a"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79993"
FT                   /db_xref="GOA:Q9YDA4"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDA4"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79993.1"
FT                   /translation="MKFCPKCGGVMLPRKDGEKRLLVCGSCGYTIEAKPEDLSRYKGVE
FT                   KVKDHVLTTKTVNVVKKRQREKEEIEQAREEYYELVLEQLGEYGE"
FT   CDS_pept        complement(658432..658938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1009.1"
FT                   /old_locus_tag="APE1009"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1009.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79994"
FT                   /db_xref="InterPro:IPR007171"
FT                   /db_xref="InterPro:IPR023131"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YDA3"
FT                   /protein_id="BAA79994.2"
FT                   /translation="MGRWLFFQAWGHPNVRATHRTTFEITSDDYLTPRGDCIIGIRSSV
FT                   TPRSLPQWFKSIARSPDSIIVVVLCSEGVCDTAVGRGHPGLSLGDGRRMVFRRSSFVGP
FT                   ETVMIGSSKAAADLRRDLIEMLRRGAALRVGMTVVRRSEVEGGGLQPPAAGPHDSDGRA
FT                   WEALN"
FT   CDS_pept        659066..659848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcm"
FT                   /locus_tag="APE_1011.1"
FT                   /old_locus_tag="APE1011"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="PIMT"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1011.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79996"
FT                   /db_xref="GOA:Q9YDA1"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YDA1"
FT                   /protein_id="BAA79996.2"
FT                   /translation="MKSPVAGAVLDPSTPPPTTGTSWRWPGLRDADPYREARLRMVEQL
FT                   RRSGLVTSRRVLEAMARVPRHLFVPPEYRGMAYEDRPLPIGHGQTISAPGVVGRMLQLL
FT                   DPQPGEKVLDVGAGSGYQSALLAELVTPGGRVYAVERIPELAEYARENLEKTGYRGVVE
FT                   VVVGDGSKGLPQHAPYHRIKVAAAAPKPPKPLVEQLAPGGRMVIPIGTPDLQILTIIEK
FT                   TPDGRVRERRDIEVLFVPLIGEHGYREDWRKQYWQWWR"
FT   CDS_pept        complement(659992..660504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1013.1"
FT                   /old_locus_tag="APE1013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1013.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79998"
FT                   /db_xref="GOA:Q9YD99"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD99"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79998.2"
FT                   /translation="MRLRRGISPVIATVIIVAVAIAISIAVAGWLFGLWGSFATGSPQI
FT                   QVSAAKVVYETINNTDNDEIEAKLYINNSGGSSDTLIRIEISGNNKTCVLDENNLGNVL
FT                   PFTIQANTTEIVSTGAIILNGTTCSLTEGDIGPGDNILVKLYFEKSGVISVPTVVSEGI
FT                   AGQANSG"
FT   CDS_pept        complement(660661..661536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1014.1"
FT                   /old_locus_tag="APE1014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1014.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA79999"
FT                   /db_xref="GOA:Q9YD98"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR011589"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD98"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA79999.2"
FT                   /translation="MAADILVADAHMHTNPTRGLGAREVARRFRREGGWFAALLTLTTW
FT                   SYGLAPTGVEAYRRMYEIHLRECRAAREEGLRVACFAGIHPAEVDRMIDKHRQPPEKAL
FT                   ETALEAVEVLRRLCREGAIDGVGEVGRQHYRTSPLRVAIAEVVLEEAAAAALEEGCLLQ
FT                   LHLENEGPATVETVDRILRRAGATGARRGMVIFHHATLRVAKEAVARGYNATIPGVPKL
FT                   LEHAAANEPPDYMVESDYLDDPARPGAVVEPWKMAQKLREIASRTPETREWVRRTNIDL
FT                   VERVFQASPP"
FT   CDS_pept        complement(661543..664422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="APE_1015"
FT                   /old_locus_tag="APE1015"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="LeuRS"
FT                   /note="leucine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1015"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80000"
FT                   /db_xref="GOA:Q9YD97"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR004493"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020791"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YD97"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA80000.1"
FT                   /translation="MERLKAVEEKWQERWREARLFEADPQPGRRKFFITFPYPYVNAYP
FT                   HLGSAFTILRVDIMARYKRMRGYNVLFPQGWHATGGPIVSSALRVREGDPRIIKTLRDM
FT                   GIPEEDIPRFRDPRYWVEFFTKAWRRDLERYGMSIDWRREFYTTSLNPAYSRFIEWQYL
FT                   KLREKGFVGKGRHPVVWCPKEQKVVGDHDRPDEYAGISPQEAVIIKFRGRDGLVYPALT
FT                   YRPETVFGVTNLWVHPDATYLVAEVDGEERWIIGEQAARELADQGHRVVILERIEGRRL
FT                   LGRIVVNPADGREVPVLPASFVRPDLGTGVVMSVPAHAPYDYVALMELKRRPETLREYG
FT                   LEPGVVESLEPIQLIAVPRAEGLLVVEEVRRRGVESQMDREKLDEATREVYAREFYEGI
FT                   MLETTGRFSGLKVAEAKEKVVEWLEERGAALRIYTLPQEVYCRCGARTHVKIVEDQWFL
FT                   LYSKPEWKALAREAVARMEFLPGHVRRDFEAIIEALRDWAFTHKGELGTPLPWDREWVI
FT                   ESLSDSTIYMAYYTIAKYTQHPEKYGVEPEMLTPEVFDYVFLGAGDPGEVSRRSGIPQG
FT                   LLEEMRREFLYWYPLDMRISGKDLIPNHLVFFIFHHTAIFPRELWPRAIGVNGWVLVAG
FT                   EKMSKSKGNFILLRQALDWWGADATRWAEVLAGADSGLDDANFEPSVADSAVSLLSQWL
FT                   DFVRENYGRPARREERWVDRWFESRLNSTIARVTRLMEEANFKTALVEAWYKLQESYRW
FT                   YLRRSGGEPREDLLRRFIEVQTLLIAPFAPHTAEEAWEAMGREGFASTASWPEPDESKI
FT                   SPEVEAAEETVQAVLEDAREVLSLIGGADTLVVTVAAEWKYRAVEAVRRARERGASMKE
FT                   ALREAFKVEGVDKREAARLVQQLSRAPEVLRRAAPRSVELEALRDAAQLLQEELGVKVV
FT                   VETEEDGGSPRRANALPGRPALYAEKRGG"
FT   CDS_pept        664563..665474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="APE_1023.1"
FT                   /old_locus_tag="APE1023"
FT                   /product="putative dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1023.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80008"
FT                   /db_xref="GOA:Q9YD89"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD89"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA80008.2"
FT                   /translation="MAKPKVIVPMVTPLRGGSVDKNAASWLASRLSESGVDGVFVPGTT
FT                   GEWYLLDPHERAEAFFAVASSAIAGLRLVAGVSGYRPEESYRLAEEAAGHGAHAVMAVP
FT                   PIYFRPSTDFLREFYGEIKRRAGGLPTYIYIFPERMGYTLAVEQVESLVEAGVVDGIKA
FT                   TVTDAAYIAGLAAVKERNPEFEVLAGGLEMLVHTSLSGGDGVVDAYSNVAPKLAVELAE
FT                   SLEKGSVERVAGLQGRVLKLSRILGKRSLPAVLKAVLHVLGAPITGEVRKPLKPLTQPE
FT                   ANATANALCTSYRDYLLPGLEC"
FT   CDS_pept        665527..666162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="helA"
FT                   /locus_tag="APE_1026.1"
FT                   /old_locus_tag="APE1026"
FT                   /product="heme exporter protein A"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1026.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80011"
FT                   /db_xref="GOA:Q9YD86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD86"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA80011.2"
FT                   /translation="MAALLRLENVWKMLGGRWVLRGVSLALGPGEAVVVSGANGSGKTT
FT                   LLRLSAGLAEPSRGRVSWGCPRGPRGCVGYVGHTPMVYGDLTVWENVEFFSSLHGGSLG
FT                   DYPLAAEAWRLLGLEKYGSHLASQLSFGWRRRLDVVRALLGEPRLLLLDEAFTGLDQGA
FT                   SEALSRLLRLALGEGLALLMTTPLLEPRYLGLASRVYTLQDGLLAEAS"
FT   CDS_pept        666180..666842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="helB"
FT                   /locus_tag="APE_1029"
FT                   /old_locus_tag="APE1029"
FT                   /product="heme exporter protein B"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1029"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80014"
FT                   /db_xref="GOA:Q9YD83"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD83"
FT                   /protein_id="BAA80014.1"
FT                   /translation="MPRAFLWLVRKEALLAARNPVLLATQALFTLAIAVAAGAVEHSSL
FT                   LGPGFSLPPMLAALMLFQAAFTAYTSYIREAEWGTLEALRTSPVDPGLVYLAKTLYSAA
FT                   SIFLTTLAFLPVYAVLASPPIPLWGYLMLGEWILLSSLLLGGVASLSSAMLSYSRNQAL
FT                   LTPTILAVVSAPYMRVASRPLADLGAGLEPAGGWWAVLAAQAIGFALVGYTLSRQLS"
FT   CDS_pept        complement(666839..668230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1031.1"
FT                   /old_locus_tag="APE1031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1031.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80016"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD81"
FT                   /protein_id="BAA80016.2"
FT                   /translation="MPDNGSGEEGGVEKVRRSLIRGVGVIDEVKLYRGQKILSTARKLN
FT                   ISGIPEIITPELAVDVFYTFYYPVPSLEEEPPLEGGEEALFRRRVLESLLMSPNLWRAK
FT                   PYTTADSLTSVVAAASFVERLARLLSRLQRPQRGRSRDREEKEGENQGGQGEGEPGGEF
FT                   DEEKLREAVEKALESVEKDARAAKNVKQLLSMMGAGDTSVLAFDENIEFILRIARETDV
FT                   SRVLENVQGIREIMRRRSRRETRSPKGWFDGLEYGSDLERIHYSQLILPDEYFWASFSS
FT                   SKLLLYRKVLDSSRGPIYVLLDKSGSMVGAKIDWARAVAVALFRRSLAENRRFSARFFD
FT                   SVTYPAIHLRPRSKPRDFLELVKYLAAVKAGGGTDITAAIKTAADDISRTPRGEQRISD
FT                   IVLITDGEDRLNIDVVEDSLKRSDARLHTVIIQGHNPYLKRISYRYMSVRRLEGREAVK
FT                   VVDFD"
FT   CDS_pept        complement(668268..669407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1035.1"
FT                   /old_locus_tag="APE1035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1035.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80020"
FT                   /db_xref="GOA:Q9YD77"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD77"
FT                   /protein_id="BAA80020.2"
FT                   /translation="MDFETASGLARKFLQELEKPFVGRHEQALMLTLALISGEHVVMIG
FT                   EPGTAKSALARRAAELLNARFFKYLLTRFTEPSELFGPLDLRSLREGKYIRITRGKLPE
FT                   AEIAFLDEVFNANSAVLNTLLSLMQERIVYDGYSEIRVPIWSIIGASNRVPEEPELEAL
FT                   YDRFVYRDYVKPLDQDHWDKLLDAAWSLEKGEYEAAKPIMSMAELREINKHVMSVDVSP
FT                   VKPSLIRLFVLLEEKGLHVTDRRKGKILKAVAAHALLNGRSSAEESDLIVLKYTVPKDP
FT                   EDFDKINIILMEELKTKDRVLRELEEIRKNVENAQSVITRMQSFDPRLTDYFRSLKATR
FT                   NRVAHLVKDLDDPEVQRMADEIIIAVDLLLEEIMAKLNM"
FT   CDS_pept        669553..669963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdd"
FT                   /locus_tag="APE_1038.1"
FT                   /old_locus_tag="APE1038"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1038.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80023"
FT                   /db_xref="GOA:Q9YD74"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD74"
FT                   /protein_id="BAA80023.2"
FT                   /translation="MEAGAPEDLVGAAVEQAGRAYAPYSRFRVGAAVRTSDGRVYGGCN
FT                   VENSSYGLTVCAERTAVFKAVSEGSRGVVEVAVYAADSDEPVPPCGACLQVLSEFARGD
FT                   PRVYMISRTGRIRVARLSQLLPMAFRLGGETG"
FT   CDS_pept        670032..670700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1040.1"
FT                   /old_locus_tag="APE1040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1040.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80025"
FT                   /db_xref="GOA:Q9YD72"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD72"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA80025.2"
FT                   /translation="MSRGPLDPRAPLYKAVQIARRRAAEEGDSSWRVVAQAVEELARRV
FT                   ERLYELASRHGLSKPFWLSPRVLEVLRSVEDGDKGGAIERARSLSESLIPAGLAGEYSL
FT                   ATGTAARVLASIIFLASAAYIGVEGIQAPSTPAAVTTLALASFALAALLAASTHYSLYL
FT                   LAVSTGASLAIATAYRPVVDSYSILMALYSAVLGFAAAAYSSYTRRKFYRMLRMLERGM
FT                   "
FT   CDS_pept        670773..671204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1041"
FT                   /old_locus_tag="APE1041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1041"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80026"
FT                   /db_xref="GOA:Q9YD71"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD71"
FT                   /protein_id="BAA80026.1"
FT                   /translation="MEPRYALLVGLGLGLGLLESLALSAAGVLVLGLLLYTAIDTVDRL
FT                   MEALCSRKRLGVNPGCIYLALRSSAARRAGGYVERYGWAGLIVFIAIPLPATGMYSGAL
FT                   AAALLGIRGPRLLASLLLGGYLSLAITAVVGGGVAVVST"
FT   CDS_pept        complement(671246..671680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1042.1"
FT                   /old_locus_tag="APE1042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1042.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80027"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD70"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA80027.2"
FT                   /translation="MAHGAQVGDEKILKLLELVEENYEALATTIELVAALKKSGTLDAL
FT                   LQLAEMGDEIFNSLARPEVMKMIGNLMMMGYMLSQIDQPLLMKAAEKMPVCMNTALQEA
FT                   AATEKGMGIRELMKTMTSPEMAALLKALIAGVSCARGKQG"
FT   CDS_pept        complement(671698..672843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1043.1"
FT                   /old_locus_tag="APE1043"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1043.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80028"
FT                   /db_xref="GOA:Q9YD69"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD69"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA80028.2"
FT                   /translation="MKKIVVLGGGPGGLVAAYNLARLLRGKAEITLIDKTGYHLFPPSL
FT                   LWVMVGQREPEDIMRPLSKLEKHGIKVVTASVESIDPDNNKVATSGGEFEYDYLVVSLG
FT                   STPRPELMKADDTVCSPWTVEGALDCRRKLAGFKSGRIIVGAWSWPYKCPPAPFETAFL
FT                   VKYLLEQRGGDAQVTVVHFWKKPMEPFGPTMAEAFQSFLDMYGVGFKGGVEPMEARGGR
FT                   LVASSGEEIEYDLAVFAPPHEPPKPVAESPLGDESLGGYMRVDKRTLRSPRYGNVFGVG
FT                   DIIAPSLGLGMAGIFAHFQAEYVASQIADEILGTYMGEHYNMSGVCVMDLGYAGAAVYC
FT                   DFSKKVMGEAEYPDCVILGGMRAFRPLKYAFERYWLEKWFT"
FT   CDS_pept        673174..673923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1044"
FT                   /old_locus_tag="APE1044"
FT                   /product="NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1044"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80029"
FT                   /db_xref="GOA:Q9YD68"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD68"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA80029.1"
FT                   /translation="MEATGASEAARVVYEVFARHRSIRKYVKKPLPEEHVSLLLEAARR
FT                   APTDATLHLWSAVRVVDDGVRRRIADAIGQEHVYEAGEFFIFLADFYRLKRLLEYRGEE
FT                   LGRVDRALLVFAAIDAGLAAENMAVMAEALGYGTCFIGGVQNAAELIIELLALPEKTYP
FT                   LFGLTIGYPAEDPPLRPRLPPDLLFHTDRYREYTSEDLARAYEAMASYSRRRDWLRILK
FT                   RYVAKGGYFEARSEEMWRLLRKQGFSL"
FT   CDS_pept        complement(673939..674898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="APE_1045.1"
FT                   /old_locus_tag="APE1045"
FT                   /product="zinc metalloprotease HtpX"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1045.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80030"
FT                   /db_xref="GOA:Q9YD67"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YD67"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA80030.2"
FT                   /translation="MGLTVLALIGGYIVVLGVAAWALDAFTGLSGTGVAFMLSLLALAM
FT                   VLVQWLFSPYIINMVYRTREPLPGEEWIVAEVEQLARRSGLKPPKVVVSEMNMPNAFAY
FT                   GSPIAGSYVAVTRGLLRLLPKDEVRAVLAHEVGHLKHRDVTVILALSLIPIAAFLIGRT
FT                   LVWAGILGGGGGERRGNPMALVAVGAALLAAGMVFQLIVSHFNRLREYYADAHSALVTG
FT                   SPRSLQRALARIHAAYEHNPHLVEEARSNEMASMLFIVAPLTSLTASPLVDVDYLVERL
FT                   KEQETNPLVELFSTHPPVSKRLRFLDRLASRIGGIEHY"
FT   CDS_pept        675165..676019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1047.1"
FT                   /old_locus_tag="APE1047"
FT                   /product="putative translation initiation factor eIF-2B
FT                   subunit"
FT                   /note="eIF-2B GDP-GTP exchange factor"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1047.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80032"
FT                   /db_xref="GOA:Q9YD65"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD65"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA80032.2"
FT                   /translation="MPAGLEEAVREVSRERIRGASWAISTLARGLLEDLESGRTLDCDR
FT                   ASQVLRTTLPGMGSLEVLAEVVERLCNRPGELAEALRRLMDYVEEAGREAAERAAEFLS
FT                   GAGAVSTVSFSRAVQLTILAARPRVVYVLESRPGGEGVAMARHLRQSGVNAVVLPDSAA
FT                   GLAVSRSNAVVFGADAAGLDGCLRNKLGTLPLAASAAALGVEAVAVFESYKIVSRACVW
FT                   EGVETRSYRVEGWGDVEYPVFEPIPLRLVSYIATELGGGRAGVEPLRLYRRLFLGEVLG
FT                   GDV"
FT   CDS_pept        676058..677530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1049.1"
FT                   /old_locus_tag="APE1049"
FT                   /product="putative ABC transporter, substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1049.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80034"
FT                   /db_xref="GOA:Q9YD63"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD63"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA80034.2"
FT                   /translation="MQGGISLTHIAAGIAVVALIILGVGFYAIYQELASLRSQVEGLNT
FT                   RYEEISESLEEVQGAFESSRGDIESIASSLESIQDRVSKIEERLGSAATQSDLDAVARE
FT                   LASLTQQLEDLQARIQALEESGAEAGERLDQLAMALQDLQARLASLEERVDEVYASLYF
FT                   PVTVVDGTGTPVVILERPERIVSMAPSATETLYYVGALDRVVGVDQYSDFPPELNEAKE
FT                   AGEVEVIGGYWNPSIEAILSLEPDLVVGVASVPNHIQVKKVLSAYGIPVILLPDSSLED
FT                   VRESMMIVGKATGEVVGAYEAVLKFDMAVAAAGLLLEGVEPVETAVVVWPNPLFVVGGG
FT                   TWEHEVIELAGGVNVYGDTQGWPQVSYESLLEADPDVIILMGGHGNSGVTVEGFIEALE
FT                   SQLGEAAWEIDAVASGRIYVLLDEYNDSFARPSPRTVLSIYVLAVLIQPSAFDIQPGDL
FT                   PSEVSPETLDVLGLLEGRVPEEVLEFLGEALG"
FT   CDS_pept        677527..678489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1053.1"
FT                   /old_locus_tag="APE1053"
FT                   /product="putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1053.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80038"
FT                   /db_xref="GOA:Q9YD59"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD59"
FT                   /protein_id="BAA80038.2"
FT                   /translation="MRTSILLASSITVFSMLTLASLALGPAGVKNPLDYIDGLGGVELY
FT                   RLLRTSASIVVGASLAVSGASLQQALRNPLVDPYLLGISTGASLAVALSLLLGLAGPLG
FT                   IGSAALAGGLAAFLLVLATARLAGMTGSGLIIVGVAYSYLFGSLTTLLVLSFPDKLTGA
FT                   LYWIFGSVAYVDRGILATAAGGLALATLYLAASSKALEALSLGEEAARGLGIGVERLRA
FT                   GVATASLVAVAASVALAGPVGFIGLTAPWIARLLGAARFQHILVASAPMGAGLALASDI
FT                   LARTLASPAELPLTPIASLIGVPILVYAAVERWRGVEAL"
FT   CDS_pept        678476..679225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1055.1"
FT                   /old_locus_tag="APE1055"
FT                   /product="putative ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1055.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80040"
FT                   /db_xref="GOA:Q9YD57"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD57"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA80040.2"
FT                   /translation="MRPCSVRLEGVEARYNTSPPVLRGVSFSLDPGSLVALLGPNGSGK
FT                   TTLLRLLAGIIKPSRGRVEVCGSPPGRVRRMLGYAPASPEVDPRLKAVEVALLYRYGVS
FT                   EGVAWGRRDWEEVLAALGEMGVGELAWRRWGELSSGQRRLVILAGVLARRPGLALLDEP
FT                   HSFLDVSNMRRVTLVLRSLRGRATIVYTTHDPLAAMAADSVIMLREGLLHAQGPPEAVV
FT                   TPETIEEVYGIPADRLDGLTIPRYYKP"
FT   CDS_pept        complement(679324..680019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1056.1"
FT                   /old_locus_tag="APE1056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1056.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80041"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023472"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9YD56"
FT                   /protein_id="BAA80041.2"
FT                   /translation="MVGGVRIARARGPPIEPEELDDADGEALVRIARRAVEEWVEHGRR
FT                   LDVEAGGKLGRPGAAFVTLERRSGDGWELRGCIGVVRPVLPLVEAVVTAAVDAASSDPR
FT                   FEPLSREELDRVRVEVTVLGSMEPLPKKPHERPALVEVGLHGLYVEKPPYAGLLLPQVA
FT                   VDEGWDPILFLTWACIKAGLPGTCWLREDVEIYRFRAAVWRETEPRGPVVRRDLAREAA
FT                   AKGVNARVS"
FT   CDS_pept        complement(680209..681249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1059"
FT                   /old_locus_tag="APE1059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1059"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80044"
FT                   /db_xref="GOA:Q9YD53"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR023993"
FT                   /db_xref="InterPro:IPR034556"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD53"
FT                   /protein_id="BAA80044.1"
FT                   /translation="MPEKWLPLAEVMVKQKYHFAGRHTVVKKCYWTHKALTEDRHCYKC
FT                   KFYGIESHRDIQMSPAAFWCWNACLHCWRIRPQDLGVDLDETKLTIVDDPKWLVDELIR
FT                   IHRRLISGYKGHPRVDPKKFWEAWNPVHVTLSLTGEPTLYPMLSDLLKEVHRRGMTSFL
FT                   VTRGVRPDILADLEEEPSQLYVSLEAWDKKSYNYFTRPLVPRAWELTMETLEMMPSFTS
FT                   PTAIRITLVAGFNDTDEALKGFAKLINLAQPTYVEIKSYMWVGASRMRLSKANMAEHEY
FT                   VRKVSERLSELTGYPILGESRASRVVLLSRLEKPIRLGKGCPEGLNTPEPEEGEYDAPY
FT                   DPDIMP"
FT   CDS_pept        complement(681316..682329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APE_1061.1"
FT                   /old_locus_tag="APE1061"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="ApTR"
FT                   /db_xref="EnsemblGenomes-Gn:APE_1061.1"
FT                   /db_xref="EnsemblGenomes-Tr:BAA80046"
FT                   /db_xref="GOA:Q9YD51"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YD51"
FT                   /experiment="proteome analysis"
FT                   /protein_id="BAA80046.2"
FT                   /translation="MPLRLSAVRAPKIPRGEEYDTVIVGAGPAGLSAAIYTTRFLMSTL
FT                   IVSMDVGGQLNLTNWIDDYPGMGGLEASKLVESFKSHAEMFGAKIVTGVQVKTVDRLDD
FT                   GWFLVRGSRGLEVKARTVILAVGSRRRKLGVPGEAELAGRGVSYCSVCDAPLFKGKDAV
FT                   VVVGGGDSALEGALLLSGYVGKVYL