(data stored in SCRATCH3701 zone)

EMBL: BA000003

ID   BA000003; SV 2; circular; genomic DNA; STD; PRO; 640681 BP.
XX
AC   BA000003; AP000398; AP001118-AP001119;
XX
PR   Project:PRJNA245;
XX
DT   08-DEC-2004 (Rel. 82, Created)
DT   10-OCT-2016 (Rel. 130, Last updated, Version 6)
XX
DE   Buchnera aphidicola str. APS (Acyrthosiphon pisum) genomic DNA, complete
DE   sequence.
XX
KW   .
XX
OS   Buchnera aphidicola str. APS (Acyrthosiphon pisum)
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Erwiniaceae; Buchnera.
XX
RN   [1]
RP   1-640681
RA   Shigenobu S., Hattori M., Watanabe H., Toyoda A., Yada T., Sakaki Y.,
RA   Ishikawa H.;
RT   ;
RL   Submitted (24-JAN-2000) to the INSDC.
RL   Contact:Shuji Shigenobu University of Tokyo, Department of Biological
RL   Sciences; 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033, Japan URL
RL   :http://buchnera.gsc.riken.go.jp
XX
RN   [2]
RX   DOI; 10.1038/35024074.
RX   PUBMED; 10993077.
RA   Shigenobu S., Watanabe H., Hattori M., Sakaki Y., Ishikawa H.;
RT   "Genome sequence of the endocellular bacterial symbiont of aphids Buchnera
RT   sp. APS";
RL   Nature 407(6800):81-86(2000).
XX
DR   MD5; 211c5f9977681f2e06842b58eb904b84.
DR   BioSample; SAMD00061095.
DR   EnsemblGenomes-Gn; EBG00000019978.
DR   EnsemblGenomes-Gn; EBG00000019979.
DR   EnsemblGenomes-Gn; EBG00000019980.
DR   EnsemblGenomes-Gn; EBG00000019981.
DR   EnsemblGenomes-Gn; EBG00000019982.
DR   EnsemblGenomes-Gn; EBG00000019983.
DR   EnsemblGenomes-Gn; EBG00000019984.
DR   EnsemblGenomes-Gn; EBG00000019985.
DR   EnsemblGenomes-Gn; EBG00000019986.
DR   EnsemblGenomes-Gn; EBG00000019987.
DR   EnsemblGenomes-Gn; EBG00000019988.
DR   EnsemblGenomes-Gn; EBG00000019989.
DR   EnsemblGenomes-Gn; EBG00000019990.
DR   EnsemblGenomes-Gn; EBG00000019991.
DR   EnsemblGenomes-Gn; EBG00000019992.
DR   EnsemblGenomes-Gn; EBG00000019993.
DR   EnsemblGenomes-Gn; EBG00000019994.
DR   EnsemblGenomes-Gn; EBG00000019995.
DR   EnsemblGenomes-Gn; EBG00000019996.
DR   EnsemblGenomes-Gn; EBG00000019997.
DR   EnsemblGenomes-Gn; EBG00000019998.
DR   EnsemblGenomes-Gn; EBG00000019999.
DR   EnsemblGenomes-Gn; EBG00000020000.
DR   EnsemblGenomes-Gn; EBG00000020001.
DR   EnsemblGenomes-Gn; EBG00000020002.
DR   EnsemblGenomes-Gn; EBG00000020003.
DR   EnsemblGenomes-Gn; EBG00000020004.
DR   EnsemblGenomes-Gn; EBG00000020005.
DR   EnsemblGenomes-Gn; EBG00000020006.
DR   EnsemblGenomes-Gn; EBG00000020007.
DR   EnsemblGenomes-Gn; EBG00000020008.
DR   EnsemblGenomes-Gn; EBG00000020009.
DR   EnsemblGenomes-Gn; EBG00000020010.
DR   EnsemblGenomes-Gn; EBG00000020011.
DR   EnsemblGenomes-Gn; EBG00000020012.
DR   EnsemblGenomes-Gn; EBG00001184376.
DR   EnsemblGenomes-Gn; EBG00001184377.
DR   EnsemblGenomes-Gn; EBG00001184378.
DR   EnsemblGenomes-Gn; EBG00001184379.
DR   EnsemblGenomes-Gn; EBG00001184380.
DR   EnsemblGenomes-Gn; EBG00001184381.
DR   EnsemblGenomes-Gn; EBG00001184382.
DR   EnsemblGenomes-Gn; EBG00001184383.
DR   EnsemblGenomes-Gn; EBG00001184384.
DR   EnsemblGenomes-Gn; EBG00001184385.
DR   EnsemblGenomes-Gn; EBG00001184386.
DR   EnsemblGenomes-Gn; EBG00001184387.
DR   EnsemblGenomes-Gn; EBG00001184388.
DR   EnsemblGenomes-Gn; EBG00001184389.
DR   EnsemblGenomes-Gn; EBG00001184390.
DR   EnsemblGenomes-Gn; EBG00001184391.
DR   EnsemblGenomes-Gn; EBG00001184392.
DR   EnsemblGenomes-Gn; EBG00001184393.
DR   EnsemblGenomes-Gn; EBG00001184394.
DR   EnsemblGenomes-Gn; EBG00001184395.
DR   EnsemblGenomes-Gn; EBG00001184396.
DR   EnsemblGenomes-Gn; EBG00001184397.
DR   EnsemblGenomes-Gn; EBG00001184398.
DR   EnsemblGenomes-Gn; EBG00001184399.
DR   EnsemblGenomes-Gn; EBG00001184400.
DR   EnsemblGenomes-Gn; EBG00001184401.
DR   EnsemblGenomes-Gn; EBG00001184402.
DR   EnsemblGenomes-Gn; EBG00001184403.
DR   EnsemblGenomes-Gn; EBG00001184404.
DR   EnsemblGenomes-Gn; EBG00001184405.
DR   EnsemblGenomes-Gn; EBG00001184406.
DR   EnsemblGenomes-Gn; EBG00001184407.
DR   EnsemblGenomes-Gn; EBG00001184408.
DR   EnsemblGenomes-Gn; EBG00001184409.
DR   EnsemblGenomes-Gn; EBG00001184410.
DR   EnsemblGenomes-Gn; EBG00001184411.
DR   EnsemblGenomes-Gn; EBG00001184412.
DR   EnsemblGenomes-Gn; EBG00001184413.
DR   EnsemblGenomes-Gn; EBG00001184414.
DR   EnsemblGenomes-Gn; EBG00001184415.
DR   EnsemblGenomes-Gn; EBG00001184416.
DR   EnsemblGenomes-Gn; EBG00001184417.
DR   EnsemblGenomes-Tr; EBG00000019978-1.
DR   EnsemblGenomes-Tr; EBG00000019979-1.
DR   EnsemblGenomes-Tr; EBG00000019980-1.
DR   EnsemblGenomes-Tr; EBG00000019981-1.
DR   EnsemblGenomes-Tr; EBG00000019982-1.
DR   EnsemblGenomes-Tr; EBG00000019983-1.
DR   EnsemblGenomes-Tr; EBG00000019984-1.
DR   EnsemblGenomes-Tr; EBG00000019985-1.
DR   EnsemblGenomes-Tr; EBG00000019986-1.
DR   EnsemblGenomes-Tr; EBG00000019987-1.
DR   EnsemblGenomes-Tr; EBG00000019988-1.
DR   EnsemblGenomes-Tr; EBG00000019989-1.
DR   EnsemblGenomes-Tr; EBG00000019990-1.
DR   EnsemblGenomes-Tr; EBG00000019991-1.
DR   EnsemblGenomes-Tr; EBG00000019992-1.
DR   EnsemblGenomes-Tr; EBG00000019993-1.
DR   EnsemblGenomes-Tr; EBG00000019994-1.
DR   EnsemblGenomes-Tr; EBG00000019995-1.
DR   EnsemblGenomes-Tr; EBG00000019996-1.
DR   EnsemblGenomes-Tr; EBG00000019997-1.
DR   EnsemblGenomes-Tr; EBG00000019998-1.
DR   EnsemblGenomes-Tr; EBG00000019999-1.
DR   EnsemblGenomes-Tr; EBG00000020000-1.
DR   EnsemblGenomes-Tr; EBG00000020001-1.
DR   EnsemblGenomes-Tr; EBG00000020002-1.
DR   EnsemblGenomes-Tr; EBG00000020003-1.
DR   EnsemblGenomes-Tr; EBG00000020004-1.
DR   EnsemblGenomes-Tr; EBG00000020005-1.
DR   EnsemblGenomes-Tr; EBG00000020006-1.
DR   EnsemblGenomes-Tr; EBG00000020007-1.
DR   EnsemblGenomes-Tr; EBG00000020008-1.
DR   EnsemblGenomes-Tr; EBG00000020009-1.
DR   EnsemblGenomes-Tr; EBG00000020010-1.
DR   EnsemblGenomes-Tr; EBG00000020011-1.
DR   EnsemblGenomes-Tr; EBG00000020012-1.
DR   EnsemblGenomes-Tr; EBT00001762690.
DR   EnsemblGenomes-Tr; EBT00001762695.
DR   EnsemblGenomes-Tr; EBT00001762696.
DR   EnsemblGenomes-Tr; EBT00001762698.
DR   EnsemblGenomes-Tr; EBT00001762700.
DR   EnsemblGenomes-Tr; EBT00001762702.
DR   EnsemblGenomes-Tr; EBT00001762703.
DR   EnsemblGenomes-Tr; EBT00001762706.
DR   EnsemblGenomes-Tr; EBT00001762710.
DR   EnsemblGenomes-Tr; EBT00001762712.
DR   EnsemblGenomes-Tr; EBT00001762714.
DR   EnsemblGenomes-Tr; EBT00001762716.
DR   EnsemblGenomes-Tr; EBT00001762719.
DR   EnsemblGenomes-Tr; EBT00001762720.
DR   EnsemblGenomes-Tr; EBT00001762723.
DR   EnsemblGenomes-Tr; EBT00001762724.
DR   EnsemblGenomes-Tr; EBT00001762726.
DR   EnsemblGenomes-Tr; EBT00001762728.
DR   EnsemblGenomes-Tr; EBT00001762730.
DR   EnsemblGenomes-Tr; EBT00001762732.
DR   EnsemblGenomes-Tr; EBT00001762734.
DR   EnsemblGenomes-Tr; EBT00001762736.
DR   EnsemblGenomes-Tr; EBT00001762737.
DR   EnsemblGenomes-Tr; EBT00001762738.
DR   EnsemblGenomes-Tr; EBT00001762739.
DR   EnsemblGenomes-Tr; EBT00001762740.
DR   EnsemblGenomes-Tr; EBT00001762741.
DR   EnsemblGenomes-Tr; EBT00001762742.
DR   EnsemblGenomes-Tr; EBT00001762743.
DR   EnsemblGenomes-Tr; EBT00001762744.
DR   EnsemblGenomes-Tr; EBT00001762745.
DR   EnsemblGenomes-Tr; EBT00001762746.
DR   EnsemblGenomes-Tr; EBT00001762747.
DR   EnsemblGenomes-Tr; EBT00001762748.
DR   EnsemblGenomes-Tr; EBT00001762749.
DR   EnsemblGenomes-Tr; EBT00001762750.
DR   EnsemblGenomes-Tr; EBT00001762751.
DR   EnsemblGenomes-Tr; EBT00001762752.
DR   EnsemblGenomes-Tr; EBT00001762753.
DR   EnsemblGenomes-Tr; EBT00001762754.
DR   EnsemblGenomes-Tr; EBT00001762755.
DR   EnsemblGenomes-Tr; EBT00001762756.
DR   EuropePMC; PMC1440324; 16536873.
DR   EuropePMC; PMC1794563; 17076878.
DR   EuropePMC; PMC2148300; 18048332.
DR   EuropePMC; PMC2175510; 17908294.
DR   EuropePMC; PMC2228313; 17915007.
DR   EuropePMC; PMC2563115; 18832143.
DR   EuropePMC; PMC3042603; 21350635.
DR   EuropePMC; PMC3246468; 22229056.
DR   EuropePMC; PMC3838393; 24278221.
DR   EuropePMC; PMC4301665; 25424897.
DR   EuropePMC; PMC4916391; 27329757.
DR   EuropePMC; PMC6180509; 30305166.
DR   EuropePMC; PMC99098; 11752244.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02031; tpke11.
DR   SILVA-LSU; BA000003.
DR   SILVA-SSU; BA000003.
XX
CC   Collaboration Information:
CC   RIKEN, Genomic Sciences Center (GSC)
CC   Kitasato Univ., 1-15-1 Kitasato, Sagamihara, Kanagawa 228-8555,
CC   Japan
CC   Tel:81-42-778-9923
CC   FAX:81-42-778-9924
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..640681
FT                   /organism="Buchnera aphidicola str. APS (Acyrthosiphon
FT                   pisum)"
FT                   /host="Acyrthosiphon pisum"
FT                   /strain="APS"
FT                   /isolate="Tokyo1998"
FT                   /mol_type="genomic DNA"
FT                   /note="primary endosymbiont of Acyrthosiphon pisum"
FT                   /note="synonym: Buchnera sp. APS"
FT                   /db_xref="taxon:107806"
FT   CDS_pept        197..2083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /product="glucose inhibited division protein A"
FT                   /note="BU001"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12729"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12729"
FT                   /db_xref="GOA:P57117"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57117"
FT                   /protein_id="BAB12729.1"
FT                   /translation="MFNLRNFDVIVVGAGHAGTEAAMASSRMGCKTLLLTQKISDLGAL
FT                   SCNPAIGGIGKSHLVKEIDALGGMMAKAIDYSGIQFRILNSSKGPAVRSTRAQADKILY
FT                   HETVKKILKKQNNLLILEAEVKDLIFKNYSVVGVLTQNEINFYSRSVVLAAGTFLGGKI
FT                   HIGLKSYSAGRIGDKSAIDLSVRLRELSLRVNRLKTGTPPRIDINTVNFNNLLIQNSDT
FT                   PVPVFSFMGNVSHHPKQIPCYLTHTNEKTHEIIRKNLDKSPIYTGFLKGLGPRYCPSIE
FT                   DKIVRFPDRKSHQVFLEPEGLSSIKVYPNGISTSLPIEVQEQIVASIKGLEKSKIIRPG
FT                   YAIEYDFFDPKDLNLTLESKLIKGLFFAGQINGTTGYEEAASQGLLAGLNAALSSKNTE
FT                   GWFPRRDQAYLGVLIDDLTTQGTEEPYRMFTSRAEYRLSLREDNADLRLTEIGRKLGLV
FT                   NDSRWIRYNQKVLNIQTEMNRLKKNKISPISPDADILKKLYNINLIKEISMSELLKRPQ
FT                   IRYQDLQSLESFRTGIVDLEAIGQIENEIKYAGYIKRQSEEIERHLKNENTFLSSIYDY
FT                   NKIRGLSSEVVKKLNDYKPISIGQASRISGITPAAISILLIHLKKESYKHTL"
FT   CDS_pept        2278..3102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /product="ATP synthase A chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="BU002"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12730"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12730"
FT                   /db_xref="GOA:P57118"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57118"
FT                   /protein_id="BAB12730.1"
FT                   /translation="MILEKISDPQKYISHHLSHLQIDLRSFKIIQPGALSSDYWTVNVD
FT                   SMFFSLVLGSFFLSIFYMVGKKITQGIPGKLQTAIELIFEFVNLNVKSMYQGKNALIAP
FT                   LSLTVFIWVFLMNLMDLVPIDFFPFISEKVFELPAMRIVPSADINITLSMSLGVFFLIL
FT                   FYTVKIKGYVGFLKELILQPFNHPVFSIFNFILEFVSLVSKPISLGLRLFGNMYAGEMI
FT                   FILIAGLLPWWTQCFLNVPWAIFHILIISLQAFIFMVLTIVYLSMASQSHKD"
FT   CDS_pept        3139..3378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /product="ATP synthase C chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="BU003"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12731"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12731"
FT                   /db_xref="GOA:P57119"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57119"
FT                   /protein_id="BAB12731.1"
FT                   /translation="MENLNVDMLYIAVAIMVGLASIGAAIGIGILGGKFLEGAARQPDL
FT                   VPLLRTQFFVVMGLVDAIPMIAVGLGLYMLFAIS"
FT   CDS_pept        3497..3982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /product="ATP synthase B chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="BU004"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12732"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12732"
FT                   /db_xref="GOA:P57120"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57120"
FT                   /protein_id="BAB12732.1"
FT                   /translation="MNLNATILGQAISFVLFVWFCMKYIWPPIILAIETRQKEIKESLT
FT                   NAKKARDELYILEKKIHQNIIDAKQKASNILNSANKQKVSILEDARNQALEESKKIILN
FT                   TQSEINIAITHARKNLHKEVVDLSISMAEKIIKKNISKDDNQELLDELVTSLSQVKN"
FT   CDS_pept        3982..4515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /product="ATP synthase delta chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="BU005"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12733"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12733"
FT                   /db_xref="GOA:P57121"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57121"
FT                   /protein_id="BAB12733.1"
FT                   /translation="MSVADTIARPYAQAIFEIAIENNTIEKWKNILIFIKTIASHKKFK
FT                   NFLSGSISPKYLSLIFITIGTNIIDENAKNLIKLLSENQRFNILNNIFERFVKLEACYK
FT                   NIIIVQLKSAFSLKENLINKIRKVLERFFLKKTKIIYKVDPNILNGMIVKVNNTIFDLS
FT                   AQNHLKQLSDSLNF"
FT   CDS_pept        4530..6068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /product="ATP synthase alpha chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="BU006"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12734"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12734"
FT                   /db_xref="GOA:P57122"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57122"
FT                   /protein_id="BAB12734.1"
FT                   /translation="MRLNSTEISKLIKERIAQFEVFNQSYNEGSIISVSDGIIKINGLS
FT                   NVMLGEMILLPNNEYAIALNIERDTVGAVVMGPYIHISEGAKVRCTGKILEVPVGDNFL
FT                   GRVVNALGFPIDGKDSIQNDGFFPVEADAPGVIDRKSVNQPIQTGYKVIDSMIPIGRGQ
FT                   RELIIGDRQTGKTALAIDTIINQKQSGIKCIYVAIGQKLSTIINVVKKLEENNALFNTI
FT                   IVVASASEAASLQYLAPYSGCAMAEFFRNKGEDSLIIYDDLSKHAVAYRQISLLLRRPP
FT                   GREAFPGDIFYLHSRLLERASRVSMEYVQKITKNKITGKTGSITALPIIETQSGDVSAF
FT                   VPTNVISITDGQIFLESNLFNSGIRPAVNPGISVSRVGSAAQTTIIKKLSSGIRTALAQ
FT                   YQELAAFSQFSSDLDDTTRKQLNHGQKITELLKQKQYSPISIAEQALILFVAENNFLDD
FT                   ISIDKITKFEKEILIYAHNYYFDLMEEINKTGDFNIVIKDKFIKLITEFKKNQF"
FT   CDS_pept        6101..6973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /product="ATP synthase gamma chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="BU007"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12735"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12735"
FT                   /db_xref="GOA:P57123"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57123"
FT                   /protein_id="BAB12735.1"
FT                   /translation="MTSTKEIKNKIVSVTNTKKITKAMEMVAVSKMRKTEERMRSGRPY
FT                   SDIIRKVIDHVTQGNLEYKHSYLEERKTNRIGMIIISTDRGLCGGLNTNLFKQVLFKIQ
FT                   NFAKVNIPCDLILFGLKSLSVFKLCGSNILAKATNLGENPKLEELINSVGIILQEYQCK
FT                   RIDKIFIAYNKFHNKMSQYPTITQLLPFSKKNDQDASNNNWDYLYEPESKLILDTLFNR
FT                   YIESQVYQSILENIASEHAARMIAMKTATDNSGNRIKELQLVYNKVRQANITQELNEIV
FT                   SGASAVSID"
FT   CDS_pept        6997..8394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /product="ATP synthase beta chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="BU008"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12736"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12736"
FT                   /db_xref="GOA:P57124"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57124"
FT                   /protein_id="BAB12736.1"
FT                   /translation="MATGKIIQIIGAVVDVEFNQDSVPKIYNALEVKNKQYKLILEVQQ
FT                   QLGSGVVRTIAMGSSNGLKRGLIVTDLGHYIKVPVGEATLGRIINVLGETIDNKGALKN
FT                   NQSDKIEYWEIHRSPPSYRDQASCREILETGIKVIDLICPFSKGGKVGLFGGAGVGKTV
FT                   NMMELIRNIAVEHSGYSVFTGVGERTREGNDFYHEMNDSQVLDKVSLVYGQMNEPPGNR
FT                   LRVAFTGLTIAEKFRDEGKDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEM
FT                   GLLQERITSTKNGSITSVQAVYVPADDLTDPSPATTFAHLDSTVTLSRQIASLGIYPAI
FT                   DPLNSTSRQLDPYIVGDEHYETALGVQSILQRYQELKDIIAILGMDELAEKDKLLVSRA
FT                   RKIQRFLSQPFFVAEVFTGFPGKYVSLKDNIRAFKGIIKGEFDDLPEQAFYMVGSIEEV
FT                   IEKAKKL"
FT   CDS_pept        8421..8837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /product="ATP synthase epsilon chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="BU009"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12737"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12737"
FT                   /db_xref="GOA:P57125"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57125"
FT                   /protein_id="BAB12737.1"
FT                   /translation="MNFYLDVVSLTKTIFSGFVEKIRVSGSEGELGIYPGHAQLLSILK
FT                   PGMVYIFHKKDKKEECIYISGGILEVQPSVVSILADVAIHAIDLDRSRILKTKKNAEES
FT                   IKSNNTKINKDAILLQISKEIAKLRVLEVMDKFK"
FT   CDS_pept        complement(8911..11322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="BU010"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12738"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12738"
FT                   /db_xref="GOA:P57126"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57126"
FT                   /protein_id="BAB12738.1"
FT                   /translation="MKNIYDSSNIKILRGLDAVRKRPGMYIGDTDDGSGLHHMVFEIVD
FT                   NSIDEALSGYCKEIIVTIHSDNSVSVKDDGRGIPTDIHPEENISAAEVILTVLHSGGKF
FT                   DNASYQISGGLHGVGISVVNALSEKLELIIDKNKKKYQQIYRHGKPENPLSIIGTTDTT
FT                   GTYIRFWPSYKTFTNNIKFQYEILSKRLRELSFLNSNIAIYLEDNRTSIKNCYHYKGGI
FT                   KAFIKFLNAKKTPIHTHIFYFRSTKDQIELEIAMQWNNSHQENILCFTNNIPQKDGGTH
FT                   LAGFRSGMTRTLNLHIEREGYNKKNKTTIIGEDVREGLTAIISIKIPDPKFSSQTKDKL
FT                   VSSEARSVIESLINENLIEYLLENPSDSKFIIQKIINAAKVREAARRAREINKKKSILD
FT                   LGALPGKLSDCQENDPKFSEIYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKSKF
FT                   DKMILSQEVASLITALGCGIGKNEYNIDKLRYHYIIIMTDADVDGAHIRTLLLTFFYRQ
FT                   LPELIEKGYVYIAQPPLYKLKKGRKEKYIKNDEEMNTYQIKNALKDLVLKSEDNLIINQ
FT                   KLKKFKKIMSEYHYIQIIMKQSKHYFPKLVFNELIYHNHLHNLKDIEIVKEWIYTLAEN
FT                   LNKKDNSNNHYSIEIKENLDKNIFEPTIKISRYAHYTKYDFKEEFLKSKEYLLITNLGE
FT                   SFKKYFSDKVLIEKSGSTYKIDSIKNTWKWLIKQSKRGLFIQRYKGLGEMNPEQLWNTT
FT                   MNPETRNMLQVTIKDAVSANNLFNTLMGEAVEPRRQFIENNALKAENIDV"
FT   CDS_pept        complement(11449..12549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /product="DNA polymerase III beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="BU011"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12739"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12739"
FT                   /db_xref="GOA:P57127"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57127"
FT                   /protein_id="BAB12739.1"
FT                   /translation="MKFIINNNILIKNLQKISRLLVKNTSLPILDNVLINIKNGMLSLT
FT                   GTNLEIELVAMIQLSTEHISGTATISGRKLLDICRNSLNSSNIEMQLNNNKMHIISGNS
FT                   RYILTTLPYDSFPVHHDFHHISEFFIPSDILKKMIEKIQFSMAKQDVRYYLNGILLEKT
FT                   DRSLYAVATDGYRLGISKFFLKENIIPFSIVIPRKGVIELYRLLNIPKQPIKVLVGKNN
FT                   IRVHIEDLIFTTQLIEGQYPDYKSVLLENKNNFITLNSKLLKQSLLRAAILSHEKFCGV
FT                   EIHIRNGQFKVLSDNQEEEIAEDRFNINYTGNTVKISINVYYIIEILNSITSENIFLFL
FT                   NNANNSIQIEAENDASILYVVMLLKR"
FT   CDS_pept        complement(12554..13918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /product="chromosomal replication initiator protein dnaA"
FT                   /note="BU012"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12740"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12740"
FT                   /db_xref="GOA:P57128"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57128"
FT                   /protein_id="BAB12740.1"
FT                   /translation="MSLCLWKQCLDRLQDELPNTEFSMWIRSLKAKLNNNILEIYAPNK
FT                   FVLEWVKDKYLNHLKKILQDYCGTNSPLIKFEIYQIYKENKLKKNIENNNNNKNEKLIW
FT                   SNIPKFKNLSYRSNINKRYNFQNFVEGKSNQLARSAAFQAARNPGNSYNPLFLYGATGL
FT                   GKTHLLHAIGNEILSYKYDIKIIFMNSECFVQDMVKALKNNAIEKFKLYYRSVDALLID
FT                   DIQFFAHKERSQEEFFHTFNTLIEGNQQIILTSDRYPKEINGVEDRLKSRFSWGLTIAI
FT                   DPPEIETRVAILIKKADQNNVILSNEVAFFIAKHLRSNVRELEGALNRVILNSRFTHRA
FT                   ITVDFAREALQDILAVQEKIITIDNIQKTVAKYYKIKVSDLLSKKRSRSIARPRQMAMA
FT                   MAKKLTNHSLPEIGEAFSGRDHTTVLHACCKIEQLRKENHDIKKDFLNLIRTLSK"
FT   CDS_pept        14369..14512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /product="50S ribosomal protein L34"
FT                   /note="BU013"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12741"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12741"
FT                   /db_xref="GOA:P57129"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57129"
FT                   /protein_id="BAB12741.1"
FT                   /translation="MKRTFQPSILKRNRSHGFRIRMATKNGRYILSRRRAKLRTRLTVS
FT                   SK"
FT   CDS_pept        14525..14872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /note="BU014"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12742"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12742"
FT                   /db_xref="GOA:P57130"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57130"
FT                   /protein_id="BAB12742.1"
FT                   /translation="MLNYFFKKQLRLSDSTSFQDVFNGSVKKKNTLEISILGRFNLLGH
FT                   PRLGLSIPRKNIKHAHNRNLIKRLVRETFRLLQYKLLSMDFVVIAKKNILFLNNTRIID
FT                   MLNSLWSNYYR"
FT   CDS_pept        15011..16609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yidC"
FT                   /product="60 kD inner-membrane protein"
FT                   /note="BU015"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12743"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12743"
FT                   /db_xref="GOA:P57131"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57131"
FT                   /protein_id="BAB12743.1"
FT                   /translation="MEVQRNFFIFAFLFVSFLLWQAWQSQMFLNKKTNEKIDPIFHFID
FT                   VKKNKKKIFIKNDVISLVVNMYGGDVEEASLLAYKDTLYSSRPFKLLETGSDFIYQAQS
FT                   GLIGKDGPDSSINDSRPLYSANKNFFVLGPNEKELRVPIKWLSKNGVIYKKTFILKPNR
FT                   YDVQIEYDVYNPSKESLNMNIFGQIKQTINLPKKRNVYSGNFALQTFRGAAYSSDDNKY
FT                   EKYKFDMIANNKNLHIMTESGWIAMLQQYFAVAWIPDNLGKNTIYTSSLDHDTAVIGYK
FT                   SPIINIPPNSRSIIKSKLWIGPKIQKEMKLVAPNLDLTVDYGWLWFLSQPLFKLLTILY
FT                   SIIGNWGFSIILITFIMRGLTYPLTKAQYISMAKMRALQPKIQEIKEKFSKDKQRISQE
FT                   MILLYKKEKINPLGGFLPIFIQMPIFLSLYYMLIGSVELRHAPFLLWIHDLSSQDPYYV
FT                   LPVIMGLTMFFIQKISSTNHISDPLQKKIMNFMPVIFTAFFLWFPSGLVLYYIISNLVT
FT                   IIQQKFILSNLEKNR"
FT   CDS_pept        16651..18009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thdF"
FT                   /product="thiophene and furan oxidation protein thdF"
FT                   /note="BU016"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12744"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12744"
FT                   /db_xref="GOA:P57132"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57132"
FT                   /protein_id="BAB12744.1"
FT                   /translation="MRNETIVAQVTCPGKSAVGILRISGFQTKIVAIKILGKIPLARFA
FT                   TYSNFLDENNEILDKGISLWFPAPHSLTGEDVLELQGHGSPLIMDLLIRRILSINNIRM
FT                   AKPGEFSERAFLNGKMDLIQAESIDDLINSETELSARASLNSLQGKFSFFIKELMNLII
FT                   EFRINIESNIDFSEEEININMQDIINIKFRELHDKFLKLKATVLKGSLLREGKKIVIAG
FT                   LPNSGKSSLLNILSYSDRAIVTDIPGTTRDLLYEDISINGVRCELIDTAGLRDTDDKVE
FT                   RIGIMRAWEMIRKSDHVLFVIDKTLSKSKQKKICDDFMKNILNNKTQVTFVLNKNDLIK
FT                   DEFGIKEIDGTAFISISARTGEGVNILREHIIKIEKNINNESVFIARRRHIKQLDLAYD
FT                   EFLTAENTWRESENIELLAESLSIISKFLGEIIGQCTSEDLLNHIFSSFCIGK"
FT   tRNA            complement(18028..18100)
FT                   /product="tRNA-Phe (GAA)"
FT   CDS_pept        18376..18666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mopB"
FT                   /product="10 kD chaperonin"
FT                   /note="BU018"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12745"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12745"
FT                   /db_xref="GOA:P25749"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25749"
FT                   /protein_id="BAB12745.1"
FT                   /translation="MKIRPLHDRVLVKRQEVESKSAGGIVLTGSAAGKSTRGTVTAVGK
FT                   GRVLDNGDIKPLDVKVGDVVIFNEGYGAKTEKIDNEELLILTESDILAIVE"
FT   CDS_pept        18715..20361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mopA"
FT                   /product="60 kD chaperonin"
FT                   /note="BU019"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12746"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12746"
FT                   /db_xref="GOA:P25750"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:P25750"
FT                   /protein_id="BAB12746.1"
FT                   /translation="MAAKDVKFGNEARIKMLRGVNVLADAVKVTLGPKGRNVVLDKSFG
FT                   APSITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATLLAQSIVNEGL
FT                   KAVAAGMNPMDLKRGIDKAVISAVEELKHLSVPCSDSKAITQVGTISANADEKVGSLIA
FT                   EAMEKVGNDGVITVEEGTGLQDELEVVKGMQFDRGYLSPYFINKPETGIVELENPYILM
FT                   ADKKISNVREMLPILESVAKSGKPLLIISEDLEGEALATLVVNSMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDISILTGGSVISEELAMELEKSTLEDLGQAKRVVISKDTTTIIGGVGEKH
FT                   SIQSRISQIRQEIQEATSDYDKEKLNERLAKLSGGVAVLKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALVRVAGKIADLRGQNEDQNVGIRVALRAMEAPLRQIVSNS
FT                   GEEPSVVTNNVKDGKGNYGYNAATDEYGDMIDFGILDPTKVTRSALQYAASVAGLMITT
FT                   ECMVTDLPKEDKSSDSSSSPAGGMGGMGGMM"
FT   CDS_pept        20985..21596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /product="elongation factor P"
FT                   /note="BU020"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12747"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12747"
FT                   /db_xref="GOA:P57133"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57133"
FT                   /protein_id="BAB12747.1"
FT                   /translation="MLYNQKSFHINRGCMRIYHSNNFRSGRKIIFENEPCLIESSEFVK
FT                   PGKGQSFVRVKLRKLLTKQLIEKTFKSTDSLEIADIIEYTLSYLYNDGRFWYFINNNTF
FT                   EELSVDEKIIGVHKKWLLEQDTCIVTLWNNQPISITPNNFVNLKVIHVQATLKGDTINT
FT                   SSTKLATLSTGAIVRVPLFIQVGSLIKVDTRSGEYVSRIK"
FT   CDS_pept        complement(21614..22354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaC"
FT                   /product="DNA replication protein dnaC"
FT                   /note="BU021"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12748"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12748"
FT                   /db_xref="GOA:P57134"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57134"
FT                   /protein_id="BAB12748.1"
FT                   /translation="MTFYTEFFKRLQRLMPKNIKPKFDNDEDLLAWNQEQGRLSSESII
FT                   RENKAMKMQRVLGRSGIRELYMNCSFDNYKIEHDGQRKVLKASKRYAEEFNENIASFIF
FT                   SGKPGTGKNHLASAIGNYLILHGKSILLVTVADLMSNMKGTFSGTSNITEENLLHDLSS
FT                   VDLLMIDEIGMQTESRYEKVIINQIVDRRSSSKRSTGMLSNLDHKGMKSLLGERVIDRM
FT                   RLGNSLWLTFEWDSYRQYVKGNEY"
FT   CDS_pept        complement(22354..22848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaT"
FT                   /product="primosomal protein I"
FT                   /note="BU022"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12749"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12749"
FT                   /db_xref="GOA:P57135"
FT                   /db_xref="InterPro:IPR020917"
FT                   /db_xref="InterPro:IPR040480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57135"
FT                   /protein_id="BAB12749.1"
FT                   /translation="MKILISDNISLELFCKNPIKILEKSNKGIIGVLKNKSPIFYVITP
FT                   YILKKIFDLECNLLDLDKTKQQISKKFSMHPQWTPDKDFIRQAALWGITLTEEILESEL
FT                   ASFISYWQAEGCFFHHIQWQQKLARSLQKSRSISYMSQKKRDITYIPTPDQTVPNGFRG
FT                   K"
FT   CDS_pept        complement(22945..23520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhhF"
FT                   /product="hypothetical protein"
FT                   /note="BU023"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12750"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12750"
FT                   /db_xref="GOA:P57136"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57136"
FT                   /protein_id="BAB12750.1"
FT                   /translation="MNNSFFRKNSKIYIISGNLKGRKISFKNIPNLRPTTNQIRETLFE
FT                   WLSKYIKNSRCLDCFAGSGVLGIEAISRYAAFSTLLEIEKKTFLTLKKNIKELNIYNVE
FT                   IIRTNTLHWLKKTRNKPYDIIFIDPPYHQGLVKKTINLLENKKWIKKNSFIYIEQEKKQ
FT                   SIIVPKNWTLYKKKITNQIQCYLYICST"
FT   CDS_pept        23651..24787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /product="cell division protein ftsY"
FT                   /note="BU024"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12751"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12751"
FT                   /db_xref="GOA:P57137"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57137"
FT                   /protein_id="BAB12751.1"
FT                   /translation="MKDSKKNGFFSWLSSKIKKKKTIDIRQNNTDKNHDINHEDLYTKK
FT                   DLLIKQDNPKKDEIDTLNDHGKDIEKAQNTKNNFFLRLKKSLKTTKKNLGDKIYQIFLS
FT                   KKIDEVLFEELEEKMLLADIGINTTNRIISNLIKDVNREDLKNSEKLYFLLKRKMFNIL
FT                   KKVEIPLEISSHSPFVILVVGVNGTGKTTTVAKLAEKYKLEGKSIMLAAADTFRAAGIE
FT                   QLQTLGKLNNIPVIAQRSGSDPAAVIFDAVKSAKSKKIDVLIIDTAGRLHNKLHLIEEL
FT                   KKIVRVIKKIDISAPHEKLLIIDSCNGQNTIQQTEIFHKALNLTGIIITKLDGTAKGGV
FT                   VFSLADQFQIPIRYIGIGEKMQDLGHFNSQEFIESIFT"
FT   CDS_pept        24950..25804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /EC_number="2.7.7.6"
FT                   /note="BU025"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12752"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12752"
FT                   /db_xref="GOA:O05385"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:O05385"
FT                   /protein_id="BAB12752.1"
FT                   /translation="MINKVQILSVTPPGNLDAYIRIANLWPMLSIEEEKKLTKRLRYNG
FT                   DLDAAKTLILSHLRFVIHISRNYSGYGLLQSDLIQEGNIGLMKAVRRFNPEIGVRLVSF
FT                   AVHWIKSEIHEYVLRNWRIVKVATTKSQRKLFFNLRKTKKRLGWFNEEEIQIVARELGV
FT                   SSRDVREMESRMSAQDVAFNPSPEEHCDSKTNSSIQYLQDKTSNFANGVEQDNWEEHAA
FT                   NKLSSALLRLDERSRHIIHARWLDKNKKNTLQNIANNYGISAERVRQLEKNAMKKLKLA
FT                   IEA"
FT   CDS_pept        complement(25945..27810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /product="D-fructose-6-phosphate amidotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /note="BU026"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12753"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12753"
FT                   /db_xref="GOA:P57138"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57138"
FT                   /protein_id="BAB12753.1"
FT                   /translation="MKFFNKKMKGINMCGIVAAVTQRNIANFLIDGIKKLEYRGYDSSG
FT                   LAVIDNKNNIVRIRCVGKVNELIKKTNKKKILGSIGVAHTRWATHGKVSKENTHPHISS
FT                   NIIVVHNGIIENNSTLRGFLKKQGYIFSSDTDTEVIAHLLHWEQNKKKDSLIKVIQNSI
FT                   KKLDGNYSMVVIDQNNPSKLIAARSGSPLIIGLGTEENFIASDQIALLHVTKRFIYLEE
FT                   GDIAIVARKEINIFNKNNSIIQREEVVSNIEYKSAKKGKYRYYMEKEIHEQPKSIRNTL
FT                   KNRLTNSNKVHFSELGSKENNIFYNTEHIQIVACGTSYNAAMVSRYWFEELANIPCDVE
FT                   IASEFSSRKLVVRKKSLLITLSQSGETADTLSALRYSKKLGYLGNLTICNMKSSSLVRE
FT                   SDFYILTKAGLEIGVASTKSFTTQLTVLLLLVAKIINSKKENNNTSKRIVQTLSILPVR
FT                   IEEILKKKQLIQDMANTLANKKNMLFLGRGNQYPIAMEGALKLKEISYIHAEAYPSGEL
FT                   KHGPLALIDKNIPVIMIAPENSLLEKNKKNIKEICSRGGIVYVFSNQEFDYEENINTIK
FT                   LPYVEELIAPIFYTIPLQLFAYYVALKKGRDIDQPRHLAKSVTVE"
FT   CDS_pept        complement(27844..29223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /note="BU027"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12754"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12754"
FT                   /db_xref="GOA:P57139"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57139"
FT                   /protein_id="BAB12754.1"
FT                   /translation="MLTQEIIIVILAAGKGTRMKSNHPKVLHFLGGKTILEHVIETAQS
FT                   IKPKKIILVYSDQKKPVLSNIYNIPIQWIIQKKPQGTGHAILLAIKKISDNTEILVLYG
FT                   DVPFISPVSIKKLQKSKKQSKISLLTAKVKNPNGYGRILRKKGKVISIIEDQDASNEQK
FT                   NIKEIYSGIFIAQSKDLTRWLKKIDKKNEKQEFYATDIIALAHLEGSFIKTIEPLNYEE
FT                   ILGINNKLQLSNLEKIFQKKQINKLLINGVTIKDPSHFIFRGTLQHGQNVEIDTGVILE
FT                   NNVILGDDVKIGPGCIIRNSSIDSNTNIQAYTIIENSKIGKGCIIGPFAHLRSNTLLDR
FT                   NVHIGNFVETKDTFIKNESKVKHLSYLGNSEIGSKVNIGAGSITCNYDGANKFKTIIGD
FT                   NVLVGSNTQLIAPIKIAKNTTIAAGTTVTKDVNTPCLVYNTKEQKYKKNWMRSKKIIKK
FT                   N"
FT   CDS_pept        29403..29972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yigL"
FT                   /product="hypothetical protein"
FT                   /note="BU028"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12755"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12755"
FT                   /db_xref="GOA:P57140"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57140"
FT                   /protein_id="BAB12755.1"
FT                   /translation="MYRIIAVDLDGTLLTSENKITKYTKEIIQILIQKKFYFVFASGRH
FT                   YIDIMKIKDSLKINIFIISSNGSKIYNLDNNLIFSDNLDENIASKLCRIKYSDKEIITQ
FT                   VYQNDQWYINNNKVENNFCSLLSSLQYKYFYPDDLNFKNISKIFFTSRNFQKLHILKRK
FT                   IINFYGNKVHVNFSIPGCLEIVSGTT"
FT   CDS_pept        30011..30220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cof"
FT                   /product="cof protein"
FT                   /note="BU029"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12756"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12756"
FT                   /db_xref="GOA:P57140"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57140"
FT                   /protein_id="BAB12756.1"
FT                   /translation="MSLKNCIAFGDGMNDQDMLKVAGKAYIMKNSDPHLKIALPHLEII
FT                   ESNDNDGVARCLNKIFIENNKEML"
FT   CDS_pept        31191..33467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /product="5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="BU030"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12757"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12757"
FT                   /db_xref="GOA:P57142"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57142"
FT                   /protein_id="BAB12757.1"
FT                   /translation="MTILNHTLGFPRIGLNRELKKAQEQYWSGELMIKDLLLVGSELRK
FT                   KNWQKQKESGIDYIPVGDFAWYDHVLTTSMMLGNIPERHNNTVDSIDLDCLFRIARGCP
FT                   PDISASEMTKWFNTNYHYIVPEFYKNKVLKYSWKQILDEVDEALLLGHKVKPILLGPIT
FT                   YLWLGKVKGEYFDRLDILKDIILIYKHVLKELSNRSIDFVQIDEPVLVLELPKKWKDAY
FT                   HYAYKELSGITKLLLTTYFDSIEHNIEFIRDLPVQGIHIDLVHGKYNLKNFSSKIPSEW
FT                   MLSLGVINGRNIWRSDLLKWFKSIKSISNHHRKILIGSSCSLLHTPIDLVAEKHLDKEV
FT                   KRWFSFAVQKCEELRLLSSALNDNDIDSIKEWSLPIYERSVSKRVNKIEVENRLSNVLI
FT                   DKHQRLSPYKTRSIEQNKKFNFPILPTTTIGSFPQTISIRKLRRDFKLGLVTEEEYTKI
FT                   IKKNIKKVIKIQEELDIDVLVHGEAERNDMVEYFGEHLDGFAFTDNGWVQSYGSRCVKP
FT                   PIIIGDISRPKPMTIEWSKYAQSLTKKPVKGMLTGPVTILLWSFPREDVSLKKIATQIA
FT                   LALYDEVLDLEKEKIEIIQIDEPALREGLPLRKSSWHEYLSWAVDVFRLSASGVKNTTQ
FT                   IHTHMCYCEFNDIMDSIALLDADVITIEAARSDMELLESFKKFKYPNEVGPGAYDIHSS
FT                   NIPSVQSIISLLNKAMKYIPLKRIWVNPDCGLKTRNWNETILSLKNMVEATKILREKMK
FT                   DSECD"
FT   CDS_pept        complement(33590..35167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase / IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="BU031"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12758"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12758"
FT                   /db_xref="GOA:P57143"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57143"
FT                   /protein_id="BAB12758.1"
FT                   /translation="MPSNNLIKNALISVSDKKNIVEVAEKLIINKINLFSTGGTAQILK
FT                   KNNIPVTEISDYTKFPEIMDGRVKTLHPKIMGGILGQKQKDQEIMKLYNICPIDIVIVN
FT                   FYPFEKIKNIKKNDIDNVVNNIDIGGPTLVRASAKNYKNVIVIVDLDDFQSTIDSINNN
FT                   TMNMEKRFNLASKAFEYTSYYEQIISQYFIEQNSLYKKTNNSLFPNEINFSFIKKQDLR
FT                   YGENYHQKSSFYIEKNMCDSGTISTACQIQGKTLSYNNISDSDIALECVKQFTKPACVI
FT                   VKHGNPCSVAVSHNILESYLSAYNSDPISAFGGIISFNCKLDEKTAQTIINQQFVEVII
FT                   IPEISKKAVKILQKKQNIRVLVTGKLQNNTVGLDLKKITNGLLVQEYDSHNIDYNSWSF
FT                   VTKRSPTKKELKDSIFCWQVAKFVKSNAIVYGSDEITIGIGAGQMSRIYSTKLANIKVK
FT                   DQGKNIIGATMASDAFFPFRDGIDEAASVGISSIIQPGGSIRDEEIIRAADEHNITMIF
FT                   TKKRHFKH"
FT   CDS_pept        complement(35308..35586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupA"
FT                   /product="DNA-binding protein hu-alpha"
FT                   /note="BU032"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12759"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12759"
FT                   /db_xref="GOA:P57144"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57144"
FT                   /protein_id="BAB12759.1"
FT                   /translation="MNKTQLINVISKKSNLSKIQAKLTLETTLSTIIDSLKKGESVQIV
FT                   GFGTFKVNLRSSRTGRNPQTGKEIQIPATKVPSFTSGKTLKNAIKQL"
FT   CDS_pept        complement(36321..40544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="BU033"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12760"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12760"
FT                   /db_xref="GOA:P57145"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57145"
FT                   /protein_id="BAB12760.1"
FT                   /translation="MKDLLKFLKSQTKNEDFDAIKISLASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQSKVRRERMGH
FT                   IELSSPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVIETGMTNLEKRQILTEE
FT                   QYLDSLEEFGDEFHATMGAEAIQFLLKDINLVQECNVLRIELNETNSETKRKKLTKRIK
FT                   LLESFIQSHNKPEWMILNVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPYLHLHQCGLPKKMALELFKPFIYGKLEVRGLATTIKAAKK
FT                   MVEREEAIVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLESQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREK
FT                   INGKGEGMLLNGSNEAEKVYRLGIAELHSLVKVRIIEYKKNEDKSFTAIKKIIPTTIGR
FT                   AILWMIIPKGLPFSIVNQTLGKKDISKMLNTCYRILGLKSTVFFADQIMYTGFAYAARS
FT                   GASVGIDDMVIPEKKANIINEAEIEVAEIQEQFQSGLVTAGERYNKVIDIWAAANERVA
FT                   KAMMQNLSTESVINKKGYKQKQISFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTQD
FT                   DCRTHEGILMTPLIEGGDVKEPLRERVLGRVTAENIIIPNTKNILIKRNTLLNEKWCDL
FT                   LEHNSIDNVKVRSVVNCDTDFGVCAYCYGRDLARGNLVNKGEAIGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRAAAESSIQVKNQGIINLNNAKFVINSAGKTVITSRNVELNIIDNFG
FT                   RTKESYKVPYGAIMAKGDGEKVHSGETVAKWDPHTMPVITEVNGLVRFVDMIDGQSITR
FT                   QADELTGLSSIVILDTAERMSSGKDLRPALKIIDCNGNDVLISGTDMPAQYFLPGKAIV
FT                   QLDDGVQISSGDTLARVPQESGGTKDITGGLPRVADLFEARRPKELAILAEISGIISFG
FT                   KETKGKRRLVITPVDGSDSYEEMIPKWRQLNVFEGERVDRGDVISDGPESPHDILRLRG
FT                   VQAVTRYIVNEVQEVYRLQGVKINDKHIEVIIRQMLRKATVVKSRDSDFLEGEQVEFSH
FT                   IKISNRMLDKKKKMPATFSRDLLGITKASLATESFISAASFQETTRVLTESAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGYAYHKERLNRRQKKHNNPTVSSSQISAEEASASLSELLNS
FT                   ALIEK"
FT   CDS_pept        complement(40622..44650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="BU034"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12761"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12761"
FT                   /db_xref="GOA:P57146"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57146"
FT                   /protein_id="BAB12761.1"
FT                   /translation="MVYSYTEKKRIRKDFGKRPKVLDIPYLLSIQLNSFKKFIQPDLSG
FT                   QHGLEAAFRSVFPIRGYNGNSELQYVSYRLGETIFDVKECQIRGATYSAALRVKLRLVI
FT                   YERDILEATVKDIKEQEVYMGEIPLMTNNGTFIINGTERVVVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPVSIILRALNYNTEEILN
FT                   IFFEKNIFKIENNKIVLELVPERLRGETASFNIKKNGIIYVEKGRRITAKHIQELKNNK
FT                   IKSITVPVEYILGRIVSKNYVDKKTGETIISSNTELSLEILEKLKKLGFYSIETLFTND
FT                   LDHGPYISETLRIDSSNDRMSALIEIYRVMRPGEPPTKEATENLFENLFFSEDRYDLST
FT                   VGRMKFNRSLLREETKGSSTLNKEDIIDVIKKIIDIRNGKGEVDDIDHLGNRRVRSVGE
FT                   MAENQFRIGLVRVERAVKERLSIGDLDALMPQDMINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEITHKRRISALGLGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYAQTNSHGFLETPYRKVCNGLVSEEIHYLSAIEEGNYIIAQANTNIDKTGFFTDDLVT
FT                   CRHKGESSLFNRNQVNYMDVSTQQIVSVGASLIPFPEHDDANRALMGANMQRQAVPTLK
FT                   TDKPLIGTGMERAVAVDSGVTAVAKRSGVVQYVDASRIVIKVDEKEMYSREAGIDIYNL
FT                   TKYTRSNQNTCINQQPCVNLGEKIKKGDVLADGPSTDLGELALGQNMRVAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTTIHIQELSCISRDTKLGAEEISSDIPNVGEAALSKLDESGIV
FT                   YIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVSGTVID
FT                   VQIFTRDGVKKDKRALEIEDMQLKKIKQDLTEEFKIFESSLFTHIKKTFISLDIETKQL
FT                   DTLPFEKWFSVDIKQKDKKKEIEKLAKQHHELKEEFNKKIEIKRQKITQGDDLAPGVLK
FT                   IVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPVEDMPYDENGIPVDIVLNPLGVPSRM
FT                   NIGQILETHLGMAAKGIGDKINHMLKTQEKISNLRKFIQKAFDLGDNLRQKVNLDTFSN
FT                   EEILRLAKNLKNGIPISTPVFDGAQENEIKQMLKFAGLPTSGQIILFDGRTGEKFERPV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAS
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMPESFNVLLKEIRSLGINIELESE"
FT   CDS_pept        complement(44871..45239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="BU035"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12762"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12762"
FT                   /db_xref="GOA:P57147"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57147"
FT                   /protein_id="BAB12762.1"
FT                   /translation="MSITKEQILEAISEMSVMNVVDLITAMEEKFGVSASMSINSNNHN
FT                   EKDLREEKTEFDIFLKVIGPNKVSVIKTVRSATGLGLKEAKDLVESAPTVLKENISKED
FT                   AESLKKTLEDVGAEIEIK"
FT   CDS_pept        complement(45306..45803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /product="50S ribosomal protein L10"
FT                   /note="BU036"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12763"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12763"
FT                   /db_xref="GOA:P57148"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57148"
FT                   /protein_id="BAB12763.1"
FT                   /translation="MALSIHDKKIIVSKINKISNTALSAVTADLQGVCVNKINELRKSG
FT                   REVGVKMSIVQNTLLSLAIKNTVFECLKKKLKGSTFIAYSMIHPGSGARLFKEFSKKNT
FT                   QFKITGAAFEGKLLSILEINQLADMPTYKEAIIKLLLTWKMLIAGKLIYTLSAIKQKKE
FT                   TS"
FT   CDS_pept        complement(46069..46764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /product="50S ribosomal protein L1"
FT                   /note="BU037"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12764"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12764"
FT                   /db_xref="GOA:P57149"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57149"
FT                   /protein_id="BAB12764.1"
FT                   /translation="MNKKTKRMKKIKEHINFAKLHHIDETIDLLKKSSTVKFNESIDIA
FT                   INLGINSKKSDQNIRSSTVLPNGIGRSIRVAVFTQGDNIAIAKDAGAELIGMEDLSEKI
FT                   KKEGVDFDVVIATPDAMKIVTQLGQILGPRNLMPNTKLGTITTNIAEAIKNAKTGQVRY
FT                   RNDKNGIIHATIGRINFHKNEIKENLNVFLESIKKAKPPQSKGIYIKKIVLSTTMGVGL
FT                   MVDQSTLSL"
FT   CDS_pept        complement(46767..47195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /product="50S ribosomal protein L11"
FT                   /note="BU038"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12765"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12765"
FT                   /db_xref="GOA:P57150"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57150"
FT                   /protein_id="BAB12765.1"
FT                   /translation="MAKKIQSYIKLQVSAGAANPSPPIGPALGQKGVNIMEFCKLFNKK
FT                   TENIEKGLPIPVIITVYSDRSFTFITKTPPASVLLKKLSGIKKGSSKNKSEKIGKINRS
FT                   QIKEIAIIKNNDMTGSNIENMMRSIEGTAKSMGLIIEG"
FT   CDS_pept        complement(47243..47788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="BU039"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12766"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12766"
FT                   /db_xref="GOA:P57151"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57151"
FT                   /protein_id="BAB12766.1"
FT                   /translation="MHESQKKRWYVLQAFSGFESRVAQSIREHVKLNQMEDLFGEVMVP
FT                   SQEVVEIRGGQRRKSEYKFFPGYVLIQMKMTDSTWHLIRNVPKVLGFIGGKSDKPSPIS
FT                   DKEVEIIINRLRKIGNKPRPKTLFEPGEMIRVNDGPFADFNGVVEEVDYEKSRLKVSVS
FT                   IFGRSTPVELDFRQVEKN"
FT   CDS_pept        complement(47791..48174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /product="preprotein translocase secE subunit"
FT                   /note="BU040"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12767"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12767"
FT                   /db_xref="GOA:P57152"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57152"
FT                   /protein_id="BAB12767.1"
FT                   /translation="MNKHHYNRNKHKIPEKVKWISISIFFILSFFINMCFYETQLFIRI
FT                   FIISCLMLCAIGTMIYTKKGKDILLYIVMSKKEMQKIIWPKYKETLYTTFIVISVTIFI
FT                   SFILWSIDSVIFRLIAFIISLRF"
FT   tRNA            complement(48488..48560)
FT                   /product="tRNA-Thr (GGT)"
FT   tRNA            complement(48576..48647)
FT                   /product="tRNA-Gly (TCC)"
FT   tRNA            complement(48670..48754)
FT                   /product="tRNA-Tyr (GTA)"
FT   tRNA            complement(48770..48842)
FT                   /product="tRNA-Thr (TGT)"
FT   CDS_pept        complement(48981..50051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="BU045"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12768"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12768"
FT                   /db_xref="GOA:P57153"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57153"
FT                   /protein_id="BAB12768.1"
FT                   /translation="MHKKKYFSSQSLKDLNTFAIDVTAKKIIFVKTIQSLIDISKICQL
FT                   SNIPYIILGEGSNVLFLENYVGVVIINRIKGIKIVEKKNFWLLHVFSGEKWHNLVKLTL
FT                   NLGILGLENLALIPGCIGSAAIQNIGAYGLEFKDVCQYVDILSLKDNTIKRIYKNSCKF
FT                   SYRNSIFKDQYKNEHAVIRVGIKLSKKWRPILFSSLENYITPINITAYKIFNIICKIRK
FT                   KKLPDPKKIGNAGSFFKNPLIKKKKAQKLINLYKVPNYPQKNGLVKISAAWLIENYKFK
FT                   HLQIGDAAIHKKQKLILINKKNATAQEIIKLAKIIHKCILKKFNILLEPEVDLIGASGK
FT                   IKASKIFKLNSKLKVI"
FT   CDS_pept        50166..51044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="BU046"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12769"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12769"
FT                   /db_xref="GOA:P57154"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57154"
FT                   /protein_id="BAB12769.1"
FT                   /translation="MKNYSQYHQDIMNQKLENIRNNIQCSFEFFPPKNSFLEENLWSTV
FT                   NRLSLLKPKFFSVTYGANTGEREKTYDTVQKIYKKTGIITAAHLTCIDSTPHKLKEIAY
FT                   NYWNSGIKSIVALRGDTLEKDYRHTMYAVDLVLLLKKIADFDISVAAYPELHPESKNVK
FT                   SDILNLKKKVDAGASRAITQFFFNIESYLRFRDNCIKNKINIDIIPGILPVCNFQKLKR
FT                   FSSMTNVKIPKWMLDMFNGLDDDIFTQKIIGSSIAIDMVKKLSCEGVKNFHFYTLNQSD
FT                   ITYSICHILGL"
FT   CDS_pept        complement(51056..52201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="BU047"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12770"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12770"
FT                   /db_xref="GOA:P57155"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57155"
FT                   /protein_id="BAB12770.1"
FT                   /translation="MIRKIPSFIEVYKSLIQIPTISSNNKLLDQSNKNFIDLLSNYFSD
FT                   LNFSVKNYQIPHTDKYNMLACVGSGNGGLLLSGHSDTVDFDEKKWTKDPFKLTETNNKF
FT                   YGLGAVDMKGFFALILEVISSINIKKINKPIYILATANEETDMSGARNFIQSTIIKPDC
FT                   IIIGEPTSLKLINAHKGHMSYSIKVIGDTGHSSNPDHGVNSIEIMHDVIRSLLILKKYF
FT                   KEEYQHPNFSIPYPTMNLSSIHGGSAINRICPLCILNFEIRPIPGLTLTQIEIVIKEKL
FT                   ETIMKKWSHRIFIKKLFSSVPAYECPHNSGTIKIVEKLCQLNSAAVNYCTEAPFLQRIA
FT                   PTLILGPGSIEQAHQPDEYLEHYFIQPTKNIITKLINKFCY"
FT   CDS_pept        52362..53366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="BU048"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12771"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12771"
FT                   /db_xref="GOA:P57156"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57156"
FT                   /protein_id="BAB12771.1"
FT                   /translation="MLNVVIVGASGYAGAELVNYMHRHRFANIKKIFVSKNSLNIDKLF
FT                   SDVHQQFKNIVDLRFDTIRNCTLIKKNIDAVFLATDHRVSHSLVPFFLSSNCIVFDLSA
FT                   SYRMNNKKVYLDYYGFVHEYEELLKNSVYGLAEWEQEKIKKANLIALPGCYATCIQLAL
FT                   KPLIKENVLCDKNIPIINAISGVSGAGRKASLNNSFCEVSLQPYNIFTHRHTPEIIEKL
FT                   GVPVIFIPHLGPFSRGIIATITCKLKPNVKSIDIHNIFNKFYKNKPLIRIYKKYLPSIK
FT                   SVEKQPFCDIGFVIKDDYIVIVAAEDNLLKGAAAQAVQCFNVRFGFSETESII"
FT   CDS_pept        53387..54160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="BU049"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12772"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12772"
FT                   /db_xref="GOA:P57157"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57157"
FT                   /protein_id="BAB12772.1"
FT                   /translation="MNPLVIKLGGVLLESDDAMKRLFEALVDYQKFYKRHVSVIHGGGR
FT                   LIDNLMNKLSLPVKKKNGLRITPSEHINIITGALAGTANKTLLAWALKYNINAIGLCLA
FT                   DGGSVDVERLDENLGHVGKAIPGSPLFLKKLFKEGTIPIISSIGITKDGLLMNVNADLA
FT                   ATALATTLQANLILLSDISSILDGKGQRITEIDSIQAEKLIMQGIITNGMIVKVRAALE
FT                   AARVLRRPVDIASWQNTEKLKLLFNGVNIGTRVYV"
FT   CDS_pept        54190..55401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="BU050"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12773"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12773"
FT                   /db_xref="GOA:P57158"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57158"
FT                   /protein_id="BAB12773.1"
FT                   /translation="MIRKKNNKVVLAYSGGLDTSAIIPWLKENYNFEVVAFVADIGQSK
FT                   KDLNGIEKKSLESGASSCHVFDLKEEFIENYVYPVLKTGALYEGSYLLGTAMARPIIAK
FT                   KQVELALNIGANSLCHGATGKGNDQVRFEMAYAALAPNLNVIAPWREWNLNSRESLLKY
FT                   LDKKNISTTATLEKIYSKDENSWHISTEGGLLENPWNQSNEDCWSWTVNPEDAPEKPEY
FT                   VSLQLKEGCVVSVNNQKLNPLKCVEELNSLGAKHGIGRIDIIENRLIGMKSRGCYETPG
FT                   GTIIMTAIKAIEQLVLDRESFRWREKIGLEMSSIVYDGRWFSPIRKSLQAAADSLSLEI
FT                   TGEVILKLYKGSVTAVQKKSPNSLYSEEYATFGEDKVYKQSDADGFIRLFSLSSKIRAQ
FT                   NMLK"
FT   CDS_pept        55473..56852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="BU051"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12774"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12774"
FT                   /db_xref="GOA:P57159"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57159"
FT                   /protein_id="BAB12774.1"
FT                   /translation="MGLWGGRFINESNKLFKEFNRSLSFDYILAEEDVISSVAWSKILM
FT                   KSKIITEKEQITIESALFELLKEIKENNQKILKSKCEDIHSWIEEKLIQKIGILGKKLH
FT                   TGRSRNDQITTDLKLWCRKKIHLLLENIIELQKTFILSAESNHNIIMPGYTHLQRAQPI
FT                   TFSYWCLAYVEMFRRDFSRLKDVLKRLNVSPLGSAALSGTAWKINREELALSMGFDSAT
FT                   NNALDTVSDRDYVVELLSSASISMMHLSRFSEDIIFFNSGEADFIELSDTITSGSSLMP
FT                   QKKNPDALELIRAKCGRVHGSLISILVILKSLPLSYNKDMQEDKEGLFDSIKTWNDCLC
FT                   MAILVLKNMQIKNESCRKAAEEGYSNATEIADYLVKKGIAFREAHNISGQLVLRAISEK
FT                   KSLNELKLSVFQMYSNLIKNDIYKNITLESCLEKRMSKGGVAPSQVYEEIIKAKKRLNI
FT                   F"
FT   CDS_pept        56934..57368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yibN"
FT                   /product="hypothetical protein"
FT                   /note="BU052"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12775"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12775"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57160"
FT                   /protein_id="BAB12775.1"
FT                   /translation="MQDVIFFLSKHILLISIWIFCFIAAVFFITRTLLSKSKMINNFQA
FT                   IKLINQDKAIVVDTRSLESFKEGHILNSINVPLKNIFLGKIKEIEIYKMFPIILVLSDT
FT                   YKVNACIKKFFEYGFNRVYILKNGLYYWKTDNLPLIVNDK"
FT   CDS_pept        57475..57903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /product="protein-export protein secB"
FT                   /note="BU053"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12776"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12776"
FT                   /db_xref="GOA:P57161"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57161"
FT                   /protein_id="BAB12776.1"
FT                   /translation="MLEEKKKQESFEIQRIYIKDVSFEAPNTPNIFHVNWIPTIKLNLN
FT                   TTTKKIKENIFEVVLMVKVTVKIKEDLVFLCDIDQAGIFFIANINEKRLKHCLYSYCPN
FT                   ILFPYARTCISNLVSCGSFPQMNLAPINFDALYHDHIK"
FT   CDS_pept        58005..58829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /product="serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="BU054"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12777"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12777"
FT                   /db_xref="GOA:P57162"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57162"
FT                   /protein_id="BAB12777.1"
FT                   /translation="MCILKISRIWNKILYDVSFLLKKEPILSDFYQSSILQHQSFTSSL
FT                   SYILSNKLSTSMISEKKIQGIFDDVYLNDRSILNFIVQDIKAVLKRDPAVNDYLTPLLY
FT                   LKGFHALEAYRISHYLWNTGKKSLSLYLQSRISSEFSVDIHPAAFIGSGVMLDHATGIV
FT                   IGEGVTIENDVSILHSVTLGGTGKNFSQNRHPTIRKGVVIGAGAKILGNIEVGSGAKIG
FT                   AGSIVLKNVPSDVTVVGVPAKIVSQVSSKKYYSQKKKNSLKYINIFQHGDGI"
FT   CDS_pept        complement(58935..60773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /product="RNA polymerase sigma factor rpoD"
FT                   /note="BU055"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12778"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12778"
FT                   /db_xref="GOA:P57163"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57163"
FT                   /protein_id="BAB12778.1"
FT                   /translation="MDQNPQSQLKLLVTHGKEQGYLTYSEVNDHLPEDIIDSEQIDDII
FT                   QMINDMGIPVVEEAPDADDLILNEINTDTDEDAVEAATQVLSSVESELGRTTDPVRMYM
FT                   REMGTVELLTREGEIDIAKRIEEGINQVQCSVSEYPEAITYLLEQYDRVKTGQIRLSDI
FT                   ITGFVDPNAEEIFPPTAIHIGSELLDEQQNNEEDEENNQEDHEDDHSIDPELANEKFSE
FT                   LRIQYNNTNNTIKNKNRTHKDSLLEIYNLSEVFKQFRLVPKQFDHLVNNMRHMMERVRK
FT                   QERIIIKLCVEICKMPKKNFIKIFPIKKINYLWFIREQNTNQPWSENLKKVKEDVFISV
FT                   KKLIKIEEETGLTIEQVKDINKRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQ
FT                   FLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
FT                   INKLNRISRQMLQEIGREPTPEELSEKMLIPEDKIRKVLKIAKEPISMETPIGDDDDSH
FT                   LGDFIEDTTLELPLDSATSESLRSATHDVLSGLTAREAKVLRMRFGIDMNTDHTLEEVG
FT                   KQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD"
FT   CDS_pept        complement(60941..62674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /product="DNA primase"
FT                   /note="BU056"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12779"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12779"
FT                   /db_xref="GOA:P57164"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57164"
FT                   /protein_id="BAB12779.1"
FT                   /translation="MSGKIPKYFITELLSRTNIIELINTRLELKKYGKNYQTNCPFHHD
FT                   KTPSFTVSNEKQFYYCFGCNAHGNAIDFLIQYEHLSFIESIEELALIHGVKIPFENTVQ
FT                   NSIYVKKQKLYLLMEKICKLYKKNINVTHLANKYLARRGINQNMIDFFLIGFSSLKWNE
FT                   FYKKINISKEFEQELLINNIIATDKNGYIYDRFQGRIIFPIQDNHGRIIGFGGRSLNDM
FT                   SPKYLNSPETDIFYKRKQIYGLYQVIKKCSKPVYLLVVEGYIDVITLTQYNIDYAVSIL
FT                   GTSTTTEHIQLLFKNTDIIICCYDGDDAGKNAAWKTLKKALPYISDKKTLKFILLPNQE
FT                   DPDTIIRKEGREKFQKRIDNAITMSKFFFKNILKNINLSSDDDKFHLSVHALPLINTIS
FT                   SDTIRIYLRQILARMIGILDDNQFEKFLYEKETKNTQKTYFQIKRTPMRTLIGLLVQNP
FT                   SLAKLVPVTMKFKNLQIKGLSIFLEILQTCRDNPNIHTGQLLELYRNTTIINVLKILAR
FT                   WDHMIIQKETQNMFLDLLMNIHDKILEKRREYLIAKERKKGLQMNEKKEIWSINKKLSK
FT                   R"
FT   CDS_pept        complement(62755..62970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /product="30S ribosomal protein S21"
FT                   /note="BU057"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12780"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12780"
FT                   /db_xref="GOA:P57165"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57165"
FT                   /protein_id="BAB12780.1"
FT                   /translation="MPIIKVRENEPFDVALRRFKRSCEKAGILAEIRRREFYEKPTTER
FT                   KRAKASAVKRLAKKLTRENARRIRMY"
FT   CDS_pept        63204..64214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygjD"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="BU058"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12781"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12781"
FT                   /db_xref="GOA:P57166"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57166"
FT                   /protein_id="BAB12781.1"
FT                   /translation="MRILGIETSCDDTGIAIYDTNKGLLINEIYNQRKLNNIYGGIIPE
FT                   LASREHMEAMIVLLNKIFKKKNIYKYVDMIAYTAGPGLIGSLLVGATFACSLGLSLNIP
FT                   VLPVHHMEAHLLSPMLDYKTIQFPFIGLLVSGKHTQIIGAHKFGEYEILGNCLDDAAGE
FT                   AFDKTAKLLGLKYPGGLELSKLASKGIKDYFYFPRPMIHHSDLNFSFSGLKTFAAQTIK
FT                   KSSKSMQEKANIAKAFEDAVIDILLIKTKKALKKQKWKRLVIAGGVSANQKLRKKSEIM
FT                   VKKNFNGTVFYSSLEFCTDNAAMIAYLGSLRQKEARNSQLEILVKPKWSIDDLCF"
FT   CDS_pept        complement(64192..64839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="BU059"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12782"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12782"
FT                   /db_xref="GOA:P57167"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57167"
FT                   /protein_id="BAB12782.1"
FT                   /translation="MNQTLLSKFGKPIERIKNAILALKSGQGVIILDDEERENEGDLVF
FT                   ACENMTVEQMALSIRYGSGIVCLCITESKRKQLNLPMMVKKNTSAYRTGFTVTIEASKG
FT                   ISTGVSAKDRLTTIKTAIADDAKPSDLNRPGHVFPLRAHKGGVLSRPGHTEAAIEIVSL
FT                   AGFKPAGVICELTNKDGTMARTPEIIKFSENKKMQVLTIQDLIFYIKNINHL"
FT   CDS_pept        complement(65111..66058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yb3052"
FT                   /product="kinase"
FT                   /note="BU060"
FT                   /note="putative product"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12783"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12783"
FT                   /db_xref="GOA:P57168"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57168"
FT                   /protein_id="BAB12783.1"
FT                   /translation="MKKKLINFNNSLVLVVGDLILDCYWYSKNHYMLSEQLTPIVPINK
FT                   IKEQPGGAANVAKNIAEIGGYTKIVGFIGMDNEGLILKKLMDHIRIDSDLISIKNNKTI
FT                   TKIRILSEKKQLIRVDFQEKYISNKNNLLHQKIIDSISSFKILVLSDYAKGTLANIQNI
FT                   IDLAKKMSIPILIDPKGIDFKKYSGASLLTPNLFEFEKIVGKCYRENEILQRGIKLLSE
FT                   LQLSALLVTRSKNGMTLFQKEKKPIHFPAASKIASDVTGAGDTVIAIIAASLATGYSLE
FT                   EACFYANIGASIVIQKIGTETLNINELNSVLNHQ"
FT   CDS_pept        66272..67516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /EC_number="2.7.7.72"
FT                   /note="BU061"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12784"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12784"
FT                   /db_xref="GOA:P57169"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57169"
FT                   /protein_id="BAB12784.1"
FT                   /translation="MKIYLVGGAVRDSLLNLPVKDKDWVVVGGTEKILLERNFQQVGKD
FT                   FPVFLHPETHEEYALARKERKSGKGYTGFDTDCNSDVTLEEDLIRRDLTINAIAQDEYG
FT                   NYIDPFQGKKDIECGLIRHVSESFIEDPLRVLRVARFAATLVHLGFKIAEETMLLMCII
FT                   VKKQELSYLTSNRIWNETEKALKTLNPHVYFQVLYECNALHFFFPEMYFLYEKKNFLNR
FT                   SFFKKFCNKNIILMGLAEISLLNKDIDVRFSYLCQFLSVNQIDRNYSKIFFDSYAASII
FT                   HSVCKRFKIPSYIRDIAVLNTGFYFFLNTIHYQSSKNIINLFSKVDAWRKPDRVKKLAF
FT                   LSNFNFLRNFKSEFFCIKSGCFLEKCFSVVKNVSIKLILKKGFKGYEIKQEITRLRIKK
FT                   LEFWRIKNIKHRFYL"
FT   CDS_pept        complement(67542..68339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /product="bacitracin resistance protein"
FT                   /EC_number="2.7.1.66"
FT                   /note="BU062"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12785"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12785"
FT                   /db_xref="GOA:P57170"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57170"
FT                   /protein_id="BAB12785.1"
FT                   /translation="MLDLHQVIVSIIIGVIEGITEFLPISSTGHMIIASHWLKIDNENT
FT                   KILEIFIEFGSALSILYFFHKKILRILKFNINVKKTNTKNLHILLAILPTIFFGLLFYK
FT                   KIKLLFNTYNVMYALILGGIFLLISEIFKPKKYKTCSINDISLLQSAIIGFFQIFCLYP
FT                   GFSRSGATIGTAILLGIKRSVAIEFSFIISIPLIMGASFYDFINNMHNFKILDLPIFFI
FT                   GFMISFIVSILCIKKLLKIINRTSLIFFGIYRFIISGLIYFIN"
FT   CDS_pept        complement(68425..68910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crr"
FT                   /product="glucose-permease IIA component"
FT                   /EC_number="2.7.1.191"
FT                   /note="BU063"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12786"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12786"
FT                   /db_xref="GOA:Q9WXI7"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WXI7"
FT                   /protein_id="BAB12786.1"
FT                   /translation="MSFFSDFFNSKKTEIFAPLSGDIINIEDVPDPVFSKKIVGDGIAI
FT                   KPSSNRILAPVNGTIGKIFETMHAFSIISEDNVELFIHFGIDTVKLKGEGFKKKAKDNQ
FT                   KVKIGDEIIILDLEFIKEKAESILTPVVISNIENFKKIKKSSGTIAAGQTVIITLYH"
FT   CDS_pept        complement(68960..70675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="BU064"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12787"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12787"
FT                   /db_xref="GOA:Q9WXI6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WXI6"
FT                   /protein_id="BAB12787.1"
FT                   /translation="MISGILASPGIAFGTALLLKEDEIVINRKIINIKNITKEIERFFE
FT                   GRRKSIQQLTEIKTKTKEKFGEKKESIFEGHIMLLEDEELEQEVISLIKEKNMSAAAAT
FT                   ELIIEGQAKALEKLKDEYLKNRAIDVRDIGNRLLKNILNLNIIDLNNINNEVILIAKDL
FT                   TPSETAQINLKYILGFITDLGSRTSHTSIMARSLEIPAIVGTGNITKIVKNNDFIILDS
FT                   INNQILINPSHKLINQTEVIKKKYLTKKNQLINLKNLQAITTDGHAIKIGSNIGNVEDI
FT                   KSAKKNGAECIGLYRTEFLFMGRNCLPDENEQFQAYKTIAELMKNKSVIIRTMDIGGDK
FT                   DLPYMNLPKEENPFLGWRAIRISMDRKEILHTQLNAILRASAFGKIYILFPMIISVEEI
FT                   RILKSEVRKLQIQLKNNNIPFDKNIKIGIMIETPASAIIAEYLIKEVDFFSIGTNDLTQ
FT                   YTLAVDRGNDLISHLYNPMNPSVLKLIQQVINVSHTHGKWTGMCGELAGDERATILLLG
FT                   MGLDEFSMSSISIPKIKEIIRKTSFSSAKKLAQKALTLPTNREILNLVENFVNH"
FT   CDS_pept        complement(70824..71081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /product="phosphocarrier protein HPr"
FT                   /EC_number="2.7.1.191"
FT                   /note="BU065"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12788"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12788"
FT                   /db_xref="GOA:Q9WXI5"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WXI5"
FT                   /protein_id="BAB12788.1"
FT                   /translation="MFQNQVKITAPHGLHTRPAAQFVKEAKKFTSEISIIYNGKSVNAK
FT                   SLFKIQTLGLIQGSLITLSAEGEDEKKAIEHLSLIMTELE"
FT   CDS_pept        complement(71230..72177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /product="cysteine synthase A"
FT                   /EC_number="2.5.1.47"
FT                   /note="BU066"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12789"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12789"
FT                   /db_xref="GOA:P57171"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57171"
FT                   /protein_id="BAB12789.1"
FT                   /translation="MSKIYQDNSLTIGNTPLVRLNRIGNGNILVKIESRNPSFSVKCRI
FT                   GANMIWHAEKNNNINKNVKLIEATSGNTGIALAYVAASRNYRLTLTMPETMSIERKKIL
FT                   KSLGAELILTDGRYGMKGAISKANDIISRNPSKYFLLKQFENPANPEIHQITTGPEIWN
FT                   DTNGNLDILISAVGTGGTITGITRYIKKIKRKKNLISIAVEPSESPVITQFLAGKAIEP
FT                   GPHKIQGIGPGFIPKNLDLTIIDQVITVSSEEAILTAKELMKKEGILAGISSGAALYAA
FT                   IKIQQQKKFSDKKIVVILPSSGERYLSTELFSEL"
FT   CDS_pept        72432..74459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lig"
FT                   /product="DNA ligase (NAD+)"
FT                   /EC_number="6.5.1.2"
FT                   /note="BU067"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12790"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12790"
FT                   /db_xref="GOA:P57172"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57172"
FT                   /protein_id="BAB12790.1"
FT                   /translation="MTSTKDKIEKLRKILLKYEYFYHTLNQSIISDAEYDYLFRQLYEL
FT                   ELKNKELIPSDSPTQKVGSHILQKFKKIKHFSPMLSLENTFDVNGYLNFKKRIKKSIHN
FT                   NEPLSFCCELKLDGVAISIIYEEGIFVRAATRGDGFEGENITSNARMIDSIPLKLKGID
FT                   IPKRLEIRGEVFMLKSNFIKLNKKYKLNQNKYFSNPRNAAAGSLRHIDPNITAERKLIF
FT                   SCHGCDFFVKTNKELTTHYQRLMKCLSWGIPVNKEIVICSSDIEIIQFYKKIAQKRNFL
FT                   DFDIDGIVIKVNSLELQKKIGSTTKSPRWAIAFKFSPKERITTLNDVKFQVGRTGVITP
FT                   VAYFNPVYISGVMISKASLHNKNEIERLNLHFNDTITICRSGDVIPRLLNVIEIRRCDN
FT                   AKKIIFPSFCPVCNTELLENIEEKLIRCHSGLTCDAQKKQALYHFFSKKSLYVVGLGPK
FT                   IINELVEKGLVKNPIDFFYLKDIDLIQLKNVGKRKSIKIINSIKKCKKTTLKCFIYALG
FT                   IPGVGEVVAGKIANYFIKLDKLMNSNILELNCISGVGKIISNNIFNYFSTISNREMVVK
FT                   LIKQAGIFLNDQEIHKINSEKTYFFNKKIVLTGVFKSFSRIELKTILLSLGAKISNNIS
FT                   RKTDFLIYGNNFGSKFFRAKDLDVKIINQEELNSLIRIKE"
FT   tRNA            complement(74471..74543)
FT                   /product="tRNA-Lys (TTT)"
FT   tRNA            complement(74572..74644)
FT                   /product="tRNA-Val (TAC)"
FT   CDS_pept        74771..76174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="BU070"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12791"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12791"
FT                   /db_xref="GOA:P57173"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57173"
FT                   /protein_id="BAB12791.1"
FT                   /translation="MKVKTRFAPSPTGNLHIGSIRTALYSWLFARHHNGKFVLRIEDTD
FT                   LVRSELISIDSIFNGLKWLGLNWDEGPYFQTKRLDRYKEVINVMLEKEDAYICVCSCQE
FT                   LEEIRKKQIEKGNKPRYPGTCRNLNIKNISNQNHVIRFKNPLFGKVKFQDKIRGEIVFD
FT                   NAELDDLVIQRSNGMPTYNFCVVVDDMDMKITHVIRGEDHISNTPRQINILNSLKVKIP
FT                   VYAHLSMILDEKGNKISKRKNAINIIEYYENGFLPEALLNYIIRLGWSYGDKEIFNLSE
FT                   MKELFNLKSITKSSSTVNFKKLLWMNKYYINNSPLDYVSDCLKNYMEKKNINVEKGPDL
FT                   ELLVKLFRSRHHTLKEITESCRYFYEEINFFNHTVIEKYFTRKNCFILQTCYKKIEKLS
FT                   IWDNKNISKIINDVSELIKVTKKEISMILRISMTGDICSPSISTVILLIGKEKALLRIN
FT                   NVVNYIKNL"
FT   tRNA            76347..76422
FT                   /product="tRNA-Ala (GGC)"
FT   CDS_pept        complement(76514..76810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /product="flagellar hook-basal body complex protein fliE"
FT                   /note="BU072"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12792"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12792"
FT                   /db_xref="GOA:P57174"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57174"
FT                   /protein_id="BAB12792.1"
FT                   /translation="MFIENINHQNINTKFNLLDAQKKDSENFIDYIKIALGEISKNQNH
FT                   AKIDSEKFILNQSGISLNDVMINLEKSSISMQLAVQIRNKIVSAYQEIMSQQI"
FT   CDS_pept        77074..78711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /product="flagellar M-ring protein"
FT                   /note="BU073"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12793"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12793"
FT                   /db_xref="GOA:P57175"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57175"
FT                   /protein_id="BAB12793.1"
FT                   /translation="MNFSTIEESVLKEKKKFNNFLSGFLKNSRFLIILLTAAAITAVSI
FT                   SVWIKSPEYQVLYNHLSNEDRGSIINELNEMKIPYQFTDSDGPILVPKDKVYEIRLRLA
FT                   ENNLPRGGSIGFELLDKEKFGISQYNEQINYHRALEGELARTIKKINSVKNARIHIAFS
FT                   KSSLFLQDKKKSSASIILELQPGRNLNTGQINAIMHLISSSISDLPVENITIVDQSGKL
FT                   LNQTSVEYDQVNDSQFKYTEEIETRYRNRIKNILEPLVGIGNIYAQVTAQIDFNAQEKT
FT                   QEKYSPNSDHKNQSIRSHQIIIHNEIEKSNIQEETPIPLSNSNNHVYFNNNIKNSKNLK
FT                   NNYIPVDSKINRDNTVNYELNHSVSHTKMNIGEIKRLSAAVIVNFSKDKNGKFVPLSTQ
FT                   KIKNIEHLIREAIGYSKARGDSVHLVNASFAKYDQKIPVHINHINTFRKSNFLYNFAPW
FT                   FCSFALLFLLLKKYICPFSKNNTFQNTIPVQEKKSIDTRNIIEKNTFQVDLQNNTNTDK
FT                   LIHKICNISNQNPRTIALIIRQWMSDKI"
FT   CDS_pept        78708..79703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /product="flagellar motor switch protein fliG"
FT                   /note="BU074"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12794"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12794"
FT                   /db_xref="GOA:P57176"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57176"
FT                   /protein_id="BAB12794.1"
FT                   /translation="MIVNGTEKSALLLMAIGSDQAGEILKHLTPFEVQELITAMVNIKR
FT                   VSAQKLNEILLQCYNLAIKNNAFNCNNSDKYLIKMLTKALGEKKGTSLLKEALEIRNAR
FT                   ICIKALNYMKAKQVAFLLDKEHPQIITTILICLNKNQSAEVLSFLSDKKRAEIILRIVD
FT                   FHGIEESSLVELTQVINNLLKNKKLILSEKGGIKTAAQILNSMKIKHEKEIIENISKSN
FT                   EQLADKIIKEIFLFENLVDLDDKYIKILLENIEKEKLHIALQNTSQAIREKFFKNMSHT
FT                   ESNELTLNLEKKSYISDISIKNEQKLILIMLKSIVENGRISLKNLREYYV"
FT   CDS_pept        79696..80358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /product="flagellar assembly protein fliH"
FT                   /note="BU075"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12795"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12795"
FT                   /db_xref="GOA:P57177"
FT                   /db_xref="InterPro:IPR000563"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57177"
FT                   /protein_id="BAB12795.1"
FT                   /translation="MSNLILEKKWTKWYPENISFKNTKKIKKILCSSNNFKKEDFFIDK
FT                   KNQKDLTFSKETSEINLTQKKAYETGFQTGLLKGKEENTLLKNKLNDLFLNFENSLAKF
FT                   ENELCSQLLKTVLKISSYVIGKKIDIDKQILLNYIKKIINKEGVFLKKPQFIIHPKNKT
FT                   LIEDIFKKFLNSHKWTIVCDDGIDLNGCKIKSESVDIDATVDARWQQLCRLIYLEEY"
FT   CDS_pept        80316..81719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /product="flagellum-specific ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /note="BU076"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12796"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12796"
FT                   /db_xref="GOA:P57178"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57178"
FT                   /protein_id="BAB12796.1"
FT                   /translation="MAAIMSSYLFRGILMNLRFAQFLKNISSFESRIEKLSDIINYGRL
FT                   VSINGLILEVVGLNTSIGSECLIERTIDGKNANINAEVIGFSGEKTFLLSFEDIHGIFP
FT                   GARVFSKIASNSNFFIKKLPLGMELLGRVLDGRGQPLDQLPKIDHKYYSTIKNYSINPL
FT                   NRTPITEVLDTGIRAINGLLTIGRGQKIGIFSSSGIGKSILLGMIARYTQADIIVIALI
FT                   GERGREVKDFIENILGLAGLSRSVIIAAPADVSPLLKIKAASYATNIAEYFYKNNKHVL
FT                   LIMDSLTRYAMAQREISLSLGELPVSKGYPSSIFSKIPNLIERTGIFNKNKGSITSFYT
FT                   VLTEGEDEQDPVSHLARSVLDGHIMLSRYYADLGHYPAIDIESSISRVMPNIINAKQYS
FT                   QAFYFKKLVASYQRNRDLINIGAYVSGTDVILDHAIKIWPKLEKFLQQEISEKSDYLFS
FT                   CEALNKIFI"
FT   CDS_pept        81749..82186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliJ"
FT                   /product="flagellar fliJ protein"
FT                   /note="BU077"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12797"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12797"
FT                   /db_xref="GOA:P57179"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57179"
FT                   /protein_id="BAB12797.1"
FT                   /translation="MKHKTFSLLEKIEKKKIEKETIKIKNIYLHKKKHIKQLKLLSGYQ
FT                   QEYLRKIHDKLILGVSVHQWQNYNSFISVLEVIIQDNINTIKKDEKIIQESFKIWSKNQ
FT                   IQGNIWKHLNMIHKRKILRIKKIKDAIINDSHIQLKFFKKV"
FT   CDS_pept        82195..82533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yba1"
FT                   /product="hypothetical protein"
FT                   /note="BU078"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12798"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12798"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57180"
FT                   /protein_id="BAB12798.1"
FT                   /translation="MIEIISNITSQDNVSTNKNNSFFNIINSSYLLKSTFSRFNQYFLN
FT                   KKIEFDHIIAEEKKENKDKIVISSHFIVNYLLNILNQKNTDFNSKNFNNSKNDQIKKKK
FT                   IDNNQVNL"
FT   CDS_pept        82624..83331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliK"
FT                   /product="flagellar hook-length control protein"
FT                   /note="BU079"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12799"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12799"
FT                   /db_xref="GOA:P57181"
FT                   /db_xref="InterPro:IPR001635"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57181"
FT                   /protein_id="BAB12799.1"
FT                   /translation="MHESSNIKKKNDFDFKNLKNKTLQKKINVFDTIKNHIKIINNEEK
FT                   IILPLNIKKNKKIVFDSKNINKINPMISKRHSCKILSNKKEFIKSYIEPFMSSDTKNSI
FT                   EWKKLISHKILLSISNKYNQAKIHLKPESLGSIYVSISMKNNIATLKFISEHNEVKTFL
FT                   DSYMPFLYNSLKKNGIKLKEFKISISSKKNQLKNYKNLFYKNIYYTDHIKKTLNWNEKK
FT                   IDYIKDKTIDVYV"
FT   CDS_pept        83392..84339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /product="flagellar motor switch protein fliM"
FT                   /note="BU080"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12800"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12800"
FT                   /db_xref="GOA:P57182"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57182"
FT                   /protein_id="BAB12800.1"
FT                   /translation="MLACLLITFTCEACKMGESKNLHDEIKILEKINRHFSDEFTKFFS
FT                   NFLKNSVELVSCSIKIGSCTSNKEIITNLRCLNLIEILPYKKKSFIIFPYNFLSNIIDI
FT                   LFGGQGDFKDHTKKIRDITSTESLVNKKIMKFITNAFSEIYKKYFVKEINFFNTKTFFD
FT                   FKKYNFDLNKLFLINCFNFKINNTEIFFNFLIPKSILKYQNEKKFFSTYDSHKNTCIEK
FT                   NIENKVSLNDIYNVEVNIISKIIGISVSYDKIYNLSIGDVLSIKKPNKITGFIQDQAIF
FT                   LGNYKRFNEQSIIFIEEFIDSSSESNQDKEYSNE"
FT   CDS_pept        84332..84733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /product="flagellar motor switch protein fliN"
FT                   /note="BU081"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12801"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12801"
FT                   /db_xref="GOA:P57183"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57183"
FT                   /protein_id="BAB12801.1"
FT                   /translation="MSKIQKNSDNDKLIDSEKKIPTDQDVDKNLLPQENSKNSTLDNTI
FT                   DIVDSKKTILNVPVNITVELGTSRIKIKDFLKFSKGSMLILNESIKEPLNIFMNGHLIA
FT                   SGEIVVLEEKYGIRITNIKNSLKTINISS"
FT   CDS_pept        84745..85884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /product="flagellar biosynthetic protein fliP"
FT                   /note="BU082"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12802"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12802"
FT                   /db_xref="GOA:P57184"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57184"
FT                   /protein_id="BAB12802.1"
FT                   /translation="MKNNLFFQSISNSLHPIFNSEKFLQIMSSLSEIILLILIFSWILK
FT                   KISSFKINKIISRMKIIERLSVGSQESIILVEVKQLRLLLGVTKKNISHLHTFPSNSKD
FT                   ELIKETNDTLLQKNLFDRSLKNFSKTSWKKTMFYRIIPFVFLLSLCPSAHADMPGLTSH
FT                   ILDDGSQTWSVPVQTLVFLTSLTFLPAFLLMMTSFTRIVIVFGLLRNALGTPYAPPNQI
FT                   LLGLALFLTFFIMSPTFEKIYKDAYVPFSQEKMNMEDAILKGSMPLKKFMLNQIRTPDL
FT                   ELFSKLAHISSYKNKNDIPMRILLPSFITSELKTAFQIGFTIFIPFLIIDLVVASVLMA
FT                   LGMMMVPPSTISLPFKLMLFVLVDGWQLLITSLAHSFNT"
FT   CDS_pept        85956..86225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /product="flagellar biosynthetic protein fliQ"
FT                   /note="BU083"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12803"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12803"
FT                   /db_xref="GOA:P57185"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57185"
FT                   /protein_id="BAB12803.1"
FT                   /translation="MTSEYVMELFYNAMKVALIIASPLLLAALISGLIISILQAATQVN
FT                   EQTLSFIPKIISVLGVISILGPWMLGVMLDYMHNLFNNIILIIK"
FT   CDS_pept        86225..87001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /product="flagellar biosynthetic protein fliR"
FT                   /note="BU084"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12804"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12804"
FT                   /db_xref="GOA:P57186"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57186"
FT                   /protein_id="BAB12804.1"
FT                   /translation="MLTFNSLQLITLISNFFWPMIRVLSFFSVAPIFKEKLINRKSKIL
FT                   LSGMISWLVWPFLPEVHTVLFSYFGFLLILQQILIGIVLGFTAQLLFATINLSGEIIGL
FT                   QMGLSFATFFNNNSQIGTSIISRFLNILALFVFITLNMHLYLISIVIDSFYSMPIDGYF
FT                   LNVNIFFILLKFSSSIFLNGLLLVLPIMIILLSISFVMSLLNRLSPQISIFSIGFPLNL
FT                   ILGMLMLYFLIPVMLPFLKKILDDLIFFMNNNLLHI"
FT   CDS_pept        complement(87154..87321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /product="50S ribosomal protein L33"
FT                   /note="BU085"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12805"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12805"
FT                   /db_xref="GOA:P57187"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57187"
FT                   /protein_id="BAB12805.1"
FT                   /translation="MAKKSREKIKMISSAGTGHYYTTTKNKRNTPDKLKLKKYDPVIRK
FT                   HILYNEGKIK"
FT   CDS_pept        complement(87332..87559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /product="50S ribosomal protein L28"
FT                   /note="BU086"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12806"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12806"
FT                   /db_xref="GOA:P57188"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57188"
FT                   /protein_id="BAB12806.1"
FT                   /translation="MSRICQITGKKRMIGNNRSHALNATKRKFLINIQYHRFWIADEKR
FT                   FIKLHVSTNGMRYIDKKGIETVIRKINMKK"
FT   CDS_pept        87905..90817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytfN"
FT                   /product="hypothetical protein"
FT                   /note="BU087"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12807"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12807"
FT                   /db_xref="GOA:P57189"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57189"
FT                   /protein_id="BAB12807.1"
FT                   /translation="MSIYRRYISKSVIFFSVFFVIFFLFIESSVGFKYIFNFTNRIFIG
FT                   LKAEEISGNWRDFTLKNIKYDVFGISITANSLHIVLDTRSLFKMSTIFKKIETKNVILS
FT                   LKKNTASNFSQNSLPSKISKNIFFIKYPIILKKIHADKILFTSPKVRVSFLDVLSGIKL
FT                   VRNNIIFSPTYINTIHVSSAKFNFEKKNILNKSTIIKNFNKIKKIYSFSYFSSNQTKKN
FT                   FPLNIYLKSLKCNKTQFIDYEYKNLLQVELQANIENNILQINKMKVDSSFLKMNSYGKV
FT                   IFNNDYSISCVMNSKTVIPSLYNKSINFQLKANFNVDHQLIFKLISKDLYNMKINGLVF
FT                   LNFSDYPFFIKLQSRNLSCVIKKNYIFKLKSFDGVLKGYINNYFFSLKNIFTLQDLPPI
FT                   FIDIQGRGDLNNIFLKKINFFPIKQKKFYKKVIHPEDYIKYNQYILKLIGQINITGKSD
FT                   RHTHYVHIPKIDLYANIMKKKLSILGALYYKNFNFIETPGINLLLGKNKLYLRGSLGKK
FT                   YNIYSSIYANNLDYFFPKLQGRMQAKVNFLGNNKFPIISSKILARDLNWNNIYFKNIKV
FT                   LTGININNTFSGKMLIYANKIHFYKFYINTLHIQTYSNNHKQNFSFLLKSNRLHINLII
FT                   NGAFNNKTGHWHGFFKKINIRTFWGQVTAKKNNFIHYYDSHNSITNFYQKSIKKRNCFS
FT                   SFLYNVKMSFFNLFNRSFISFESKLSINAKLKLILGKMISDGAIFLKGNNTKLEKKINK
FT                   KIFIQNIDFFKISMNLIKNDFKSKWIIKKNKKLSNNKNIFGYLNIIDIYNKKNIKGEFI
FT                   FYKFPFSFINFFTTNFKEVSGKFQSKIKLFGTLYQPKVLADVHFKNIFIRSNNILKYIT
FT                   LFFPYFLGKVDNIKINQEIMMNKGNILFTLKPFFKNNSADIEWNIAFNSKKISVLIFPK
FT                   IKVKFSSKLNLHYLFSKYDLIGYIKFSLFYFQINEKNFIF"
FT   CDS_pept        complement(90833..91381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="BU088"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12808"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12808"
FT                   /db_xref="GOA:P57190"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57190"
FT                   /protein_id="BAB12808.1"
FT                   /translation="MNLNKIVAGDDIPNDIYVIIEISSNSSPIKYEVDKKSGMLFVDRF
FT                   IPTPMFYPCNYGYINHTLSLDGDPLDVLVPSHYPIKSSCVIHCKPIGILNMQDESGDDA
FT                   KIIAVPKSKICQEYKNINDISDISELLKKQITHFFQNYKTLEKEKWVEIIGWGNCQDAK
FT                   LEINDAYNRAKKNSIFLNK"
FT   CDS_pept        91575..92915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /product="pmbA protein"
FT                   /note="BU089"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12809"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12809"
FT                   /db_xref="GOA:P57191"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57191"
FT                   /protein_id="BAB12809.1"
FT                   /translation="MQLIKEIENEELHLVNTVKNTLKLSKNINASVEVFIKKTIGISVN
FT                   VRNNVVENVEFNSDGGLFITVYNKFSKGSVSSKDFSIKNIKNMLDIAINISKYSSSDFF
FT                   SGLPDIKFLCFHSMELDLFHPWEFNIENAIKMSILSEKSAFESDKRIVNSEGSFLNSHT
FT                   TINVFGNSLGVLEKYKSTRYSNYTCMIAKDKNSMQRDFDYSLSRRIDDLIKPEILGQKT
FT                   AKRAISRLGSRKIQTMRSPIIFSSEISHMFFSHLASAISGDNVYQKSTFLINDLKMKIF
FT                   PDWLDIEENPHLKRGLGSKPFDNEGVATEIKYIIKAGILQTWLLNCYNARKLKLDSTGN
FT                   CGGIHNWLVSNQNISFEELLKKMDQGILVTELMGQGVDIINGNYSRGAVGFWVEKGKIS
FT                   YPINEITISGNLRNMWNNIVSISSDVDRRNNIQCGSVLLSEIQVSGN"
FT   misc_RNA        complement(92990..93313)
FT                   /gene="rnpB"
FT                   /product="ribonuclease P RNA component"
FT                   /note="BU090"
FT   CDS_pept        complement(93393..94241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yraL"
FT                   /product="hypotheical protein"
FT                   /note="BU091"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12810"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12810"
FT                   /db_xref="GOA:P57192"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57192"
FT                   /protein_id="BAB12810.1"
FT                   /translation="MNEFYIGILYIVPTPIGNLSDITYRALEVLKDVDIIAAENIRHTN
FT                   ILLQHFNIKNNLILMNKDNEKKQSHNLIQELKKGKKIALVSNAGTPIINDPGCILIKQC
FT                   HIFDIKVIPLPGACAAITALSASGIINNRFCYEGFLPSRKKSRCDLLHSLKEETRTIIF
FT                   YESKHRILESIKDIIEQIDKNRHIVIAREMTKKWESIYGAKASLILEWLKENKYRYKGE
FT                   MVIIIDGFKKLKNYTLSKKILDTFSILRKFFSLKTSVLITAQIHDINKNKLYQYVIKKE
FT                   E"
FT   CDS_pept        94380..95600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabB"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase I"
FT                   /EC_number="2.3.1.41"
FT                   /note="BU092"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12811"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12811"
FT                   /db_xref="GOA:P57193"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57193"
FT                   /protein_id="BAB12811.1"
FT                   /translation="MRRVVITGIGIVSSIGNNKKEVLASLYKGVSGIVSSEEMKKLGMR
FT                   SAVWGNIKLESINIITQKLSRFMNNASRYSFVAMMEAIKDAKIDREYYQKNPRVGLISG
FT                   SGCSFSKNTLTSDIHLMKNKHISKGISPYLAVKTMPSGISACLSTLFKIYGVTYSISSA
FT                   CATSAHCIGNAFELIQFGRQDLIFAGGGEEISLELAMQFDAMRALSTCFNNDPKKASRV
FT                   YDVYRDGFVISGGAGMLVIEELNSALSRSAYIYAEIIGYAATSDGSNIVVPSGDGAIRC
FT                   MNLARKGKNIPIDYLNVHGTGTKIGDLIELEAIRKVFLNEKKPMISATKSMTGHGLGAS
FT                   GVHEMIYTLLMLKYNFIAPTINIENLEPCAENMNIIQKTTNIEINTAMSNSFGFGGTNV
FT                   SLIVKKY"
FT   CDS_pept        95840..96790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talA"
FT                   /product="transaldolase A"
FT                   /EC_number="2.2.1.2"
FT                   /note="BU093"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12812"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12812"
FT                   /db_xref="GOA:P57194"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57194"
FT                   /protein_id="BAB12812.1"
FT                   /translation="MNQLSALKQFSIIVADTSDIKSICKYQPEDATTNPSLILQAVSSN
FT                   TNQNFVDQAVQYAKKKGGLYKDQIINASDKILVDLGIEILKKIPGYISSEVDARLSFST
FT                   EASILKAKKIIDLYEEQGISRNRVLIKLAATWECIKAAEELKKDSILCNLTLLFSFAQA
FT                   RACAESNVFLISPFVGRIYDWYISQNLLSKSFLGKDPGVISVCKIYEYYKKYGYKTIIM
FT                   GASFRNIQQILYLSGCDRLTISPVLLKELESNTAKIDRNLAPPSFISVPPVALSEEEFR
FT                   WEHNQDAMAVQKLSDGIRNFGKDQLRLEKIFSKKI"
FT   CDS_pept        96845..98842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktB"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="BU094"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12813"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12813"
FT                   /db_xref="GOA:P57195"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57195"
FT                   /protein_id="BAB12813.1"
FT                   /translation="MYSRKELANAIRMLSIDAVQNAQSGHPGMPMGMADIAEVLWRSFL
FT                   KHNPANPNWNDRDRFILSNGHGSMLLYSLLHLTGYNLPIEELKKFRQLNSKTPGHPETG
FT                   ETPGVETTTGPLGQGLANAVGMAIAERTLSSYFNRPGYDIINHYTWVFVGDGCLMEGIS
FT                   HEVCSLAGTLNLGKLIVFYDKNGISIDGKTAHWFTDDTAKRFESYNWHVLDNIDGHDSE
FT                   SIERSIKQAKLITNQPSIIICNTIIGFGSPNKSGTAESHGAPLGEVEISLIREQLKWNY
FT                   PPFQIPKEIYKKWNFIEEGSKLEKKWNEKFSLYQSKYPDLSTEYLRRINKKLPVEWDRV
FT                   TNNYISFLQKNRQSIASRKASQNTLEKYAMILPELIGGSADLSPSNLTMWSRCNSIKDN
FT                   LSGNYIHYGVREFGMTAIANGISHHGGFIPYTATFLMFVEYARNAVRMAALMCTKHIFV
FT                   YTHDSIGLGEDGPTHQPVEQLSSLRITPNIDVWRPSDQVETAVAWKKAIEKTSGPTALI
FT                   LSRQNLDQFERSSEQLENISYGAYILYDSKKRLDIIFISTGSELNVTLIAAKKLASLGY
FT                   SVRVVSMPCTSVFDRQDASYKEFVLPTYVAKRVAVEASIEDFWYKYVGINGVIIGMKTF
FT                   GESAPAEDLFKKFGFTVQNIFNKSLILLKS"
FT   CDS_pept        98947..100074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /note="BU095"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12814"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12814"
FT                   /db_xref="GOA:P57196"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57196"
FT                   /protein_id="BAB12814.1"
FT                   /translation="MTCSITELAKKLISIPSVSPKDLGCQDIIIKRLCAIGFDIKRVNV
FT                   NDTKNFWAFRGTGKTLTFAGHTDVVPIGQDKDWQTDPFQPVIRSGYLFGRGSADMKGAL
FT                   AAMITAAERFVNKFPNHKGRLSFLITSDEESSAVDGTIKIVEYLMSKRDMIDYCIVGEP
FT                   SSTNIVGDVIKNGRRGSITANITIYGIQGHIAYPDLADNPIHKGLPVILKILSIKLDSG
FT                   NDFFLPSSINIANIHAGNGFNNVIPGSLFVQFNIRFSSEVSEKHIQSQIVNILNSNDIN
FT                   YSIEWLFSGKPFITKKGLLIDTVIQSIFYFNKKKPILSTSGGTSDGRFIALMGSEVVEL
FT                   GLVNNTIHKVNECVKISDLKLLSCMYEDIMKNLLS"
FT   CDS_pept        complement(100464..101348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="BU096"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12815"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12815"
FT                   /db_xref="GOA:P57197"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57197"
FT                   /protein_id="BAB12815.1"
FT                   /translation="MFKGSIVALITPMDEKGQICRISLEKLINYHVASKTEAIVSIGTT
FT                   GESATLSQEEHINIVMLTLELADGRIPVIAGTGANATTEAISLTKRFEKSGVAGCLSVT
FT                   PYYNRPTQEGLYQHFKAISENTELPQILYNVPSRTGCDLLPETVAKLSHFNNIIGIKEA
FT                   TGDLSRIHKIKELVKTNFLLISGDDATALDFMQLGGQGVISVTANIAAKEMMEICSYAL
FT                   KGDFINARSINKRLMLLHEALFIEPNPIPVKWLAKKIGLIKSDTLRLPMTPVLDSTRFQ
FT                   LEKAIQYANLKIS"
FT   CDS_pept        complement(101924..102988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="BU097"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12816"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12816"
FT                   /db_xref="GOA:P57198"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57198"
FT                   /protein_id="BAB12816.1"
FT                   /translation="MSGNTIGKIFCVTTFGESHGEALGCIIDGTPPGLELSCKDLQYDL
FT                   NRRRPGTSRYTTLRREPDEVNILSGIFNGVTTGTSIGLIIYNHDHRSQDYSDIKNLFRP
FT                   GHADYTYEKKYGIRDYRGGGRSSARETAMRVAAGAIAKKYLNEKYGITIRAYLSAMGNI
FT                   KCPFKSWQEVENNPFFCSDPEKILALENLIKYLKKIGDSIGAEITIIAENIPVGLGEPV
FT                   FDRLDADLSHALMSINAAKGVEIGDGFSVINQRGSEHRDEITPQGFLTNHSGGILGGIS
FT                   NGREIVLKVAFKPTSSIRKAGNTINKNNEKVQIVTKGRHDPCVGLRAVPITEAMVAIVL
FT                   MDHLLRFRAQCSGK"
FT   CDS_pept        103284..103844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yb2331"
FT                   /product="hypothetical protein"
FT                   /note="BU098"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12817"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12817"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR022990"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57199"
FT                   /protein_id="BAB12817.1"
FT                   /translation="MDKNSRYTVDSSILFRQWLNDTREMVQDTIFHSRIQKKNNNHPVS
FT                   QRVFFEQNAHSHYFSYRNNKNLFKENPVSYIRHQSLYNVLKNLKKGRYNPDISIDLHGL
FT                   TQHQAQQALGELITTCQKEKIFCAHIMHGHGKHILKKQTPFWLSQHPDIIAFHEAPKFF
FT                   GSDAAIIVIIEINSLKKNINIFN"
FT   CDS_pept        104169..105068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="BU099"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12818"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12818"
FT                   /db_xref="GOA:P57200"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57200"
FT                   /protein_id="BAB12818.1"
FT                   /translation="MFENNRVRIAMQKTGRLSKDSIRLLTSCGVKINLKQQKLIAFAEN
FT                   MPIDVMLVRDDDIPGLVMDGVVDLGIVGENVLEEELLKRKSQKSECSYITLRRLDFGVC
FT                   RLSLALPVNTIYTNITCLKNIRIATSYPHLLKKYLDEKNISFKSCMLNGSVEVAPRAGL
FT                   ADAICDLVSTGATLEANGLREVQVVYHSHACLICKTGNINSIKKEFINKLMTRIKGVIK
FT                   ARESKYIMLHAPIKQLEAVISLLHGAERPTILKLAGDDNRVAMHMVSSETLFWETMEKL
FT                   KLLGASSILVLPIEKMME"
FT   CDS_pept        105077..106384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="BU100"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12819"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12819"
FT                   /db_xref="GOA:P57201"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57201"
FT                   /protein_id="BAB12819.1"
FT                   /translation="MKYFKNIIFWNKLHPDEQKKILSRPILKENNFIKKTVKEIIENVR
FT                   LFGNSALKKYTFLFDKQDINTFQVSKEKISSSSFYLSKVLKDSISVAQKNITCFHKAQI
FT                   PSKIDVETEVGVRCEQIYLPLNSIGIYIPGGTAPLFSTVLMLAIPAKISGCKKIILCSP
FT                   PPISNEVLYAAHICGIHDIYQVGGAQAIAALALGTETVPKVDKIFGPGNAYVTEAKLQV
FT                   SSIFNGTEIDMLAGPSELLIIADNTANPDFIAADLLSQAEHGVSSQVILLTPCFELAEK
FT                   VVLSINKQLNNLSRLSEILKTLKNSSVIIVKNLSECIEISNMYAPEHLIIQTQSPREVL
FT                   NYISNASSIFLGLWSPESAGDYASGTNHVLPTYGKSITNSSLGLCDFQKRVLVQELTAK
FT                   GLMKLSNTIEILSSAEKLQAHKNAVKIRVDFLKGKI"
FT   CDS_pept        106381..107487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /note="BU101"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12820"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12820"
FT                   /db_xref="GOA:P57202"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57202"
FT                   /protein_id="BAB12820.1"
FT                   /translation="MTDNVLKLSRKNIKKLIPYQSARRIGGEHGNILLNANESPVSIFF
FT                   KLKKKPFNRYPECQPSKLISSYAHYVNLSCNQILATRGADEGIELLIKAFCEPGKDAII
FT                   YCPPTYDMYRINATIAGVEIKEIPTIKNTWQLDLLNIKLNLSRVKLIYICNPNNPTGNI
FT                   FFKKDLIFLLNITLGQALVVIDEAYIEFSPEESMTNYLKDYPNLVVLRTLSKAFALAGI
FT                   RCGFTLAKKEIIQTLSKVISPYPISIPVSDIAIRSLEKDYVQLMKNRVLDSNNNRIWLI
FT                   NQLKNITCVETVFESNANYVLVKFSMFEKVFETLWNKGIILRNQNEKTNLKKCIRISMG
FT                   TRSESLRLIKELKIFSKKNMCQGEMSEK"
FT   CDS_pept        107477..108538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /product="imidazoleglycerol-phosphate dehydratase /
FT                   histidinol-phosphatase"
FT                   /EC_number="3.1.3.15"
FT                   /EC_number="4.2.1.19"
FT                   /note="BU102"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12821"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12821"
FT                   /db_xref="GOA:P57203"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR005954"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020566"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57203"
FT                   /protein_id="BAB12821.1"
FT                   /translation="MKNKILFIDRDGTLIDEPINTFQVDSINKLVFKKYVISSLRKLVE
FT                   LDYKLIMITNQDGLGTESFPLQDFSTAHLFMLSVFRSEGVIFDDILICPHFLDDDCVCR
FT                   KPKIKMIEPWLDKIDLKKSYVIGDRDTDMQLSNNLKIKGIKYKEDICNWLHITKYIIKH
FT                   NRYAEIIRRTKETKVSIKVWLDLEETSKIDTGVKFFDHMLEQLSVHSGICMNISVQGDL
FT                   DIDDHHTIEDTGIVLGEALLQALGKKNGLSRFGFYLPMDESRSNCIMDISNRPYLNFKA
FT                   KFNHKMAGDLSTNMVEHFFYSLCYSMKITLHLYAEGKNDHHCIESLFKVFGRTLRQAIK
FT                   IEGNMLPTSKGIL"
FT   CDS_pept        108538..109128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /product="amidotransferase hisH"
FT                   /note="BU103"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12822"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12822"
FT                   /db_xref="GOA:P57204"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57204"
FT                   /protein_id="BAB12822.1"
FT                   /translation="MYIVIVDTGCANLTSIKVAINNLGYNATITSESSIILKSNKIFLP
FT                   GVGTASAVMDLLSKKKIINVIRECKQTILGICLGMQLFCASSEESNGVKTIGIIKTPAL
FT                   RLKVNNLSLPHIGWNQITFQKGHALFKNIPNNSRFYFVHSYMVPINKYTLSTTNYGINF
FT                   SSIIQKDNFFGVQFHPEKSGNIGSQLLKNFLEI"
FT   CDS_pept        109133..109873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="BU104"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12823"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12823"
FT                   /db_xref="GOA:P57205"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57205"
FT                   /protein_id="BAB12823.1"
FT                   /translation="MIIPAFDLINGRTVRLYQGDYSNQKNYNVNLFNSLEVYKSKGIEI
FT                   VHLVDLDGAKNSANRQIELFKKIVSHTTVPVQVGGGIRTTKDISTLLDLGVKRVVIGSS
FT                   IVSNKKQVKQWLNFYGPDAIVLALDVHVDGSNKKEISIDGWQKKTNFILEEIIEYFLSS
FT                   GLKHVLCTDISRDGTLLGPNFKLYKEICSNFKNINFQASGGVASLQDIIFLKKTGVKSI
FT                   IIGRSLLEKKFTIEEAVKCWQRES"
FT   CDS_pept        109852..110628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /product="hisF protein"
FT                   /note="BU105"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12824"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12824"
FT                   /db_xref="GOA:P57206"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57206"
FT                   /protein_id="BAB12824.1"
FT                   /translation="MLAKRIIACLDVDDGVVVKGIKFQNHKIVGDIVPLARRYAKEGID
FT                   ELVFYDITAATKNKLVDRSWIKNVSKVINIPFCVAGGIKSVEDAKKVLSSGADKISINS
FT                   SALIDPNLITKISERFGVQCVVIGIDSWFDKTKNSYMVQQYTGDISKTYQTSWKTSDWV
FT                   KKVQEKGAGEIVLNMMNKDGLQKGYDISHLSEIRKICKVPLIASGGAGSVEHFYEALYY
FT                   SNVDGVLAASVFHKNIVEIKVLKKKLIARGMEIREC"
FT   CDS_pept        110622..111269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /product="phosphoribosyl-AMP cyclohydrolase /
FT                   phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /EC_number="3.6.1.31"
FT                   /note="BU106"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12825"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12825"
FT                   /db_xref="GOA:P57207"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57207"
FT                   /protein_id="BAB12825.1"
FT                   /translation="MLKKHDLLNLDWTKTNGMIPVIIQDYSSSEVLMHGYMNQDALTKT
FT                   QEDGLVTFYSRTKNCLWTKGEISGNYLKVIEISTDCDNDTLLILVAAQGKTCHLGNSSC
FT                   FISNKYNINFLFKLEEIIEERKNKFSDNSYTSSLYKSGTSRIAQKVGEEAIETILAAMN
FT                   KDQIELINEASDLIYHLVVLLHDQDLNFNLVIDNLKKRREKNLNTNSEKLLK"
FT   CDS_pept        111628..113034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="BU107"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12826"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12826"
FT                   /db_xref="GOA:P57208"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57208"
FT                   /protein_id="BAB12826.1"
FT                   /translation="MSRQQIGVVGMAVMGRNLALNIESKNYSVSIFNRTRSVTEEVFNQ
FT                   NKKKNIVPYFSIKDFIDSLLKPRCILLMVQSGKATDETIKMILPYLEKEDILIDAGNTF
FT                   YKDTIRRNEKLSKYEINFIGMGVSGGELGALNGPSIMPGGQKEAYKLVLPMLEKISAKF
FT                   KGEPCVSYIGPNGAGHYVKMVHNGIEYGDMQLISESYFLLKYLLNMSNEELSSTFSKWN
FT                   KGELNSYLIEITKNIFIEKDEKGKYLIDRILDVAEDKGTGKWISKSALDLREPLSLITE
FT                   SVFARYLSSLKRQRIIASKILQGPKIKTFIKDKNSFIEEVRRALYLGKIISYAQGFSQL
FT                   KRASEKYHWNLKYGEIAKIFRAGCIIRANFLQKITDEYTQNKNVVNLLLTPYFSKIANE
FT                   YENSLRNIVMYAIKYGISTPTFSAAISYYDSYRALYLPANLIQAQRDYFGSHTYQRTDQ
FT                   TGYFHTNWSQ"
FT   CDS_pept        113197..113817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="BU108"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12827"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12827"
FT                   /db_xref="GOA:P57209"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57209"
FT                   /protein_id="BAB12827.1"
FT                   /translation="MLKYIKDNIIGIKMRLCDKDIEEWLERKELIIEPYPNKTLINGIT
FT                   VDIHLGNKFRFFYEHTGSCIDLSNSKIIGGLSLTEIMSNEIIFSKEQPCFLQPGSLVLC
FT                   STFESIKMPNNLVGWLDGRSSLARLGLMIHATAHRIDPGWNGNIVLEMFNAGKLTLVLR
FT                   PKMRIAALSFEVLSQPVLRPYNLRKEAKYKIQNGVVPSRIHKE"
FT   CDS_pept        113965..115608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="BU109"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12828"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12828"
FT                   /db_xref="GOA:P57210"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57210"
FT                   /protein_id="BAB12828.1"
FT                   /translation="MSSVFRKILVTCALPYANGSIHIGHMLEHIQADIWVRYHRMRGHE
FT                   VWFVSADDAHGTAIMLKAQDLEISPNKLIKNIRIEHQIDFSNFKISHDNYYSTHSLENL
FT                   YLSRKIFTCLNEKGLIKEKKIFQLYDTVKKIFLPDRFIKGTCPICKSKNQYGDNCEICS
FT                   ATYEPTDLINPISVISGKKPILKNTKHLYFDLPSFTNMLKKWIHSGVLEESVIKKTEEW
FT                   FKVGLKSWAISRDAPYFGFKIPNYPNKYFYVWLDAPIGYISAFKNLCFKSKKLNFNELW
FT                   NQNSNYELYHFIGKDIIYFHTLFWPAILEAVSFRQPSGIFVHGHLTMNGLKLSKSRGAL
FT                   IKASDWIQYFDSDSLRYYYASKLSNKTHDIEINLEDFIQKINSDIVNKLVNLAARNASF
FT                   INKYFNGYLSDKLSNIKLYKYFVNTSSSIEDFFENREFSFIVKESMRLLDVANQYINEK
FT                   KPWKIKRTEENIRELQNICTMGINLFRIIMIFLKPIVPDLAIKTESFLISKLTWDGIKK
FT                   PLLSHQINKFFPLYKRIDVEKMFEFMNICR"
FT   CDS_pept        complement(115656..116978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /product="cell cycle protein mesJ"
FT                   /note="BU110"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12829"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12829"
FT                   /db_xref="GOA:P57211"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57211"
FT                   /protein_id="BAB12829.1"
FT                   /translation="MIKEIISQYQNKSFLVAYSGGLDSTVLLYKLLEIKKKYYIKIRAI
FT                   HINHNLTLLSKKWSEHCKKICNINHIPLIVENINIKNKTNNLEEKLRIKRYNIIYNHLF
FT                   SDEILLTGHHINDQCETFFLSLKRGSGPTGLSSMSFETLFGTKKIVRPFLKKTKIELQT
FT                   WAKKKKLHWIEDFSNLNIDYDRNFIRNEVIPILEKRWSYFLKNCFRTTIICQQETRLLN
FT                   DFLRERIYKLIKFDDSLNIENFKNIKQAMCTALIRYWLLLKKIKMPSYKNIQCIYRQMI
FT                   FSRIDSNPKIILGKHEVRRYKQSLHFIKTQPSLKNTLLFWHKNNIKLTLPNNLGYLIKN
FT                   NNGTVLPGPKENELINIRFQYEGYVLILGRSKKRKIKKIWQEKNIPPWLRNQIPLLFYN
FT                   NYFISAIGVFVVNIKNKNRTKCIISWQNDLKSTTNNFFSFY"
FT   tRNA            complement(117007..117080)
FT                   /product="tRNA-Val (GAC)"
FT   CDS_pept        117204..117830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /product="riboflavin synthase alpha chain"
FT                   /EC_number="2.5.1.9"
FT                   /note="BU112"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12830"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12830"
FT                   /db_xref="GOA:P57212"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57212"
FT                   /protein_id="BAB12830.1"
FT                   /translation="MFTGIINGTATIVYIEKKKKKYRYTVELPSNLSKNLKLGDSISHN
FT                   GCCLTVKLINNSFIICDVIQETLKSTNLGILNIGDSINIERSIKYGDEIGGHIISGHVM
FT                   NTAEISKMSKSDNNCVIWLKMNNMSLMKYIFYKGFICVDGISLTVNDIIKNEFCVNIIP
FT                   YTFLFTTIKDKKNGSLVNIEIDFYTQTIVDTTERLINNNLKSLYD"
FT   CDS_pept        117867..118448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfA"
FT                   /product="hypothetical protein"
FT                   /note="BU113"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12831"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12831"
FT                   /db_xref="GOA:P57213"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57213"
FT                   /protein_id="BAB12831.1"
FT                   /translation="MKHYILFFISNILIENFILVKFLGLCPFLGASSNIETAFGMSCAT
FT                   TFVILTSSVLLWCVNFFILLPLDLIYLRIIAYMLIVSVSVQFLEIVLRKTSPILYRLLG
FT                   IFLPLITTNCTVLAIPLFSLYEHHTFLESIFYGLSASLGFALVMIIFSCIRERIVLSDI
FT                   PLPFQGAPIILITVSLISITFMGFKGLIKI"
FT   CDS_pept        118451..118954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfB"
FT                   /product="ferredoxin II"
FT                   /note="BU114"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12832"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12832"
FT                   /db_xref="GOA:P57214"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR016463"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57214"
FT                   /protein_id="BAB12832.1"
FT                   /translation="MITLIIFSFLSFLLGIILSFTAYKFRSQEDPIVAIVNELLPQSQC
FT                   AQCGYSGCYPYAKAIVENSEKINKCIPGGTDLISAISSVLSIEVPEKNLIITHKKQKNN
FT                   TVLINESNCVGCSKCASFCPVDAIVGAPNFIHTVLQEFCTGCNICLLHCPTNCIEIKKE
FT                   TYEE"
FT   CDS_pept        119117..120538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfC"
FT                   /product="membrane protein"
FT                   /note="BU115"
FT                   /note="putative product"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12833"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12833"
FT                   /db_xref="GOA:P57215"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57215"
FT                   /protein_id="BAB12833.1"
FT                   /translation="MPLPDKFFLFIQDDYHNVKLRVKINEKVLRGQPLIFSDDFNVPVH
FT                   APTSGLIENICFNSDSIKKNIKIVISPDYLDQWIRLNPIKDYKKYAPEKLIKIIHQSGV
FT                   VGLGGGQFPSSKKIIFSINRAHTLIVNAVESEPYITSDNCLIYNHISEILIGCKIICWI
FT                   TKIKTVLIAIQEDNIQSISKIQHLIKNKSLFKICIIKKKYPAGSSKVLVKSLTGKEVPH
FT                   GKHSIDIGYLIFNVATIFSIKRAIINGKPLTERVVTLMSDKNLLSGNFWVRIGTPIKYF
FT                   LTSNKLKQSFIASVYLGGPFMGKKINNLNHSILKKTNSIFITHKKEKNESISEKTCIRC
FT                   GYCSYVCPVNLLPQQLYWYIKNKNHVQTKKHYVLDCIECKACEKVCPSYIPLVKYFIQE
FT                   KNILKNITLENNRKKMSLIRFKTREQRLFNEKRMIHENNDTFLMKKKDKKINNITKTVL
FT                   KKTLQDAIERMKSKQ"
FT   CDS_pept        120631..121629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgO"
FT                   /product="hypothetical protein"
FT                   /note="BU116"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12834"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12834"
FT                   /db_xref="GOA:P57216"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57216"
FT                   /protein_id="BAB12834.1"
FT                   /translation="MFLVIVACLPGIFAKYYFFGIGTLIQIFFSIFISLVLEIIILKIR
FT                   SKNIKNYLQDTSLVLTSVLFGVSIPPLLPWWMTSIGLFFAIVVAKHLYGGIGQNIFNPA
FT                   MVGYAVLLISFPVYMNNWNERDFSLSFFNDFKKSAYIIFFKNDITTVSSSYLNIIPDAF
FT                   TTATPLNNFKIKSHLKDDFFLKENIIKNKEVSIQTSWKCINISFFLGGIFLLFTKIICW
FT                   RIPISFLSSLGMLSIITYFYSKELFMSPQVHFFSGGTMICAFFIATDPVTAACNNVGKI
FT                   VFGIIIGFLVWIIRNYSDYPDAIAFSVLFANMTVPLVDYYTKSSGYGRNNI"
FT   CDS_pept        121778..122272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfG"
FT                   /product="nitrogen fixation protein"
FT                   /note="BU117"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12835"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12835"
FT                   /db_xref="GOA:P57217"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57217"
FT                   /protein_id="BAB12835.1"
FT                   /translation="MPSNIYHTFEKKSYKIKNKLLGDHKIHNLWVLFKNKKPVAAIVET
FT                   TAPDGYSGAINMLVAAYFNGEIINARVLSHKETPGIGDKIDLSISNWITRFTGMYVASI
FT                   EDKDFKLRKYGGKIEQFTGATITPQSVTNSIKRTVVFIKKIPFIFDFLNKGIYEYQKFF
FT                   K"
FT   CDS_pept        122247..122930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgQ"
FT                   /product="hypotheical protein"
FT                   /note="BU118"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12836"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12836"
FT                   /db_xref="GOA:P57218"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57218"
FT                   /protein_id="BAB12836.1"
FT                   /translation="MNIKSFLNNRLWKNNSSLVQLLGLCPVLAMTTNAINAIGLGMTTT
FT                   LVLTITNTIISSFRKIIPKDLRIPIYMMIISSVVTSIEMLLHAYTFNLYQSLGIFIPLI
FT                   VTNCIIVGRADLIAYKSSIVESFFDGIFIGLGSMFAMFAVGSIREILGNGTLFFGANKI
FT                   ISNIHSSVFFTLLDKKFTIILAVFPPGGFLILGFLIAIKNFIDLYYKKNTIKNIEQCSC
FT                   SNKIK"
FT   CDS_pept        122941..123573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="BU119"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12837"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12837"
FT                   /db_xref="GOA:P57219"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57219"
FT                   /protein_id="BAB12837.1"
FT                   /translation="MNKKKRYEILSILSRNNPEPKIELFFSSDFELLLSVILSAQSTDF
FT                   IVNKTTKILFKIANTPETIFLLGLERLKNYIKDIGLYNTKALNIIRTSFIILTKYNSIV
FT                   PNNRIELESLPGVGRKTANIILNILFKKKTIAVDTHVFRVCNRTNFAKGKNVKIVEEKL
FT                   IKVVPSIFKLNFHSWFILHGRYICTARKIKCNICLIFKLCEFKQKIF"
FT   CDS_pept        123653..125776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /product="primosomal protein N'"
FT                   /note="BU120"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12838"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12838"
FT                   /db_xref="GOA:P57220"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57220"
FT                   /protein_id="BAB12838.1"
FT                   /translation="MPDFMCPIIGGRILVPFNSKDVIGIVASFYKKNNVDQANFKHIKA
FT                   LIDTESLYSNMVLDIISWISNNYHCPAGNLFFSILPKILHSDYIIKNKYICQWSITKKG
FT                   QELNLNYFKRRKKQLYVLLILKKKHILSTELKKYNISKIILKKLEIQELCKVNLNYKIS
FT                   FKRKIIRTKKKLFFNKKISIVLNDVLKKQCFSSWLLTRVNLYLKVKFYLGLIQSVLYKG
FT                   VQILILVPYIKNINTIAFFLEKYFNASIDVMHSKLTSSKYFSNWVRTKNGENSIVIGTG
FT                   KSIFLPFLKLGLIILLEEHNLKYKSINQCRYNIRDLGILRAYKEKIPIILDSETPSLKT
FT                   LNNVLHRKCFYIKLNKYNHVNQINNNIINLKTEKIKFGLSLTLINEIYKNFTGKQVLLI
FT                   FNKFVLFFFVLMCQKCNEIFKCTNCDDYFEINQYRNILFCKFCLIQIKKPIFCYNCGSF
FT                   SLIVFKIGAEEIKKEMHSIFPKIPFFFFLNEKNINKNILNTKSFEFAISSPCIIIVTEE
FT                   LVQNYYFPHVKLISLICIDNYFLSFNYRAMEYFAQFYINLNQLTRSTKKSCKIFIQTSF
FT                   PNDINLKEICNNGYFSFSKKAMAIRKSFLLPPWSFQTIVYSASTNTKYNIIFLSLMRKI
FT                   LQKKSRKYNCFLWVLGPNNAFLSINKHKYFHQLLIQCSSRVALNNVLNESIDVINIFTI
FT                   SKRVKWFIDIEPN"
FT   CDS_pept        125936..127204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="BU121"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12839"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12839"
FT                   /db_xref="GOA:P57221"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57221"
FT                   /protein_id="BAB12839.1"
FT                   /translation="MSEFNFISRLHNRGLISHITNEDNLSKLIENKSISLYCGFDPTEE
FT                   SLHIGHLLPLIMLKRFQIAGHRPIILIGGATSLIGDPSFKEKERVFNSNYNVNIWTEKI
FT                   TKQISCFLDFNCGKNSAVLLNNNTWFKQINILSFLRDVGKYFSVNTMINRAAVKQRITR
FT                   PDQGISFTEFSYNLLQAYDFFILNQQYQADLQIGGADQWGNISSGMHLIHRKTKRVVYG
FT                   LTVPLLIQSNGIKFGKTESGTIWLDSNKTSPYKFYQFWMNIEDANVYYFLKLFTFIKVS
FT                   EINKLEKNKNIKNQIINDKSLLAKHITQLVHGKEKLLAAERITKFLFLKNTTHIEESDL
FT                   QQLKQDGIPFIEVSNVKDLQEALVLTSLAQSRTQAKNMIISNSISINTEKIRKNHIFHE
FT                   KDKLFGKFTLLSRGKKQHSLLCW"
FT   CDS_pept        complement(127212..127604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiC"
FT                   /product="hypothetical protein"
FT                   /note="BU122"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12840"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12840"
FT                   /db_xref="GOA:P57222"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57222"
FT                   /protein_id="BAB12840.1"
FT                   /translation="MNKNEVKTYLLKKNTFQNISITKDAIEQILFLINLNSDNIGIRLS
FT                   IKKSGCAGFRYSMKLLKASELKKEKDEKEVSFFYQNILIYIYSKDIPFLEGIRIDFVKN
FT                   NINKIFKFYNTKLEKFCGCGESFSIN"
FT   CDS_pept        127828..128910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yb1688"
FT                   /product="hypothetical protein"
FT                   /note="BU123"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12841"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12841"
FT                   /db_xref="GOA:P57223"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57223"
FT                   /protein_id="BAB12841.1"
FT                   /translation="MQNPKEKMDLSQSILSLIFIVSMGVISFLVIHPFILGFFWASMIV
FT                   IATWPLMLKIQKILGGKRSLAVIIMIIILLLLFIIPVFFLVNSLIATSIPIIHWLGSND
FT                   LELPELAWLQNIPLMGRKIFNSYQTLLNSDGGELIHKIRPYMGHATEFFIIQVRNCGLF
FT                   IVHSILMLFFSALLYWNGEKISISIHHFAYRLSEKNGKAILLLATQAVRAVALGVAVTA
FT                   LIQALLSGIGLLVSGVPYWALLMIIIFFSCLIQLGPLPILIPSIIWLYWNDDTTWGTIL
FT                   LIWSCFVFILDHILRPFFIRIGADLPILLTLSGVIGGLLTFGMIGLFIGPVVLVIFYRL
FT                   TISWIYGISIASFLENTSLK"
FT   CDS_pept        129262..130308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroH"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase
FT                   (Trp-sensitive)"
FT                   /EC_number="2.5.1.54"
FT                   /note="BU124"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12842"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12842"
FT                   /db_xref="GOA:P57224"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57224"
FT                   /protein_id="BAB12842.1"
FT                   /translation="MKKTDELRTIRIDPLITPAELARQYAITSDIMDTVIATRQNIARI
FT                   MTGQDARLLVVIGPCSVHDPIAAVEYAHRLYELRVKYKDRLEIIMRTYFEKPRTVVGWK
FT                   GLISDPDLNGSFRVNHGLAVARKLLLDINALGMPAATEFLDIVIGQFIADLISWGAIGA
FT                   RTTESQIHREMASALSCPVGFKNGTDGNIRIAIDAIRAAKVRHLFFAPNKDGQMTINHT
FT                   SGNPYGHIIMRGGRAPNYHPDDINSAVKHLREFDLLEHLMIDFSHGNCLKEHLRQKNVS
FT                   KSVSYQISHGSKAIFGVMIESFLEEGFQTVTNNQPLIYGKSITDACLNWKDSVLIIEQL
FT                   ADAVDARF"
FT   CDS_pept        130460..132388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="BU125"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12843"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12843"
FT                   /db_xref="GOA:P57225"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57225"
FT                   /protein_id="BAB12843.1"
FT                   /translation="MPVIRFYDGSQQVYEHSVSLIEIIKNKKPSIMKSLIAISVNNHFS
FT                   NLNTFIREDAFIEFVDQKNYKALNIIRYSCAQLLSYAIKNIWPLAQIATSNIIEDGFYC
FT                   DIDFKRSISEKDLILLENQMKMLVKREYNILNKLISYSEAREIFQKCFEKYKVSLIDEN
FT                   INCNSKVSLYYHENYADIDIGLQVFNIKFCKYFKLQKIGGVYWKKNKNNKMLQRIYGTA
FT                   WTNKQELDKHLDYLNELEKRDHRKIGKFLQLYHMQEESPGMIFWHNKGWIIFNELQNFV
FT                   RVKLKEYKYEEVKTPLLIDKLIWKQSGHWDNYKNAIFTTLSEHREYCIKPMNCPGHVQI
FT                   FNSRLKSYRDLPIRMAEFGSCHRNEPSGSLHGLMRVRNFTQDDAHIFCTREQVRSEIND
FT                   CIKMIYDLYSTFHFKKILVKLSTRPEKRIGTDSLWNESEKDLSDMLIENHLSFEYQSGE
FT                   GAFYGPKIEFILQDSLDRNWQCGTIQLDFYLPLRLSSFYINEKNEKKVPVIIHRAILGS
FT                   IERFIGILIEECSGNLPTWLSPVQVVIISITDISSGYVKELFKKFSDVNIRIECDLRNE
FT                   KIGFKIREHTLRRIPYILICGEKESSSKKISVRNRQGHNFGMIDVDFFIKKLQKEIITR
FT                   NFYQMEE"
FT   CDS_pept        132392..132931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /product="translation initiation factor IF-3"
FT                   /note="BU126"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12844"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12844"
FT                   /db_xref="GOA:P57226"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57226"
FT                   /protein_id="BAB12844.1"
FT                   /translation="MKGGKIVQLTRPNRINSEIRAIKVRLTGVEGDQIGIVNLREALKK
FT                   SEELGLDLVEISPNAEPPVCRIMDYGKFLYEKSKSSKEQKKKQKVIHIKEIKFRPGTDE
FT                   GDYQVKLRNLIRFLEDGDKAKITLRFRGREMAHQKIGVDVLNRVKNDLIELATVEYFPS
FT                   KIEGRQMIMILAPKKK"
FT   CDS_pept        133018..133215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /product="50S ribosomal protein L35"
FT                   /note="BU127"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12845"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12845"
FT                   /db_xref="GOA:P57227"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57227"
FT                   /protein_id="BAB12845.1"
FT                   /translation="MPKIKTLKSAAKRFKITASGKFKRKQANLRHILTKKTTTKKRHLR
FT                   PKILVSTGDMDRVKSFLPYA"
FT   CDS_pept        133258..133614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /product="50S ribosomal protein L20"
FT                   /note="BU128"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12846"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12846"
FT                   /db_xref="GOA:P57228"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57228"
FT                   /protein_id="BAB12846.1"
FT                   /translation="MARIKRGVIAHARHKKILKQAKGYYGARSRIYRVAHQAVIKAGQY
FT                   AYRDRRQRKRQFRQLWISRINAAVRQSKMSYSNFIFGLKKASINIDRKILSDIAIFDLL
FT                   SFNALVKKAKEALL"
FT   CDS_pept        133809..134798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /product="phenylalanyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.20"
FT                   /note="BU129"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12847"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12847"
FT                   /db_xref="GOA:P57229"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57229"
FT                   /protein_id="BAB12847.1"
FT                   /translation="MLNLNKLFEIIEIDIQNSKKISELDKIRIKYLGKKGVLTAFMKKL
FT                   KDFSYEDKKKHSIIINKKKQEIISKINIKKQKLSVYILEQRIKSETIDISLPGRRTEHG
FT                   GFHPITNTIDYIKNFFLKLGFQSINSPEIEDEYHNFDALNISKYHPARDSHDTFWFDRN
FT                   RLLRTQTSSMQIRIMKQEKPPIRFIFPGKVYRNDYDITHTPMFHQIEGLIVDKNINFSN
FT                   LKWIIYKFLYDFFGKEVLIKFRPSYFPFTVPSAEVDIIDHNGKSLEILGCGMVHPNVLK
FT                   NVNIDSKIYSACAFGLGIERIAMLRYGITDIRSFFENDIRFLKQFKYN"
FT   CDS_pept        134808..137195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /product="phenylalanyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.20"
FT                   /note="BU130"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12848"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12848"
FT                   /db_xref="GOA:P57230"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57230"
FT                   /protein_id="BAB12848.1"
FT                   /translation="MKFSEKWLREWIDPQVSSKILHEQISNSGIEVEHVENFKSEFHGV
FT                   VVGKIVQCTFHNESNNLKVLKVDIGKKKLLNIICGASNCRNGIKVAVATVGATLPKNIT
FT                   INKKILKGAWSEGMLCSFFELGLFLNDNKIIEFPKETLVGINVYDYFLLEDNIIKVSIT
FT                   SNRPDGLSILGLSRNIAAINDLRISPLKNRLVPAVIQKKINIDIQADKECMNFFGRIIE
FT                   NININVDTPFWMKKKLFFSNVLSENIITNIIHYVLIELGQPLNILDADNINDSIIVRMA
FT                   RHEEDLFLKNNIKISLNENILVFSDSNKILSLPGNINSNIVDVDKNTKNIFLSSYLINR
FT                   KYISYIIKKMNMNTVLEYHYYGVDPFLQNYAIEYATDLILKICGGVPGPINEKKCNFQI
FT                   HKNNTIRLHHERLNKIIGFFIDTSVISKILYRLDYQLKFQKTFWDVISPSWRFDILIEE
FT                   DVIGDILRIYEYNNVHLIPLKEFLNCSKKNELTDSLLKKSAVILINQGYHEVINYGFID
FT                   PKIQNLIFPNEENLLLSNPISQDMSCMRLSLWPGLLKNISYNKNRQQKSIRIFESGLCF
FT                   SIDKRENLGIRQEIFLAAAISGNYIKENWYYNIRKMDFYDLKGDLESILESICQLNEIE
FT                   FRRKKIHGLHPEQSASIYFRNYLIGSIGAIDPRLEKALNVSSTTFLFEISLNNFSDIKP
FT                   LKVEEISKFPTVRRDIAILISEEIAAYNVIEQCKIFFINEKVEINLFDIYAYKESHNHK
FT                   KSLGISFIFQNKKRTFQDNEINLMIDDCIGVLQKKFQAVLRK"
FT   CDS_pept        137200..137508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="himA"
FT                   /product="integration host factor alpha-subunit"
FT                   /note="BU131"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12849"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12849"
FT                   /db_xref="GOA:P57231"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57231"
FT                   /protein_id="BAB12849.1"
FT                   /translation="MVLTKAAISENLFEKLQLTKKESKEFVEFFFEEVRKSLEKGEAVK
FT                   LSGFGNFQIKKKKARPGRNPRTGEIFLITARRVVTFKAGQKLKNKINNYLIKKNNNF"
FT   CDS_pept        137550..138623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /note="BU132"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12850"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12850"
FT                   /db_xref="GOA:P57232"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57232"
FT                   /protein_id="BAB12850.1"
FT                   /translation="MQLSDFSFDLPKSLISFHPYFIRSTCRLMVMYGHTGMIFHKRFFN
FT                   IIDEINSGDLIILNNTQVIPARFFGKKESGGKVEVLVEKILGINNILASIKNSKNINIG
FT                   SKIFFGYKDKIKGSVVDCKNSFFEIFFHDNIDSAIDIINNIGEIPLPPYIKRFRNKLDV
FT                   DLYQTVYKKKTGSIAAPTAGLHFDLPLLEALHNKGVDIDYITLHIGSGTFQPIRRVQIE
FT                   EHIMHSESVEVSSSVIQKIKSCKKKGGRIIAVGTSTLRALESAYHSSEWSDSQDFISDT
FT                   NIFIYPGYKHNIVDALITNFHFPESTLIMLVCSFLGYKNTMNAYNTAIVNKYSFFSYGD
FT                   AMYITHNKLAPYENFII"
FT   CDS_pept        138664..139776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="BU133"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12851"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12851"
FT                   /db_xref="GOA:P57233"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57233"
FT                   /protein_id="BAB12851.1"
FT                   /translation="MNFKVLYQDNNARCGVFNFNQEIIETPVFMPVGTYGAVKSISTEE
FT                   IKNTGSRIILSNAFHLYFRPGLEIIKLHGNLHNFMNWSGPILTDSGGFQVFSLSRFCKV
FT                   NEEGVIFQNHIDGKKTFLTPKISMKIQSDLGSNIVMIFDQCIEYNQNWEKTKNAMERSL
FT                   YWAKKSRIYFDSYKNKNSLFGIIHGGIYPSLRDISLQELIKIDFDGYALGGLAVGEPKI
FT                   EMYKLLDHICPQIPKNKPRYLMGVGKPEDLIEGVRRGVDMFDCVIPTRNARNGHLFVTN
FT                   GVIKIRNKKYKKDLSCLDNTCVCYTCRYYSRSYLHHLDACNEILGARLNTIHNLHYYQT
FT                   LMSNIRNSIKNNTFEQFSVNFYKQKNKIDF"
FT   CDS_pept        139801..140136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /product="hypothetical protein"
FT                   /note="BU134"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12852"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12852"
FT                   /db_xref="GOA:P57234"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57234"
FT                   /protein_id="BAB12852.1"
FT                   /translation="MSFFIQNANAVVNGTSESSNSYSLIFMAVIFLLIFYFMLFRPQQK
FT                   KDKEHKNLINSLVQGDEVITTSGLLGRIKKITKNGYILLELNETTEVFIKQDFIVSLLP
FT                   KGTLKSL"
FT   CDS_pept        complement(140188..142260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="BU135"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12853"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12853"
FT                   /db_xref="GOA:P57235"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57235"
FT                   /protein_id="BAB12853.1"
FT                   /translation="MTKKILLIEIGTEELPARLLSKISLYFYKNFIKELDFHNISYKNI
FT                   KYFSTPRRLALKIKDIDITERFVEIKKRGPSIINSYDKDGFLTEAATRWLKHCGININQ
FT                   AIRLKNEKGEWLFYKTRKKQENIESLIPKITESALKNISIKKSMRWGQDNQKFSRPIRN
FT                   IVILLDKKVIPGDVFNITSKNLLQNHLSSKDSQIKIKDAKDYPKILLEKNNIIADYFIR
FT                   KEKIIEDIENIAKKIKGFIKKNNVLIEEVTALVESPKALLVNFQEKFLQIPKKILINTI
FT                   EKKQKCFPIYNSEKKLLPYFIFISNIQTQESEKIIIGNQRVMHARLSDAEFFFKNDRKV
FT                   KLESRLLSLKKVLFQNNLGSLYEKTLRIKLLIKWIAKYSSSDVEDSIRAALLSKCDLVT
FT                   DVVCEFPELQGKIGMYYALEDKEKKDVATALEEQYLPRFSGDKLPCTPIGCGLSIADKM
FT                   DTLSGMFYIGNIPSSDKDPFALRRLAIGIIRIILEKNIPLNLEDLIKKSLSLYNKKNED
FT                   DLILFDKMIKFFMIRLFHWYEETGYSAKIIKSVLSCKSIELIDIHKKIQAISFFKKLKD
FT                   SQSIILSIKRISNILAKEKEKINGDINKKLMIEKEEIILFNNIEEFDNYTKNLFLEKKY
FT                   NDILIKIKSFENPIYNFFKKVKIYHSDSKIRLNRLLLLSKLKKIFFKIADFSYLY"
FT   CDS_pept        complement(142235..143203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="BU136"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12854"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12854"
FT                   /db_xref="GOA:P57236"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57236"
FT                   /protein_id="BAB12854.1"
FT                   /translation="MFFNILSGFLMKNYHNNFHKLITILQEYWLQQGCTIFQPLDLPIG
FT                   AGTFHNITFLGTIGPEPINAAYIQSCRRPSDGRYGENPNRLQHYYQFQVIIKPPPNNIQ
FT                   NIYLNSLYLLNIDEKIHDIRFVEDNWENPTLGAWGIGWEVWLNGMEITQFTYFQQVGGL
FT                   ECKPVSVEITYGLERIAMHMQNKSNVYDLIWNEYNHKKITYGDIFQQNEREQSQYNFQY
FT                   SDVNFLFDCFKKYELEAKKLINLKEPLLLVSYEKILQANHIFNLLDARKSLSSNERQSY
FT                   ILRIRKLTSQVAIKYLNLRKNLGFPLCHKKREIHDKENIIN"
FT   CDS_pept        143868..144713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfo"
FT                   /product="endonuclease IV"
FT                   /EC_number="3.1.21.2"
FT                   /note="BU137"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12855"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12855"
FT                   /db_xref="GOA:P57237"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57237"
FT                   /protein_id="BAB12855.1"
FT                   /translation="MNYIGAHVSSSGGLEKTVLRAIQIKATAFSFFTKNQRQWFSPPLI
FT                   QKKIDQFKAMCIKYSFQPQQILPHSSYLINLGHPIDELLRKSRKSFIDEMIRCSQLGLI
FT                   FLNFHPGSHLNKITENACLLRVSDSINIALEKTQNVIAVIENTAGQGTNIGYCFEHLSE
FT                   IIKNIDDKSRVGVCIDTCHLFASGYDLRTKKDCENTFEKFNSLIGLKYLKGIHLNDSKK
FT                   KINSRVDRHESLGLGEIGTAAFTWIIKNENFSNIPIILETANPMIWEEEIDWLRSQKKL
FT                   "
FT   CDS_pept        144748..145035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /product="50S ribosomal protein L25"
FT                   /note="BU138"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12856"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12856"
FT                   /db_xref="GOA:P57238"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57238"
FT                   /protein_id="BAB12856.1"
FT                   /translation="MLTLQAETRKEKGTGFSRRLRIHNKFPAVLYGVKKTEILLILDHN
FT                   TTFNLQKKIEFYKENLLLCVQDKKYKVKVQAIQRHSFKSKLLHIDFLYVE"
FT   CDS_pept        complement(145105..145875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /product="hypothetical protein"
FT                   /note="BU139"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12857"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12857"
FT                   /db_xref="GOA:P57239"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57239"
FT                   /protein_id="BAB12857.1"
FT                   /translation="MESWLTSFITQSLVYSLLVVGIVSFLESLALVGLLLPGIILMTTL
FT                   GTFIGDGKLSFYPAWISGTTGCLLGDWISYYIGLYFKNWLYNFNFLKKNQKLLDKTKSF
FT                   LDKHSMLTIILGRFIGPTRPLIPMVSGMLKLPLKKFVFPSIIGCILWPPVYFFPGIVTG
FT                   IAIKIPESSQSYYFKWLLLLISILIWLGIWLISKWWKMRKNHIDNRTSFFTKKKIGWLA
FT                   ILTMSSGILSLIAIQFHPTMLIFREIFSTILLGT"
FT   CDS_pept        146062..147354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /product="survival protein surA precursor"
FT                   /EC_number="5.2.1.8"
FT                   /note="BU140"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12858"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12858"
FT                   /db_xref="GOA:P57240"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57240"
FT                   /protein_id="BAB12858.1"
FT                   /translation="MKICIFIFFYIFSSIFYVLAKNNQVDNITAIVNDEIILNSDVNEI
FT                   LVFLKKSKKKFIIPLKSDFLKEKVLEKLIVDSLILQEANSKNINITKEQIDTVIKNIAL
FT                   KKHISVDHFKKQILLRNIKNPSYYDNFIKKIEILLKMKTIQDYELHKRINISEQEVNTI
FT                   FKKLIKDNEKFKKINLSYILLPSLKQDSDNAVRNRTKIAENIVYKLKKGYDFEKLLIEC
FT                   EKNKSTFIVKKMFWKPLLDIQNSFFKTLNIFKKGQILGPIVGDKGLYILKVNDIHHKKE
FT                   NIVTEFYMQHCLIKPSVILTNTEAKKKIFNIYENIKKGIYTFDDAVKNLSDDYYSSNKK
FT                   GDLGWISKESLGFDLNKKFLILDKNEISEPVKSNWGWHIFKILDRRQVDAFYKLKKNQA
FT                   FNIVLNQKIISEKNHWIEDLKNTAYIEIIRS"
FT   CDS_pept        147408..148229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /product="dimethyladenosine transferase"
FT                   /note="BU141"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12859"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12859"
FT                   /db_xref="GOA:P57241"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57241"
FT                   /protein_id="BAB12859.1"
FT                   /translation="MPKNFKKHLPLKKYGQNFLINKDTIKNIIKIIDPKTTETLVEIGP
FT                   GLAALTKPMCELLEELIVIEIDQDLLFLLKKRSFYSKLIVFYQNALNFNFLNLFHKKKQ
FT                   LIRIFGNLPYNISTSLIIFLFKQIKVIQDMNFMLQKEVAERLISTPGNKSYGRLSIISQ
FT                   YYCDIKILLNVSPEDFRPIPKVHSVFINLKPHTNSPYFVYNVNILSAITKDAFQNRRKI
FT                   LRHSLKNLFSEKELIKLEINSNLRAENVSVSHYCKLANYLYKKSNNLLKIN"
FT   CDS_pept        148274..149098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase (symmetrical)"
FT                   /EC_number="3.6.1.41"
FT                   /note="BU142"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12860"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12860"
FT                   /db_xref="GOA:P57242"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57242"
FT                   /protein_id="BAB12860.1"
FT                   /translation="MSTYFISDIHGCYEEFRILLEKSSFNDKKDYLWIAGDLVSRGPDS
FT                   LKVVKYLYSLKDRVQIVLGNHDINLIAVHAGIKDNKKENYFDEFLSSPDSVELINWLRC
FT                   QSFLKVDEKRKIIMSHAGISPQWDINIAKVCALEIEDRLSHKNYALFLKEIYHNNIDFW
FT                   RLNLNQLDRLRYSMNSFTRMRYCYPDGRLNMFCKKSPDFVKYPLRPWFLMPSSISKVYS
FT                   IFFGHWSSLKGTHVPKPFFPLDAGCCWGEELVMLRWEDGKWFSQAYLSKKCI"
FT   CDS_pept        complement(149125..149610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="BU143"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12861"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12861"
FT                   /db_xref="GOA:P57243"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57243"
FT                   /protein_id="BAB12861.1"
FT                   /translation="MNISLIAAISKNLVIGYKNKIPWYLPEDLKWFKQKTINKNIIMGR
FT                   LTWESIKKKPLPMRKNIVISSNEIKQEGIIWADSISNAIISAQYNQEIMIIGGAKIYKE
FT                   MLFYANKLYLTHIDIDIVGDAYFPEYKLYPYWKTLFRKKNTKNKMNPYNYSFEILSR"
FT   CDS_pept        complement(149700..152939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /product="carbamoyl-phosphate synthase large chain"
FT                   /EC_number="6.3.5.5"
FT                   /note="BU144"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12862"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12862"
FT                   /db_xref="GOA:P57244"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57244"
FT                   /protein_id="BAB12862.1"
FT                   /translation="MPKSTDIKSILILGAGPIVIGQACEFDYSGTQACKALKEEGYRII
FT                   LLNSNPATIMTDPDMADATYVEPIHWEIVEKIIQKEKPDALLPTMGGQTALNCALELDH
FT                   KGILKKYGVQIIGATVDAIKKAENRKLFEHSMKKLNLETAKCGIAHNIQEAFLVLNNVG
FT                   FPCIIRPSFTMGGHGGGIAYNHEEFEKICERGLELSPSTELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENLDPMGIHTGDSITVAPAQTLTDKEYQVMRNASMSILREIGVETGG
FT                   SNVQFAINPKNGRMIVIEMNPRVSRSSALASKATGFPIAKIAAKLAIGYTLDELANDIT
FT                   GTNTTASFEPSIDYIVTKIPRFNFEKFPGCDDRLTTQMKSVGEVMAIGRTFQESIQKAI
FT                   RGLEVGASGFDSKISSRDSEYLIKIRRELKDAGSERIWYIGDAFRYGMSINDVFDLTSI
FT                   DPWFLVQIKEIILLEKKIIKNGFIGLKYDFFYFLKRKGFSDQRIAILTNKNESEIRQLR
FT                   YKLNLHPVYKRIDTCSAEFSTETAYMYSTWEDECESHPSKNNKKIIILGGGPNRIGQGI
FT                   EFDYCCVHAAQALREDGFEAIMVNCNPETVSTDYDISDRLYFEPITLENVLEIVRIEKP
FT                   KGVIIQYGGQTPLKLAHEFEKEGVPIIGTSPDSIDTAENRYRFQKTVNKLRLQQPLNAT
FT                   VLTLDEAYKKADIIGYPIMVRPSYVLGGRAMEIVYEPYGLENYFKTTLKKNNTTPILLD
FT                   QYLDYATEVDVDAICDGETVLIGGIMEHIEQAGVHSGDSACSLPAYTLTSKVQNEIRRQ
FT                   VKKLAFELSVKGLMNIQFAIKNNKIYIIEVNPRAARTVPFVSKAIGLALAKISVRVMCG
FT                   KTLLEQGFIKEIIPPYFSVKEAVLPFDKFQGVDPILGPEMRSTGEVMGIGKNFSEAFSK
FT                   SMLGAHTNMKKSGRVLLSVRNNDKNNIINLAVKLKKLGFKIDATKGTSVALKKSGISSR
FT                   LVNKVHEGRPHIQDRLKNGEYSYIVNTTSCYQGIKDSKLICRSALQYKVHYDTTVNGAF
FT                   ATVMALNENPIKNIETLQKIHKKIQLFYTKK"
FT   CDS_pept        complement(152953..154116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /product="carbamoyl-phosphate synthase small chain"
FT                   /EC_number="6.3.5.5"
FT                   /note="BU145"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12863"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12863"
FT                   /db_xref="GOA:P57245"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57245"
FT                   /protein_id="BAB12863.1"
FT                   /translation="MEGVLSQLAVLVLEDGTKFHGRAIGAKGITVGEVVFNTSITGYQE
FT                   IITDPSYSHQIVTLTHPHIGNVGTNSNDEESSKIYIKGLIIRDLSLTASNYRNKKSFSS
FT                   YLKENNIIAISDIDTRKLTRILRTKGSQNGCIIEDKKQNYSIAYNKAKNFISLQDLDLA
FT                   KKVSTKSIYNWDQGSFTFKKNNFFSINKQKFLFHVVVYDFGVKRNILRMLVDRGCYLTV
FT                   VPAITDPKTVLNLSPDGIFLSNGPGDPRPCDYAIHAIQYFLKTNIPIFGICLGHQLLAL
FT                   ASGAKIVKMKFGHHGGNHPVKDIKNNRVIITSQNHSFTVDTENLPNNIEITHSSLFDGT
FT                   LQGLSLTNKSAFSFQGHPEASPGPHDASYLFDYFIKLIVSQKTTLSN"
FT   CDS_pept        complement(154326..155135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="BU146"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12864"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12864"
FT                   /db_xref="GOA:P57246"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57246"
FT                   /protein_id="BAB12864.1"
FT                   /translation="MNKKTRIAITGPIGRMGRMLIKEIQNNKHSHLTVAVVQKKHQLIG
FT                   QDIGRIIGIGEIGVLISDELNIKKNDFDVLIDFTRPAGTLEYLKYCNKFKKNIVIGTTG
FT                   FSKEEIDIIKSYSQKIAIIIASNFSIGINLLFQLIKKTTQIIGKDSDINILEYHHRNKI
FT                   DAPSGTALEIGEVISKVMNWNLNQDSIYYQKGITGIRDAKKIGFSIVRAGNIVGKHTVM
FT                   FSSYDEEIKITHTASNRMSFARGAIQSALWIHKKNTGLFDMTDVLSL"
FT   CDS_pept        complement(155139..156098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /product="lytB protein"
FT                   /note="BU147"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12865"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12865"
FT                   /db_xref="GOA:P57247"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57247"
FT                   /protein_id="BAB12865.1"
FT                   /translation="MNIILTNPRGFCAGVKRAILIVENALKVYKKTIYIRHELVHNQYV
FT                   INTLRQKGVVFVEKIEQIPDYSVVIFSAHGVSKKVVQEAVKKKLIILDATCPLVEKVHI
FT                   EVSKSSEKAIETILIGHRGHPEVEGTIGQYNNKNGKIYLVESIEDVHNLSVQNSKKLNF
FT                   FTQTTLSITNTKKIIAALKNKFPEISGPNKEDICYATTNRQIAVRQLSKIADIIFVIGS
FT                   NNSSNSNRLAELGKETGTFTKLISSFLDIKKKWLKNVNYIGITAGASAPEILVTEVIQY
FT                   LRKIGAHKPIEMIGVREKKIFKIPKKLLNIKTILDENG"
FT   CDS_pept        complement(156163..156645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /note="BU148"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12866"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12866"
FT                   /db_xref="GOA:P57248"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57248"
FT                   /protein_id="BAB12866.1"
FT                   /translation="MKQKYSKKSKKWIYITTIIFILILDISSKRLIIKYIKTYDTKKIF
FT                   SVLNFFHVHNHGAAFSFLSDQNGWQKWFLSTVSILTILVMTRIITKLKKQETKKITAYS
FT                   LIIAGATGNLIDRIFYGFVVDFIDIHINDWHFATFNIADCSIFIGIIILMRINYST"
FT   CDS_pept        complement(156645..159467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="BU149"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12867"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12867"
FT                   /db_xref="GOA:P57249"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57249"
FT                   /protein_id="BAB12867.1"
FT                   /translation="MDDYKDTLNLPKTLFSMRGNLSKKEPNILKSWNENNLYKLIRKKN
FT                   QEKKIFFLHDGPPYANGNIHIGHAVNKILKDIIIKSKNMSGFDAPYIPSWDCHGLPIEQ
FT                   KVEEKIKSNQGEISTTEFQEKCRKYAQDQVEKQKKDFIRLGVIGDWDNPHLTMNFKNEA
FT                   NIIKTLSKIVQKKHLYQDFKPIHWCLKCASSLSEAEIEYSKKKSDSIIVGFKFKYKSII
FT                   EKLFDFQISNKKEIHLLIWTTTPWTLPSSKAISIHPDFQYQLIETERCYLIIAKELVEK
FT                   TLNTLKIKKSIIRNYVKGRFLEKMICLHPFLKNIDLPVILGKHVTLESGTGAVHTAPDH
FT                   GLEDYIISQKYNIKTSNIVNFKGEYISNTHDKLDGVNVLEANSIIIELLIKNNTFFHHE
FT                   SLIHSYPHCWRHKSPVIYRATPQWFIDIDQKQLRIKLLQEIKKVRWIPEWGESRIGEMI
FT                   KKRPDWCISRQRKWGVPMSIFIHKNTRKIHPNTFVFMKKIAKKVELEGLQVWWNIDSKE
FT                   ILGEEYQSYEKILDILDVWFESGNTHTTINYKNKNYTKKNADMFLEGSDQHRGWFMSSL
FT                   IISTLISEKKPYSEVLTHGFVVDGKGQKMSKSIGNTISPNEIVDTLGADILRLWVASSN
FT                   YSNDISISNEILKSSSDIYRRIRNTARFMLANISDFDPKKNIISKENMVLLDKWAIGQT
FT                   KIVQEEIIQHYNNYNFHAVIQRLMYFCSIEMGSFYLDIIKDRQYTLKKHSQERRSSQTA
FT                   IYYIINSLVRWIAPILSFTADEIWSYLPENNSQYVFMEEWFDKLFYLDQDDLFNYQFWN
FT                   EIITIKHEINKFLEEAIQNKTINNSLETSIILYVSHELSNKLKILEQETKFIFLTSDIQ
FT                   IKLYDTAPKNAKKSKIVPYLKVSLEKIKGKKCPRCWHYFNFTKKNIKNSDICNRCILNT
FT                   IGNGEKRIFI"
FT   CDS_pept        complement(159484..160425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /product="riboflavin kinase / FMN adenylyltransferase"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /note="BU150"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12868"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12868"
FT                   /db_xref="GOA:P57250"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57250"
FT                   /protein_id="BAB12868.1"
FT                   /translation="MKIIRGIHNIKEINSNSVVTIGNFDGIHLGHQKLFSHIYQIGQKY
FT                   KLSTIVVLFEPQPLEFLRKNNAPVRITKFREKIRRISSYNFDSILCVKFNKSFQSLSAK
FT                   DFIINILINKLHLKFIVIGNDFRFGFQRNGNINLLKKLGYKYQFNVIKIRPLYKNNIKI
FT                   SSTNIRKALSENNIKLASLLLGRVFSISGRVIHGNKIGRTMNYPTANILLSKNFLLTNG
FT                   VYAVKIKYCPNKYAIGISNIGIKPSFSNTQKNKLLEVYLFDIKIDLYGKYIEIFIYKKI
FT                   RDEQFFPSKKELKNQISQDILIVQKYFNIHKN"
FT   CDS_pept        160640..160909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /product="30S ribosomal protein S20"
FT                   /note="BU151"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12869"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12869"
FT                   /db_xref="GOA:P57251"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57251"
FT                   /protein_id="BAB12869.1"
FT                   /translation="MANIKASKKDALTSEKRRKKNSSRRSMIRTFVKKVRVAIMSGNKT
FT                   TAEDAFKKMQPIIDSHVNKGLIHKNKAARYKSNLSLQIKKISKI"
FT   CDS_pept        complement(160960..162093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /product="dnaJ protein"
FT                   /note="BU152"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12870"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12870"
FT                   /db_xref="GOA:O32465"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:O32465"
FT                   /protein_id="BAB12870.1"
FT                   /translation="MAKKDYYQILGIPKSAEEREIKKAYKKLAMKYHPDRNQGDKTAEG
FT                   KFKEIKEAYEILINEEKRSAYDQYGHAAFENGQSNSTYSTFTNSADFSDIFGDVFGDIF
FT                   GGNRTQRAKKGADLCYNMEITLEEAVKGIKKEIQIPTLQKCKTCYGSGTRTGTKPRSCS
FT                   TCHGKGQIHIRKGFFTVQQSCPTCHGKGTIITDPCNLCHGQGRVETYKILSVKIPPGLD
FT                   TNDRIRLNNEGEAGANGAQSGDLYVQITVKKHPIFEREGNNLYCEVPINFTMAALGGEI
FT                   EVPTLDGRVKLKIPYETQSGKLFRIRGRGVKSVQNRNQGDLLCRVVVETPVNLNEQQKN
FT                   LLHELGNSFHGFRGEKNSPRSKRFFDGVKRFFDDLTR"
FT   CDS_pept        complement(162206..164119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /product="dnaK protein"
FT                   /note="BU153"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12871"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12871"
FT                   /db_xref="GOA:O32464"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:O32464"
FT                   /protein_id="BAB12871.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGNKPRVLENAEGDRTTPSIIAYTQE
FT                   GEVLVGQPAKRQAITNPKNTLFAIKRLIGRKFKDDEVQRDIKIMPYNIVNSDNGDAWID
FT                   VKKQKMAPPQISAEVLKKMKKTAEDYLGETIKEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKGKGNRTIAVYDLGGGTFDISIIEIDEVDKEKTFEVLATN
FT                   GDTHLGGEDFDSRLINYLVTEFKKEQGIDLRNDPLSMQRLKESAEKAKIELSSAQQTDV
FT                   NLPYITADSNGPKHLNIKVTRAKLESLVEDLILRSIEPLKVALKDAGLSVTDINDVILV
FT                   GGQTRMPMVQSKVADFFGKEPRKDVNPDEAVAVGAAVQGGVLSGDVKDVLLLDVTPLSL
FT                   GIETMGGIMTSLINKNTTIPTKHSQIFSTAEDNQSAVTIHVLQGERKRSSDNKSLGQFN
FT                   LDGINPAPRGTAQIEVTFDIDSDGILHVSAKDKKTGKEQKITIKASSGLNEEEIKKMVN
FT                   DAEANSEADQKFEELIQTRNQGDQLVHSIKKQLNENKNSIEEESKKDIQLALNKLENAL
FT                   KGEDKSDIEKNIQNLLKISSKLTEINQKKSEKDQKDNNMSANKKDENVVDAEFEEIKDP
FT                   KK"
FT   CDS_pept        164454..164858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoA"
FT                   /product="NADH dehydrogenase I chain A"
FT                   /EC_number="1.6.5.3"
FT                   /note="BU154"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12872"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12872"
FT                   /db_xref="GOA:P57252"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57252"
FT                   /protein_id="BAB12872.1"
FT                   /translation="MLINTEAVNEYLSFFMFIFFSLGLCFFMLCLSWILGGRSSSRYKN
FT                   TPFESGIVSSGNTNLYFSVKFYLIAMFFVVFDVEALYLYAWSVSIKESGWIGFSEALMF
FT                   GISLLLGLFYLVRIRALNWSSSVKNNIQLF"
FT   CDS_pept        164892..165566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoB"
FT                   /product="NADH dehydrogenase I chain B"
FT                   /EC_number="1.6.5.3"
FT                   /note="BU155"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12873"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12873"
FT                   /db_xref="GOA:P57253"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57253"
FT                   /protein_id="BAB12873.1"
FT                   /translation="MNYTLTKADSDNNNKKYPKQTIESVSDPLEEYLKKNIFMGKITQL
FT                   LHKLVNWGRKNSLWPYNFGLSCCYVEMVSAFTSVHDVARFGSEVLRASPRQADVMVIAG
FT                   TPFIKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYSVVQGVDKFLPVDIYIPGCP
FT                   PRPEAYMQALILLQKLINEERRPLSWVIGEQGVYHKKMPSERVQKRSKRINIINLSTSE
FT                   KI"
FT   CDS_pept        165657..167459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoCD"
FT                   /product="NADH dehydrogenase I chain C / D"
FT                   /EC_number="1.6.5.3"
FT                   /note="BU156"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12874"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12874"
FT                   /db_xref="GOA:P57254"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR023062"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57254"
FT                   /protein_id="BAB12874.1"
FT                   /translation="MIDLMPKKNTFLLKKKYKEDSNNSVINNLFDFFGKEFCFHQITLT
FT                   GFPIIWIDKTLLIEVGKFLYHLSQPYIMLYDLHGVDERIRLHREDLPKADFSVFYHLIS
FT                   IERNSDIMIKVPLLENDLILPTFTGLFPNANWYERETWDMFGIIFNNHPNLTRIIMPST
FT                   WKGHPLRKNYSARATEYEPFFLNEQKEDLEMEGLKFKPELWGMKRKNDNVEFMFLNLGP
FT                   NHPSAHGAFRIVLQLDGENIVDCVPDIGYHHRGAEKMAERQSWHSYIPYTDRIEYLGGC
FT                   VNELPYVLAVEKLANISVPEKAEVIRVMMSELFRINSHLLYISTFIQDVGCMTPVFFAF
FT                   TDRQKIYDLIEAITGARMHPAWFRIGGVANDLPQGWNILLKEFLDWMPKRLKYYINTAL
FT                   KNSILIHRSKGIAEYNKKEALQWGVTGAGLRATGLNFDVRKWRPYSGYQNYTFEVPVGS
FT                   GISDCYSRVMIKVEEIYQSLFILKQCLCNMPSGPFKSEDSLTTPPSKECVLQNIETMIT
FT                   HFLQVSWGPVIPENESFQMIEATKGINSYYLISDGGTMSYRTRIRTPSFPHLQQIPSVI
FT                   RGSLISDLIVYLGSIDFVMSDVDR"
FT   CDS_pept        167482..167970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /product="NADH dehydrogenase I chain E"
FT                   /EC_number="1.6.5.3"
FT                   /note="BU157"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12875"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12875"
FT                   /db_xref="GOA:P57255"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57255"
FT                   /protein_id="BAB12875.1"
FT                   /translation="MQEISIKFKLTNEEINAIENQKKYYEDFRAISIEALKIVQKKRGW
FT                   VSDQAIYAIAEILHINPSDVEGVATFYSQIFRKPVGRNIIRYCDSVVCFLTGYKRIQIA
FT                   LENYLKIKIGETTKDDRFTLLPVCCLGNCDKGPTIMINEDTYSVLTPESIPSLLESYK"
FT   CDS_pept        167967..169301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /product="NADH dehydrogenase I chain F"
FT                   /EC_number="1.6.5.3"
FT                   /note="BU158"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12876"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12876"
FT                   /db_xref="GOA:P57256"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57256"
FT                   /protein_id="BAB12876.1"
FT                   /translation="MNRILRISETHPLTWRLRDDQKTVWIKEYCDKNGYLSLKKALKEM
FT                   LPEDVINIVKESGLKGRGGAGFSTGLKWSLMSQNHSYTRERGYLICNADEMEPGTYKDR
FT                   LLIEKIPHQLIEGIILSAYALNVSRAYIFLRGEYVQAEHILKQSIQEAINFGFIGLNIL
FT                   GSNFNIELVLHTGAGRYICGEETALINSLEGRRANPRSKPPFPAVFGLWGKPTCVNNVE
FT                   TLSNVPCIILNGVSWYKNLSKSSDTGTKLMGFSGNVRNPGVWELPFGTTAREILEDYAH
FT                   GMKSGFSLKAWQPGGAGTDFLLEEHLDLPMDFKNISQAGSRLGTALSMAVDNKTSMVSL
FT                   VYNIEKFFSRESCGLCTPCRDGLPWIVKILKSLEQNKGHKNDVKNLEKLCSHLSPGKTF
FT                   CAHAPGAIEPLQSAIKYFRSEFESGINIRKRDLNKKIIGIQSNCI"
FT   CDS_pept        169395..172115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoG"
FT                   /product="NADH dehydrogenase I chain G"
FT                   /EC_number="1.6.5.3"
FT                   /note="BU159"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12877"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12877"
FT                   /db_xref="GOA:P57257"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57257"
FT                   /protein_id="BAB12877.1"
FT                   /translation="MAKIYVDSKIYNVNESDNLLQACLSVGINIPYFCWHPLLGSLGAC
FT                   RQCAVTQYDNFQDRKGRLIMSCMTPVTDGAIISIKSTESEVFRSAIVELLLTNHPHDCP
FT                   VCEEGGHCHLQDMTVMVKHSMRNYRFKKRTHKNQYLGPFIKHEMNRCIACYRCVRYYNE
FT                   YADGVDFGVYGSNNNVYFGRIEDGVLESEHSGNLIELCPTGVFTDKTHSKKYNRKWDMQ
FT                   YAPGICHNCSVGCNISIGERYGEIRRIENRYHENINHYLICDLGRFGYSHTNLNTRPKK
FT                   PTYVNKYNDLNVLNFNEAIKIGVDFFKRYKRVIGVGSARSSIENNFALQELVGKENFSN
FT                   GMSNKEKECIKSILEFLKNNYIYIPSLKEIESYDVILVLGEDLTQTSSRVALAVRQAVK
FT                   KKVQDIKNLYGIPKWNTSSNIHISEKFKNSLYIMHTHESKLDDISEWSYFASIDKQVNL
FT                   ASSIAYEIDKSSPKVSNLDSELKEKVLLISDRLISSKKTLIISGSHSFSDSIIKASINI
FT                   AKAIKFRAPDHHVGVTLLTSSVNSLGAELLGGMSIESALDDLKKEKADAVIFMEYDLYR
FT                   SVSEYDCEYFFKNKDNIITLDHQYTQTFKKSMLSLPSTNFTESSGTVINFEGRAQRFFQ
FT                   VYDPNFYDKSNCLCDSWKWLHTIKSKINNTEICWFNLDDVINSYAEKYSIFKQIKTNEL
FT                   NSNLRIHGQKISRSPIRSSGRTSLRSNIDVHEPCQPKDINTMFAFSMEGYNQPNSSVSN
FT                   IPFAWFPGWNSPQAWNKFQVEVGRNLISGDSGIHIFKKYEKKTDVYSNIVLKNSIKEKY
FT                   WNIIPYYHLFGNEELTQYSSIIQENTPLEYALIGLSDAIKMGLKKDSIVEFNCLKKDYC
FT                   LPVQVSKYLTEKQIGLPIGRKGFPLALVGEKIEFL"
FT   CDS_pept        172127..173095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoH"
FT                   /product="NADH dehydrogenase I chain H"
FT                   /EC_number="1.6.5.3"
FT                   /note="BU160"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12878"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12878"
FT                   /db_xref="GOA:P57258"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57258"
FT                   /protein_id="BAB12878.1"
FT                   /translation="MIWLEENMIKITFCFFKVIFILLLIVFSSAMLSIVERRLLAVFQN
FT                   RYGPNRVGWMGSLQLCADMIKILFKEDWIPPFSRKFIFVLSPVIAFTSLLCVIPIIPFT
FT                   SHFVIIDLNIGILFFLMMASLSVYAILFAGWSSNNKYALLGAMRACVQTLSYEVFLGLS
FT                   LMGVVAQSGSFKISDIVNSQKYIWNVFPQFFGFLTFLIAGLAVCHRHPFDQPESEQELA
FT                   DGYHIEYSGMKFGLFFIGEYISIITVSSLIVTLFFGGWLGPWIPSCIWFILKIIFFIFL
FT                   FILIRAALPRPRYDQVLLFGWKFCLPLTLFNLFLTAFLILV"
FT   CDS_pept        173120..173662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoI"
FT                   /product="NADH dehydrogenase I chain I"
FT                   /EC_number="1.6.5.3"
FT                   /note="BU161"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12879"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12879"
FT                   /db_xref="GOA:P57259"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57259"
FT                   /protein_id="BAB12879.1"
FT                   /translation="MTLKNIIIGFFTQIRSIFMIGANIFSKPETKLYPEEKVYLAPRYR
FT                   GRIILTRNIDGQERCVACNLCAVVCPVDCISLQKSEKTDGRWYPKFFRINFSRCIFCGL
FT                   CEEACPTAAIQLMPDFELSDFKRQDLVYEKKDLLISGPGKYPNYDFYNFSGVTLKGKKT
FT                   GDLEIQARPIDVKDLLP"
FT   CDS_pept        173672..174184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoJ"
FT                   /product="NADH dehydrogenase I chain J"
FT                   /EC_number="1.6.5.3"
FT                   /note="BU162"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12880"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12880"
FT                   /db_xref="GOA:P57260"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57260"
FT                   /protein_id="BAB12880.1"
FT                   /translation="MEFVFYVCSFAAVVSTFFVIIQKNAVYSLVYLIISLLSIAGVFFS
FT                   LGAFFAGSLEVIIYAGAIIVLFVFVIMMLNISDKYNLEEAHYLKPRFWIGPSILSLILL
FT                   LSMTYAIFFLRDKKIDGFLIDSKIVGINLFGPYVFLVELSSILLLSALVVIFHIGTEKN
FT                   VDKNKVL"
FT   CDS_pept        174215..174517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoK"
FT                   /product="NADH dehydrogenase I chain K"
FT                   /EC_number="1.6.5.3"
FT                   /note="BU163"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12881"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12881"
FT                   /db_xref="GOA:P57261"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57261"
FT                   /protein_id="BAB12881.1"
FT                   /translation="MISLFHGLFLSLILFILGLTSLIVRRNILFILISLEIMMNAVGLA
FT                   LIVVGSYWHQADGQIMYIFVITLAASEASIALALLLQLYRRKKTLNIDILSEMNG"
FT   CDS_pept        174514..176358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL"
FT                   /product="NADH dehydrogenase I chain L"
FT                   /EC_number="1.6.5.3"
FT                   /note="BU164"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12882"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12882"
FT                   /db_xref="GOA:P57262"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57262"
FT                   /protein_id="BAB12882.1"
FT                   /translation="MSIIFFIILFPLIGFLFLSTIQDFIFKRYTLNIGIFSIFISFFIT
FT                   CFYGVSILKNNNQVFTQILWKWLSINEFKIDFGFFLDGLSLSMLFVITGVGLLIHIFSS
FT                   WYMRYKEGQSRFFAYTNLFIASMSVLVLADNFLFMYLGWEGVSVCSYLLIGFYYTELKN
FT                   NLCAFKAFILTRVSDVFLMIGMFLIYREFNSFNFQEIKFLSSFLNVENFYYLDYITLFL
FT                   LLGVIGKSAQLPLQTWLSDAMVGPTPVSALIHAATMVTAGVYLIARTHFLFLLTPGILY
FT                   LVGLIGTLTILVSSISALVQKDIKRILAYSTMSQIGYMFLALGVKAWSAAITHLIMHAI
FT                   FKALLFLSAGSLIKSCKNEKNIFKMGGLRKQLPFLYISFIVGGASLVSFPLITAGFYSK
FT                   GNILFSVLKSGCIDFFIIGLFCSFLTAIYTFRMIFVIFHGKNIHTADSSTNLQHNIPLF
FT                   VLLLLSTVFGSYISPPLSDVFPLSYTPIDHKFAFEIICSILSLSGIYLSYYIWIKNLYV
FT                   LDKIFQFKFMRYLYYFFLKGWGFNWFYKISFVYFYLYISKRLSADPLNKIINYFLKVTQ
FT                   IFNFYLLKTSNGYVRWYVASMILGINFIFLLMLFFYFN"
FT   CDS_pept        176455..177972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM"
FT                   /product="NADH dehydrogenase I chain M"
FT                   /EC_number="1.6.5.3"
FT                   /note="BU165"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12883"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12883"
FT                   /db_xref="GOA:P57263"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57263"
FT                   /protein_id="BAB12883.1"
FT                   /translation="MLLSLLIIIPFLSSFFSFFSPRLHNNFPRWIALSGIIATLLVVIQ
FT                   IFFQENYHIFQIRHYPNWNCQLIVPWISRFGIEFNIALDGLSIIMLIFSSFLSIIAIIC
FT                   SWNEIKKNEGFFYFNFMLVFTGIIGVFISCDLFLFFCFWEIMLIPMYFLIALWSDKTEK
FT                   KKNFLAANKFFLYSQTSGLILLSSILLLVFSHYYSTNILTFNYNLLINKPINIYVEYIV
FT                   MIGFFLSFAIKMPIVPFHGWLPDIHSRSLSCGSVEIIGVLLKTAPYALLRYNLVLFPDS
FT                   TKSFSLIAVFWGIISIFYGAWIAFSQTNIKRLIAYSSVSHMGLILIGIYSNNERALQGV
FT                   VIQMLSNSLTVAALCILSGQIYKRFKTQDMSKMGGLWSCIYWIPGFSLFFSLANLGVPG
FT                   TGNFIGEFLILSGVFEVFPLVSILATIGIVFSSIYSLNVIQKIFYGPCKQNIKVFFINK
FT                   QEVWTIIALVFTLVFLGLNPQKIIDVSYNSIHNIQKEFNNSILKIRS"
FT   CDS_pept        178030..179439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN"
FT                   /product="NADH dehydrogenase I chain N"
FT                   /EC_number="1.6.5.3"
FT                   /note="BU166"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12884"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12884"
FT                   /db_xref="GOA:P57264"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57264"
FT                   /protein_id="BAB12884.1"
FT                   /translation="MLTVITVILSISYNRNHFFVAVFSILGLIFALCSLYFLIEIIPIN
FT                   VSILFHFNSNAILYIGMILISSICTCIFSYPWLLKYPFNKEEFYLLVIISTLGAISLTI
FT                   SHHMASFFINIELISLPMFGLIAYSRYQKYSLESSLKYIILSGVSSSFLLFGIAWVYSI
FT                   SGGLDFLSIHKSFNFASEKEILVVLFGISMILLSLFFKLSIVPFHLWTPDIYQGSPTSV
FT                   LSFFSTAGKISVFSVLLNFLSYFSNSDNKVIYFILSLIIILSILVGNLMALFQKDIKRF
FT                   LGYTSISQIGYLLIVLLVSHKNYSFSLEASAIYLCGYLFSNIACLGIVNLISTSHINNN
FT                   ASSINSYRGLFWSHPLLSSVLTLVLISSAGIPMTLGFIGKFYILSIVMIEHLWLIGFAF
FT                   LIGSLLGLYCYLRIILNLYLHPSKLFKRDLNIPLNWVYTPSGIVICISGIILLALGIYP
FT                   NPLIGLIKCTI"
FT   CDS_pept        180565..181800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /product="folylpolyglutamate synthase / dihydrofolate
FT                   synthase"
FT                   /EC_number="6.3.2.12"
FT                   /EC_number="6.3.2.17"
FT                   /note="BU167"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12885"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12885"
FT                   /db_xref="GOA:P57265"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57265"
FT                   /protein_id="BAB12885.1"
FT                   /translation="MINKNYSLSLWLKYLEQLDKKRIYNLTELKFLAKKLGLLKSESFI
FT                   FTVAGTNGKGTTCAVLERLLLDSGYQVGLYTSPHLINFVERVRINGFVLHEEEHIDSFQ
FT                   NVELVRNGVLLTYFEFITLAALILFKRYSLDCIILKVGLGGRLDATNIIDSDISIITNI
FT                   GIDHTSILGRDRISIAREKCGVFRKNKISVIGETDIPCSMYQIAKEKKTILKKIDIDWS
FT                   WEKKRNYWNFFHSTIQLYNLPETQVPLSSAATALSTLYYSRFKIKEKIIRKSISNVQLP
FT                   GRFQVISTFPYIIVDVAHNPNAAFYLSQKIDEINITGKIYAVVGILKDKDILGIIDPLA
FT                   NKIHHWFTAPLKTIRTATKHELKKFFPIHNTSILKSIEIAYKKALILVKKEDAIIIFGS
FT                   FLTVSEFLSLKI"
FT   misc_feature    181820..182301
FT                   /gene="cvpA"
FT                   /note="authentic frameshift at position 182063; 26 pct
FT                   identical to 140 residues of CVPA_HAEIN SW:P45108"
FT   CDS_pept        complement(182379..183317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="BU169"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12886"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12886"
FT                   /db_xref="GOA:P57266"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57266"
FT                   /protein_id="BAB12886.1"
FT                   /translation="MKLFSGNSIPKLAKFIANRLYINLGKASVGRFSDGEISVQINENV
FT                   RGSDVFIIQSTCSPTNDNIMELVVMVDSLRRASAGRITAVIPYFGYARQDRRVRSARVP
FT                   ITAKVVADFLSSIGVDRVLTVDLHAEQIQGFFDVPVDNVFGSLILLEDMLQRELKNPIV
FT                   VSPDIGGVVRARAIAKLLYDTDMAIIDKRRPRANVSQIMNIIGDVANRDCILVDDMIDT
FT                   GGTLCKAAEALKERGAKRVFAYATHPVFSGDAPKNLKNSVIDEVVVCDTIPLSENIELL
FT                   PNVRTLTLSGMLAEAIRRISNEESISAMFEH"
FT   CDS_pept        complement(183446..184330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychB"
FT                   /product="hypothetical protein"
FT                   /note="BU170"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12887"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12887"
FT                   /db_xref="GOA:P57267"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57267"
FT                   /protein_id="BAB12887.1"
FT                   /translation="MNKRNQKKMIYTCLSPAKINLFLYVTGRRKDGYHNIQTLFQFLDY
FT                   GDQFKIIANKTGNIELFTEKKIFMNVQNSIIIAAKLLKKTALLQGKLQNSSYGAKIFLK
FT                   KNIPMGSGLGGGSSNAATTLVVLNKLWNTQYTLKELSLLGLRIGADVPGFVMGNTAVIE
FT                   GIGDILYPIVQKEKWYLVVYPCINISTRYMFSSPFLMSNTAKKSLQVLLKTPFKNDFEN
FT                   IAKKQFVPIKKLIRMLSSYAPSRMTGTGSCVFSEFDNKKSAQKIFSVLPKNVQGFIAKS
FT                   VNISPLHKTLYKR"
FT   CDS_pept        184538..185623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /product="peptide chain release factor 1"
FT                   /note="BU171"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12888"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12888"
FT                   /db_xref="GOA:P57268"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57268"
FT                   /protein_id="BAB12888.1"
FT                   /translation="MNNSILNKLKSLRNRYQEIEIMLTQKNVISNRENLKTLSKEYLKL
FT                   SEIIKYFIEWEKLEVDIENVNILLNDVEIQGMAEEELYFFNKKKKALEKKINQLLLPED
FT                   PNDKHSCFIEIRSATGGDESSIFAGELFRMYLRYAESYSWKVEIMNTSESEKGGFKEII
FT                   AKITGRGACGRLKFESGGHRVQRVPETESQGRIHTSTCTVAVMPVTPKTEKEEINSSDL
FT                   KIDTFRSSGAGGQHVNTTDSAIRITHIPTGNVVECQDERSQHKNKAKALSILSARVYAA
FT                   KLEKDRQESSSMRKILLGTGERSDRNRTYNFPQNRITDHRINLSIYKLDEVLQGKLDLL
FT                   IDPIIQEYQADMLSSLSKSES"
FT   CDS_pept        185620..186453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /product="hemK protein"
FT                   /note="BU172"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12889"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12889"
FT                   /db_xref="GOA:P57269"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57269"
FT                   /protein_id="BAB12889.1"
FT                   /translation="MNIKKWIKKSIQKLSHVDNPKFESELLLSYVTKHTRSFIISSDEI
FT                   QLTEKQYKYLNHLIHRRSLGEPIAYIIKEKEFWSLSLCVSYDTLIPRPDTEILVERALS
FT                   KIKSNSACILDLGTGCGAIALALASINSNWNIIGIDKSENALAIARINASKLNFKNVTF
FT                   FFSDWFLNIKKKFNIIVSNPPYVSKKEIKFFKKDIFFEPLSALISDNNGLSDIENIIKN
FT                   SKHYLFYGGWLMIEHGWRQKVKVQYLFKKYNFHEIESYQDYGGNDRVTIGKKYDK"
FT   CDS_pept        186613..187422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychA"
FT                   /product="hypothetical protein"
FT                   /note="BU173"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12890"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12890"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032698"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57270"
FT                   /protein_id="BAB12890.1"
FT                   /translation="MNSLSNIDFSKLSLFESIIVASQAIREDFPSHSVLTELKNRIKEA
FT                   ESYISSENEPDRKLEKLLQLFYTQWNFGGASGVYKLSDTLWIDNVLKTRKGTAVSLGII
FT                   FLHIAQSLKLPLNPVVFPTQLILRADWINEKKWLINPFNGEILDQHTLEVWLKGNISPT
FT                   AELYENDLYKSESITVIRKMLDTLKAALMEEKKMELALNVTNLLIKIDPNDPYEIRDRG
FT                   LIYAQLECNHVALTDLIYFVEHCPEDPISEIIKIQIHSIEQKKTILH"
FT   CDS_pept        complement(187430..188236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /product="nh(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /note="BU174"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12891"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12891"
FT                   /db_xref="GOA:P57271"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57271"
FT                   /protein_id="BAB12891.1"
FT                   /translation="MTLQKKIIELLGVKPAIIPEIEIKNCVDFLKKYLVNHVHIKSLIV
FT                   GVSGGQDSTLTAKLCQMTAETLRKEKNDITYQFIALRLPYGIQYDEKDCQDAIRFIQPD
FT                   QIFNVNIKKAVLSSEKSLKKSGVIISDYVRGNEKARERMKVQYSIAAMKQGLVVGTGHA
FT                   AENITGFFTKYGDSGTDINPIAKLNKRQIRLLLKNLNCPKHLYLKKPMADLEDEHPQQD
FT                   DESVLGVTYDAIDSYLEQKKIDIRSQKIIEALYLNTLHKRNLPITQ"
FT   CDS_pept        188320..189537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="BU175"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12892"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12892"
FT                   /db_xref="GOA:P57272"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57272"
FT                   /protein_id="BAB12892.1"
FT                   /translation="MDKKLNNLILVLNCGSSSIKFAILNPDNKEKYLSGSVECLFLLET
FT                   YITWQCLGTKHKKKIGANVNHKDALNFIIEQVFSQQKDIFKNLIGVGHRVVHGGTKIKK
FT                   STLIDSNIIKCIQDASSFAPLHNPANLIGIKMIIEKYPSLSRKNIAVFDTSFYCNMPET
FT                   SFLYAIPYNFYKKYGIRRYGAHGISHNYVAHRASLMLNKQFKSLNIITCHLGNGSSISA
FT                   ICNGICVDTSMGLTPLEGLVMGTRSGDLDPSIIFFMNNHLNLSIDKIETILNKKSGLLG
FT                   LSGISSDFRYFEKKYYCKKHAKRSVDIFCHRLSKYIAAYTSVLENRLDAVIFTGGIGEN
FT                   VPLIRELVFSRLSLLGFKINSNLNLSTIGGKSGLITEDNSTPVFVITTDEELAIAQETN
FT                   SIINRK"
FT   CDS_pept        189582..191708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /note="BU176"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12893"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12893"
FT                   /db_xref="GOA:P57273"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57273"
FT                   /protein_id="BAB12893.1"
FT                   /translation="MSRIIMLIPLDKDIGLTSIGLSIIYFFYQKKIKKKSVQSILYFSC
FT                   TQNSSNSTSHVINKYFSKIVHTVDYIDFSKVLFNSPEYSFLLNKVIDEHYNNKFLRELI
FT                   LIEGIKNNYCINSEEMNYDISQNLNAEVIFIANLENSSPEYIKNKEKKINFFLKQKKYK
FT                   NILGVIFNQINSPFLENKYDFIKKLIVLKKIKNETKTIVPKKILKNNFFSIIACIPWNR
FT                   NIVTTRVIDLFNFLNIQHTNLVQKKNHIIEEIIIFDTHHLNLLNKHSLNTLVIVSFSRV
FT                   DVFLNVLNCNVNRSKVKCIILTGILKLKKNIASLYKFLIKRSISIFFTEKNTIEILSQL
FT                   QNFNFDISVKDITYIKKLQRYISNFFCHSSFMFFKKKYNINVIYPPKEFCYNLKLLSQK
FT                   KNKRIKLPESYEIRILKSVAICSDSNIAQCVLLGDPKKIYSIANDNGINLKKNIEIIDP
FT                   ISVRQEYLARFLEIRKGKNINEFSAKKQLEDNTVLATLILESNHVDGLVSGSINTTSDT
FT                   IRPALQIIKTNPQSLLVSSIFFMLLPNQVLIYGDCAININPTAEELAVIAIQSADSAKM
FT                   FGIEPRIAMLSYSTGCSGFGCQVEKVKEATSIIKNRRSDLIIDGPIQYDAAVSNKVAKL
FT                   KAPSSPISGSANVFIFPDLNSGNIAYKAVQRSSRIVSIGPMLQGLRKPVNDLSRGASVE
FT                   DIIYTIALTSIQSE"
FT   CDS_pept        complement(191740..192003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfaE"
FT                   /product="hypothetical protein"
FT                   /note="BU177"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12894"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12894"
FT                   /db_xref="GOA:P57274"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57274"
FT                   /protein_id="BAB12894.1"
FT                   /translation="MQSSIIEITNIKKKIVYQTQITLLLVLELNNIHLEYQCRSGYCGI
FT                   CRIELIKGEVFYLIKQPMAALFKEREIFPCCCKPKGNITIKI"
FT   CDS_pept        complement(192006..193136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /product="ribonucleoside-diphosphate reductase 1 beta
FT                   chain"
FT                   /EC_number="1.17.4.1"
FT                   /note="BU178"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12895"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12895"
FT                   /db_xref="GOA:P57275"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57275"
FT                   /protein_id="BAB12895.1"
FT                   /translation="MSYTIFSKKKNNQLKEPMFFGQPVNIARYDQQKYKIFEQLIEKQL
FT                   SFFWRPEEIDLSRDRIDFQNLPDNEKHIFISNLKYQTLLDSIQGRSPNIAFLPIISIPE
FT                   LETWIETWSFSETIHSRSYTHIIRNIVNCPSLVFDDIISNKNIYDRAQNISIYYDELIN
FT                   LTSYWHLLGEGIHLINGKKIHINLRFLKKRLYLCLISVNVLEAIRFYVSFACSFAFAER
FT                   ELMEGNAKIIRLIARDEALHLTGTQHILNLLSNIKNNENMEDVVLECKEEAINIFISAA
FT                   QQEKKWASYLFKSGSMLGLNKDILCQYIEYITNIRMHAIGFKMPFKKQSNPIPWINDWL
FT                   TSDNIQIAPQETEISSYLVGQIDSEVSDNEFKKFEL"
FT   CDS_pept        complement(193204..195489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /product="ribonucleoside-diphosphate reductase 1 alpha
FT                   chain"
FT                   /EC_number="1.17.4.1"
FT                   /note="BU179"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12896"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12896"
FT                   /db_xref="GOA:P57276"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57276"
FT                   /protein_id="BAB12896.1"
FT                   /translation="MKKNLFVTKRDGRKEKINLDKIHKVLNWASEGLDDVSVSQVELCS
FT                   RIQFYNNITTINIHETIIKAAADLISQDTPDYQYMAARLAIFHLRKKAYGQFEPPKLYD
FT                   HVKKMVDLEKYDENLLKNYSYKEFLQMNSFIDHWRDMNFSYAAVKQLEGKYLIQNRVNG
FT                   KIYESAQFLYILISACLFSQYPKNVRMNYIHRFYNAISTFKISLPTPIMSGVRTPTRQF
FT                   SSCVLIECGDSLNSINATTSSIVKYVSQRAGIGVNAGQIRALGSPIRNGEAFHTGCIPF
FT                   YKHFQSAVKSCSQGGVRGGAATIFYPIWHLEVESLLVLKNNRGIEENRVRHIDYAIQIN
FT                   KLMYQRMLSGDQITLFSPSDVPDLYKAFFSDQKKFKKIYLQYEKNKNIRKKTIKALDLF
FT                   SLMMQERTSTGRIYVQNVDHCNLHSAFNPELSPIRQSNLCLEITLPTKSLNDVHDTDGE
FT                   IALCTLSAFNLGKIKSLDDFKELSILSVRALDEILDYQNYPVLAAKKSAISRRSLGIGV
FT                   INFAYYLAKNKVRYSDGSAHNLTHKTFEAMQYYLLEASCELAKEKGACSLFNHTNYYLG
FT                   KLPIDTYKKYIDDICNEPLHLDWNLLRSKIKKYGLRNSTLSALMPSETSSQISNATNGI
FT                   EPPRGFISIKVSKDGILRQVVPEYKKLRLQYELLWDIPNNTGYLQLAGIMQKFIDQSIS
FT                   VNTHYDPARFLNNKIPMKQLLYDLLLSYKLGLKTLYYQNTRDGSEDDQNITSKSITEDI
FT                   CESGSCIL"
FT   CDS_pept        complement(195562..198054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="BU180"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12897"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12897"
FT                   /db_xref="GOA:P57277"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57277"
FT                   /protein_id="BAB12897.1"
FT                   /translation="MKDPSREIIQVNIEEELKSSYLDYSMSVIVGRALPDVRDGLKPVH
FT                   RRILFAMYILNNDWNKAYKKSARIVGDVIGKYHPHGDSAVYDAIVRMAQKFSLRYMLID
FT                   GQGNFGSVDGDSAAAMRYTEVRMSKIAHELLNDLEKNTVEFLPNYDGTEYIPEILPAKI
FT                   PNLLINGSSGIAVGMATNIPPHNLNEVINGCLAYIDNNDITLEELIKHIPGPDFPTAAI
FT                   INGKSGIEEAYRTGKGKIYIRAQNQIEKNKKNKKESIVFNEIPYQVNKSRLIEKIAELV
FT                   KEKRIDGITALRDESDKDGMRIVIEIKREAIAEVILNQLYSLTQLQISFGINMVALCQG
FT                   QPKTLSLKEILKNFLSHRQEIIIRRSLFELNKVRNRIHILEGLNMALININAIIEIIKN
FT                   SVNSIDAKKIIIQKNWKSEKINYLAKKHEYYFSEKQAQAILDLRLHKITNLEQEKIIME
FT                   HNDLIKKTKELKEILENPKKMFEVIKSELLSIQNNFSDKRRTKITENHSDINMEDLINQ
FT                   EDVVVTLSHSGYVKYQPLSDYNAQRRGGKGKSAAKIKEEDFIESLVIANTHDTILCFSS
FT                   RGILYWMKVYQLPESSRHARGRPIVNLLPLSPKERITAILPVHKYQDNLNIFMTTAHGI
FT                   VKKSSLSQFKKPRFAGIIAINLHANDELIGVALTDGNNNIMLFTQNGKVVQFLENSVRT
FT                   MGRTASGVKGIKIKKNDKVVSLIVPKNKGSILIATKNGYGKRTKISDFPIKSRATQGVI
FT                   SIKITKKNGKIIGAIQVIEKDQIMMITDAGTLVRIRVSEVGVLKRNTQGVILIRTSKNE
FT                   KVVALQKIVDPMIEKIDL"
FT   CDS_pept        198321..199037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yba2"
FT                   /product="hypothetical protein"
FT                   /note="BU181"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12898"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12898"
FT                   /db_xref="InterPro:IPR018648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57278"
FT                   /protein_id="BAB12898.1"
FT                   /translation="MTDEEKNLIENLFHRLKKTELNSPERDDAADELIQRLAKKQPTSS
FT                   YYMAQTILIQETAIKKMSIELEELRKKIKILNREETNKKPSFLSNFFKKKSPSEIISND
FT                   NNILKKKENILPSNYSSSPISPTTQTSPVINNTRSSSFLGNALQTATGVAGGMILGNML
FT                   MNVFSHTKPEEDIFDTVKQSSSDEYTENNFLNNNTDNDLINYSYNESDINFRESSEESI
FT                   NNNVDDTDDIDNDNFI"
FT   CDS_pept        complement(199160..199753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /product="alkyl hydroperoxide reductase"
FT                   /note="BU182"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12899"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12899"
FT                   /db_xref="GOA:P57279"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57279"
FT                   /protein_id="BAB12899.1"
FT                   /translation="MVLVTQNAPNFIAPAILKNNQIVEQFDLKKYSNGQSTVLFFWPMD
FT                   FTFVCPSEIIEFNKLHSEFKKRNVKIVGVSIDSVYVHQAWQNTLPKNGGIGKINFPMVS
FT                   DVKHDIQKSYGIQHPNLGIALRASFLIDSNWIIRHQVVNDLPFGRNITDMIRMVDALDF
FT                   HNKFGEVCPANWKKGEEGITASSEGVSQYLSKYS"
FT   CDS_pept        199831..200493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /product="uracil-DNA glycosylase"
FT                   /note="BU183"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12900"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12900"
FT                   /db_xref="GOA:P57280"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57280"
FT                   /protein_id="BAB12900.1"
FT                   /translation="MILSWKDVLSQEKKKKYFINIIRFLKKERLKKIIYPDQKDIFNAF
FT                   FLTSFNDIKVVILGQDPYFSKNQAHGLSFSVPKHVTIPPSLKNIYKELNTDFKKEHIFH
FT                   HGCLESWANQGVFLLNSILTVESGKPKSHSNIGWNIFTDKVISVINLYKNSVVFLFWGS
FT                   NAQKKSHLINRKNHYILKAAHPSPLSAYRGFFGCKHFSLTNKILLKTKKKPINWFLI"
FT   CDS_pept        complement(200569..201135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /product="heat shock protein grpE 2"
FT                   /note="BU184"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12901"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12901"
FT                   /db_xref="GOA:P57281"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57281"
FT                   /protein_id="BAB12901.1"
FT                   /translation="MDNKENKLDEKKIFKNNKIEEKKENLIDAITVQNQKIENLKLKLL
FT                   QNQKKINDIELRKLANIENIKKNTEEKIEKIKKTEIERFLKSIIPVIDSLEDILNLSTT
FT                   VDIKDQPIIKGIELTLESLLNILNKLGVKIEGQKNKVFNPDIHELVSRELSKETLPNHV
FT                   ISVNKKGFTFNKIVLRKASVIVAEN"
FT   CDS_pept        201252..202130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjB"
FT                   /product="hypothetical protein"
FT                   /note="BU185"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12902"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12902"
FT                   /db_xref="GOA:P57282"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57282"
FT                   /protein_id="BAB12902.1"
FT                   /translation="MKQHFTCIGIVGRPRHDSALITHKTLYEWLIKNGYKVFIEHTVAR
FT                   ELKLNNPNTATLIEIGEFCDLAVVIGGDGNLLCAARVLSFYNIKIIGINRGNLGFLADL
FT                   NPDTGLKKLSEVLSGNYSLENRFLLDAQVCQKKIISRSSIAINEVVLHTKNLAHMIEFE
FT                   VYIDNKFSFSQRADGLIVSTPTGSTGYSLSAGGPIIAASLDAIVLVPMFPHTLSARPLV
FT                   IHSDSIICLKFSNIQTNLKISCDSQIILTIKKGECVFIRRSCYYLNLIHPKSYNYFKTL
FT                   TSKLSWSKKFF"
FT   CDS_pept        202263..202571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpA"
FT                   /product="small protein A"
FT                   /note="BU186"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12903"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12903"
FT                   /db_xref="GOA:P57283"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57283"
FT                   /protein_id="BAB12903.1"
FT                   /translation="MNNYIKALLIIICFSSCSISDKNKYNLDVLEATHLNKNILNRNYV
FT                   GMTRQQIVYIFGIPIISDSFDDIYHYYLSDSKNNNVYPKKMLNLYFKDNKVFKFNMT"
FT   CDS_pept        203108..203434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydhD"
FT                   /product="hypothetical protein"
FT                   /note="BU187"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12904"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12904"
FT                   /db_xref="GOA:P57284"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57284"
FT                   /protein_id="BAB12904.1"
FT                   /translation="MSIFQKIKKQIQDNIILIYMKGTPEAPSCGFSAQAVQALSFCGEK
FT                   FAYVNILENPDIRSELPKYANWPTFPQLWIDGELIGGCSIILEMLENGELKKLILKVKK
FT                   KYQT"
FT   CDS_pept        complement(203578..204243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnt"
FT                   /product="ribonuclease T"
FT                   /note="BU188"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12905"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12905"
FT                   /db_xref="GOA:P57285"
FT                   /db_xref="InterPro:IPR005987"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57285"
FT                   /protein_id="BAB12905.1"
FT                   /translation="MSTNQEFNLLSNRFRTFYPVVIDIETAGFNANTDAVLEIAIITLK
FT                   MDELGWLHKEDTLHFHIEPFKGSIINSDAIAFNKIDPFNPLRGAISEKIAIQSILKKVR
FT                   NGIKIQGCSRGIVVAHNANFDHNFLMAAIQRVKIKNNPFHPFATFDTAALSGLVVGQTV
FT                   LSKACKAIGLSFDNHQAHSALYDTLQTANLFCELVNRWKRLGGWPVDIKKNNSTSNKY"
FT   CDS_pept        204463..205074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /product="superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="BU189"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12906"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12906"
FT                   /db_xref="GOA:P57286"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57286"
FT                   /protein_id="BAB12906.1"
FT                   /translation="MSYVLPSLPYSYNALEPFFDEETMKIHHTKHHQNYINNTNSILEN
FT                   TTFSSLPIEELISILNEIILEKKNALRNNAGGHINHSFFWKSLKSGTVLTNDLKIEIEK
FT                   QFGTIDEFKEKFESVALNHFGSGWVWLVNQNGVLSIVSTVNQDSPLMGKLISNTYGYPI
FT                   IGLDIWEHAYYLKYQNRRLDYIKSFWNVVNWEEASNRLQK"
FT   CDS_pept        205262..205795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="BU190"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12907"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12907"
FT                   /db_xref="GOA:P57287"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57287"
FT                   /protein_id="BAB12907.1"
FT                   /translation="MIVGLSNPKKEYHSTRHNVGSWYLYSLAESYLRNFKNEKKFFGFT
FT                   TSLNIESNYIRLLIPNIFMNINGQSVFKMASFYNINLSEILIVHDDLELQPGISKLKYS
FT                   YGHNGHNGLRDIVNTFNKNINFYRFRIGIGRPINRDQIASFVLSNPTKKEKILIQKSIL
FT                   HAIEKNVLSNILKF"
FT   CDS_pept        205836..206924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychF"
FT                   /product="GTP-binding protein"
FT                   /note="BU191"
FT                   /note="putative product"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12908"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12908"
FT                   /db_xref="GOA:P57288"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57288"
FT                   /protein_id="BAB12908.1"
FT                   /translation="MGFKCGIIGLPNVGKSTLFNLLTKGNSAVANFPFCTIKPNIGIVP
FT                   VIDERINNLNQIVSPQKTVNAFIEFIDIAGLVKGASQGEGLGNQFLGNIRDVHAIAHVV
FT                   RCFKDDNITHIYNQVQPIKDIDIINSELILSDFDLCEKTILKLQKKTLLKNKETQEKIN
FT                   TLKKCLNHLKQFFMLKTLNLNKTEKQLISYLRFLTLKPTMYIANINEEKESYYFLDKLN
FT                   EIAKKEGSIVIPIHANLELDLVKMSDEEKKSFMKLFNIKTLGLNSIISSGYHLLNLITF
FT                   FTVGDKEIRAWAIPNGSTSIEAAHKIHSDFSKGFIRAQIIKYVDFITYKSEAKIKEMGK
FT                   FRTEGKQYYIQDGDIIHFLFNV"
FT   CDS_pept        complement(207000..208289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="BU192"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12909"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12909"
FT                   /db_xref="GOA:P57289"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57289"
FT                   /protein_id="BAB12909.1"
FT                   /translation="MKLYNLKNHNEQVNFEAAVKLGLGQQQGLFFPVELPTITPIELSK
FT                   ILKMDFITRSTEILSKFICHEISKEELYKHVKQAFSFKHPLKIKITKDIHCFELFHGPT
FT                   LAFKDFGARFMAQMILLLNKKNESVTILTATSGDTGAAVANAFYGMKNVRVIILYPKGK
FT                   ISELQEKLFCTLGRNIKTISINGSFDDCQKLVKEAFNDKKLKESIGLNSANSINISRLL
FT                   AQICYYFEAFSLISEEQRKNLVIAVPCGNFGNLTAGLLSKSLGLPIKSFIACTNANDTV
FT                   PRFLNNGTWNPKKTVSTISNAMDISQPNNWTRIEELFYRKKWDLKKLRFGSVSDHTTEE
FT                   TLKELFKLGYVSEPHAAIAYRLLRDQLKENEFGLFLGTAHPAKFKNTVEKILKNKISLP
FT                   SELQNRIDLPLLSHNINPVFSKLKTFLLEK"
FT   CDS_pept        complement(208296..209225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="BU193"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12910"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12910"
FT                   /db_xref="GOA:O66132"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66132"
FT                   /protein_id="BAB12910.1"
FT                   /translation="MIKIYAPASIGNVGVGFDILGAAIIPVNGSLLGDFVTVKLSNKFN
FT                   LVNKGIFSNKLPKNTEQNIVWKCWLKFCNTIKRNIPVSIILEKNMPIGSGLGSSACSIV
FT                   ATLVAMNEFCDKPLNSKELLLLMGEVEGEISGSIHYDNVAPCYLGGLQLILEDSKIISQ
FT                   TIPNFKNWFWIVAWPGTKVPTAEARDILPKKYKKETCIKNSRYLAGFIHASYSQQPHLA
FT                   ARLMQDFIAEPYRIKLLPNYLYVKEKIKKIGAISSGISGSGPTIFSISDNINTAQKISA
FT                   WLTENYLQNTTGFVHICFLDSKGVRKIG"
FT   CDS_pept        complement(209246..211696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /product="aspartokinase I / homoserine dehydrogenase I"
FT                   /EC_number="1.1.1.3"
FT                   /EC_number="2.7.2.4"
FT                   /note="BU194"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12911"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12911"
FT                   /db_xref="GOA:P57290"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57290"
FT                   /protein_id="BAB12911.1"
FT                   /translation="MKLLKFGGTSLANAEKFLSVSSIIEENTQTDQIAVVLSAPAKITN
FT                   YLVKIIENTIKNNQILETVHLAENIFMQLINNFLNIQSNFPHKEIEKIIKKEFNELKNI
FT                   IQGILLLKQCPDNIRAIIISRGEILSVFIMKSILQSKNYNVTIINPVKNLVAIGDNYLD
FT                   STVDISESKKNIQNMNINQSNIILMAGFIAGNKDKKLVVLGRNGSDYSAAVLAACLDAN
FT                   CCEIWTDVDGVFTSDPRKVPNARLLKSISYQEAMELSYFGAKVLHPRTIEPIAQFKIPC
FT                   LIKNTNNVKSIGTLICEQNCSEKDFLKGVTHLDEIAMFNISGPHIKDVGSVISRIFTMM
FT                   SRGNIKILLITQSSSENKINFCVYEHDIYKILYLFNKEFQLELKDGLLNPFKIKKNLSI
FT                   LSIVGSNIYKKHNIASKIFSVLGALKINVIAISQGSSKHSISLVIKKENILKAVQHVHN
FT                   TLFFNKKTIHMFLIGIGGIGSTLLNQILKQKQFLDKKNIEIKICAIANSKKILLLDNTN
FT                   DLSNWKNDFKKSTQKFNLELLNNLIKNNHFSNSVIVDCTSSQLLSEQYVNFIDNNFHVV
FT                   TSNKKANTSEWNYYKKIRKSVAQTGKKFLYETNVGAGLPVIETLQNLFKSGDNLICFKG
FT                   ILSGSLSFIFGRLEEGILLSQATREAKELGFTEPNPCDDLSGIDVARKLLILARESGYN
FT                   IELKDIKIEPLLPNNFKIYEDTDKFLLKLKELDVYFSNKIKQALNVGNVLRFVATIEQK
FT                   RQFFIKLEEVNINNPLYKVKNGENALAFYTNYYQPIPLVLRGYGAGNNVTASGVFSDLL
FT                   RTLS"
FT   CDS_pept        212355..212855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="BU195"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12912"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12912"
FT                   /db_xref="GOA:P57291"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57291"
FT                   /protein_id="BAB12912.1"
FT                   /translation="MKHTLQVIITEKELDIRVRELGQEITKKYRNSRNKMILIALLRGS
FT                   FIFISDLCRRIHIEHEIDFMTTSSYGRGMLSSGDVKIIKDLDEDIYNKNVLIVEDIIDS
FT                   GKTLSKVLDILKLRNPKSLSICTLLDKPECREVNINVDFIGFSILENFFIVGYGIDYAQ
FT                   SYR"
FT   CDS_pept        complement(212899..213756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /product="pantoate-beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="BU196"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12913"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12913"
FT                   /db_xref="GOA:P57292"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57292"
FT                   /protein_id="BAB12913.1"
FT                   /translation="MHIIKTIKVLYKEIKILKKSNKKIGLVPTMGNLHDGHIKLILLAK
FT                   KYSDIIIVSIFINPMQFDNLSDLKNYPKTFMKDSIILKKYHVDILFFPHINEIYPNGIE
FT                   HQTFVEVIKLSKILEGQSRPGHFRGVTTIITKLFNFIQPDFAFFGEKDYQQLLIIKILV
FT                   KELNYMIKIISLPTIRLKNGLALSSRNNYLSSQENEIAPYLYKIIKKTCEKIIKEDDNI
FT                   RPKIIHESKILLIKKGFSVDIFDIYDYKNLEHPSKKVKKVILLASVWLGNTRLIDNKKI
FT                   ILNY"
FT   CDS_pept        complement(213771..214562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="BU197"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12914"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12914"
FT                   /db_xref="GOA:P57293"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57293"
FT                   /protein_id="BAB12914.1"
FT                   /translation="MESITISQLKNWKINKKKFAAITAYDFSFSRLFSNCGIPVILIGD
FT                   SLGMTIQGHTSTLPVKIEDIAYHTKAVRKGAPNTFLISDLPFMSYYDTKQALKNTAKII
FT                   RSGANMIKMEGGKWLIEIIRELSNRLILICGHIGLIPQSFHYLGGYKVQGRKENDANKL
FT                   IDEALLLEESGINMLILECIPEKLAKKITESLSIPVIGIGSGKNTDGQILVMHDLLGIT
FT                   EGKTPSFTKNFLSESDSIQKAIQKYIYEVEHSIYPSKKHSF"
FT   CDS_pept        complement(214678..215133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /product="dnaK suppressor protein"
FT                   /note="BU198"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12915"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12915"
FT                   /db_xref="GOA:P57294"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57294"
FT                   /protein_id="BAB12915.1"
FT                   /translation="MEKEKNKKTSSLNVLSIAGLQPYQKKIDEEYMNKDQILHFYKILE
FT                   TWKTQLQDEINHTLLYIQDNATNFPDPIDRATQEEEFSLDLRNRDRSRKLIKKIEITLK
FT                   KIKEKDFGYCNSCSVEIGIRRLEARPTADLCIDCKTLAEIREKQMTG"
FT   CDS_pept        215390..216190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /product="pseudouridylate synthase I"
FT                   /EC_number="4.2.1.70"
FT                   /note="BU199"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12916"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12916"
FT                   /db_xref="GOA:P57295"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57295"
FT                   /protein_id="BAB12916.1"
FT                   /translation="MVAKNVKTFALGVEYDGSYYHGWQRQKILPSIQEEIEKALSIIAN
FT                   HKIDVVCAGRTDAGVHSIGQVIHFKTTANRKKSSWSIGVNSYLSENISVVWVKEVTENF
FT                   HARYSAITRSYRYIIYNYSLRSAIFQTKLNHIYRKLNVDKMNFEAQFLLGEHDFTSFRA
FT                   LGCQSHSPWRNITKLNVFRFHNWVVVDITANSFLHHMVRNIVGSLIEVGISKKKEYWIK
FT                   DLLEKKDRSHAGATAPAKGLYLVYVEYPLHFNLPRSAYTSIFFK"
FT   CDS_pept        216262..218544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /product="penicillin-binding protein 1b"
FT                   /note="BU200"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12917"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12917"
FT                   /db_xref="GOA:P57296"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57296"
FT                   /protein_id="BAB12917.1"
FT                   /translation="MFFNFKKYFLIKVFFFVLILTLCYGLYLYVKINRFINGKVWNFPT
FT                   SIYGRIVNLEPGNSYSQKEVLHLLKSTMYRKVDLVMLPGEYSIKNNTIEFIRRAFDFPD
FT                   IREDEFHARLYFNKDTLVKIKNIDNNHDFSFFRLEPKLIAMLKSPEAKKRMFIPRNQYP
FT                   EMLVKTLLAIEDKYFYEHDGIHLSSIGRAFLVNLMAGRTIQGGSTLTQQLIKNLFLTNT
FT                   RSILRKINEIYMALILDRFYTKDRILELYLNEVYLGQDGDEQIRGFPLASIYYFGRPIN
FT                   ELNLEQYALLVGMVKGASLYSPWTNPNLALKRRNLVLFLLYKQKYITRKIYKDLCKRSL
FT                   NVQPKGNIISSHPSFIQLVCEEFHKKIYNPIKNFPGTKIFTTLDYTSQNAVEQAVKIEI
FT                   PILKRKKRLKDLEVAMIVIDRFTGEVQALIGSSKPEFNGYNRALKTRRSIGSLSKPITY
FT                   LTALSQPEKYHLNTWISNYPLSIKLDSGQYWTPKNNNFSFSKKVLLLDALIHSINIPTV
FT                   NLSINIGLKKLVDSWLLLGISKKYITPLPSISLGAINLTPFEIAQVFQIIGSGGYKSSL
FT                   SSVRSIISDDGKVLYQNLPQSIHIESSEASYLTLYGMQQVVKSGTAKSLGTIFKEFSLA
FT                   GKTGTTNNLVDNWFVGIDGKQIVITWIGRDNNHTTRLYSSSGAMQIYKRYLQYQRPVPL
FT                   VLKAPNNINMFYINNLGELFCKKNNQHNRMLPIWSIKNKKICNDKLSERFSIKKKKNFL
FT                   FWLKNLF"
FT   CDS_pept        218774..221401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /product="preprotein translocase secA subunit"
FT                   /note="BU201"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12918"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12918"
FT                   /db_xref="GOA:P57297"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57297"
FT                   /protein_id="BAB12918.1"
FT                   /translation="MLIQFLTKIFSNHNNRILKKFKKIVLSVNKLEKNFEKLSDKELQA
FT                   QTELFRLRLRNGETLDDILPEAFALVREASKRVFSMRHFDVQILGGIALNKQCIAEMRT
FT                   GEGKTLTSTLPAYLNALNGKGVHIVTMNDYLARRDAEKNTPLFEFLGLTVGLNLSEMSF
FT                   FSKRKAYLSDITYGTNNEYGFDYLRDNMVFSPEERVQRKLNYALVDEVDSILIDEARTP
FT                   LIISGPSEDSSELYKEINKIVPFLNSQKKEDSDIFCGTGDFSIDEKSKQIYLTERGLIK
FT                   VEKILFDKKLMNTGESLYSSNNIILMHHVLSALRAHKLFVRNVDYLVKDNSVIIVDEHT
FT                   GRTMPGRRWSDGLHQAIEAKENVSIKNENQTLASITFQNYFRLYEKIAGMTGTAETESF
FT                   EFNSIYNLDTIVIPTNRKMIRKDFPDLVYMTEKEKINAIIQDIQKCIKLNQPVLVGTVS
FT                   IEKSEIISKELLKLNINHNVLNAKFHAKEAEIIAQAGKPGSITIATNMAGRGTDIVLGG
FT                   NLEVELNKYKNITSRKIEEIKKKWQSEHDLVVSAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDTGSSRFYLSMEDSLMRIFASDKIVHMMKKLGLAFNEAIEHSWVTKAIENAQKKVE
FT                   NRNFDIRKQLLEYDDVINEQRSAIYSQRNKLIDARDIKLMIYDIFKDVLKKNIILYIPK
FT                   NTFHDKWNITDLKDKLNIDFYLNAPILDWINIEPNLTDKKIIKRIIDFARINYKNKEIL
FT                   IGSNNMRIIEKIIMLQTLDSLWKEHLAAVDYLRQGIHLRGYAQKDPKQEYKRESFNMFS
FT                   SMLELLKFEVVSFLSRINSSYAKKYIDLNKHLVITHNNTMKISRNSPCLCGSGKKYKYC
FT                   HGSL"
FT   CDS_pept        221477..221851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /product="mutator mutT protein"
FT                   /note="BU202"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12919"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12919"
FT                   /db_xref="GOA:P57298"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57298"
FT                   /protein_id="BAB12919.1"
FT                   /translation="MELLSKKKVYITRGKYKKNIWEFPGGKVKKHENIVHALKRELLEE
FT                   VGIIVLKINFFQYIEYIYPEKKIKLYFFLKKKWKGRPYSIEGYTYLWKRLCHLRALDFP
FT                   LANHSVINALKKNNILIKFR"
FT   CDS_pept        complement(221834..222487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacE"
FT                   /product="hypothetical protein"
FT                   /note="BU203"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12920"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12920"
FT                   /db_xref="GOA:P57299"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57299"
FT                   /protein_id="BAB12920.1"
FT                   /translation="MTYIVALTGGISSGKTTISNGFKKIGINVIDTDIIAKNIIEKNLQ
FT                   VSFSIKRKFGKKILNIDNSINRLLLRQYVFNNHHHRLWLENLLHPKIYQESKHQIKMTQ
FT                   SNWCLWVVPLLVEKKLEKKAHRILLIDTPVKEQIKRTVRRDKISFLEAKKIIALQSSRK
FT                   TRISLSDDIIFNKKNFKKINLYIYYFNLLYSHLSRIYNKNKTINIKKNFLTKFY"
FT   CDS_pept        222543..223592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /product="GMP reductase"
FT                   /EC_number="1.7.1.7"
FT                   /note="BU204"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12921"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12921"
FT                   /db_xref="GOA:P57300"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57300"
FT                   /protein_id="BAB12921.1"
FT                   /translation="MRIEEDIKLGFKDVLIRPKRSILKSRSQVNLARCFSFKYSASIWS
FT                   GIPIIAANMDTIGTFEMVKSLSKFNILTAVHKYYSFEEWKNFVCLSSKEILNHVIVSIG
FT                   TSNIDFLKIKKIFLLSSELKYICIDVANGYSEHIVSFLKLVRDYFPDKIICAGNVVTGE
FT                   MVEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAIIECADAAHGLNGQIISDGGC
FT                   TVSGDIAKAFGGGADFVMLGGMLSGHKECSGDIIEEKSKKYMIFYGMSSVSAMQRYEGK
FT                   IAGYRASEGKTVKIPFRGGVDSTIRDILGGLRSSCTYVGAEKLKELTKRTTFIRVTEQE
FT                   NCIFNAFKE"
FT   CDS_pept        223819..226482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /product="pyruvate dehydrogenase e1 component"
FT                   /EC_number="1.2.4.1"
FT                   /note="BU205"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12922"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12922"
FT                   /db_xref="GOA:P57301"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57301"
FT                   /protein_id="BAB12922.1"
FT                   /translation="MSENLYNDVDPIETRDWVQAIESVIRREGHKRAHFLIEQVLKTAK
FT                   INRKEFFRSSFTSDYINTISREDEYEYPGNLILEKRIRSAIRWNAIMMVLRASKKNLEL
FT                   GGHLSSFQSSATIYEVCFNHFFQAKNHKDGGDLVYFQGHISPGIYARSFLEGRLSEEQI
FT                   DNFRQEVDGIGLSSYPHPKLMPNFWQFPTVSMGLGPLCAIYQAKFLKYLHNRELKNTSK
FT                   QIVYAFLGDGEMDEPESKGAISIAVREKLDNLIFIINCNLQRLDGPVVGNGKIVNELES
FT                   FFYGAGWKVIKVIWGSRWDCLLKKDTSGKLIQLMNETVDGDYQTFKSKDGAYVRKYFFG
FT                   KYKETYDLVKDMTDEEIWKLNRGGHDPKKMFNALKKAKETKYKPTVILAHTVKGYGMGV
FT                   IAEGKNIAHQIKKININGIIHIRDRFNIPVSNDEINKLPYVTFKKNSEEYCYIHSQRKK
FT                   LGGYIPFRLSSFTGKLILPKLIDFQSLLEEQKKDISTTVAFIRVLNIILKNNSIKHLIV
FT                   PIIADEARTFGMEGLFRKIGIYSSSGQKYTPQDREQLAYYKEEKKGQILQEGINELGAA
FT                   SSWLAAATSYSTNDFPMILFYIYYSIFGFQRIGDLFWAAGDQQARGFLIGGTSGRTTLN
FT                   GEGLQHEDGHSHIQSLTIPNCISYDPAFAYEVAVIIQDGLRRMYGPSQENIYYYITTIN
FT                   ENYYMPAMPIGVEEGICKGIYKLKTLHGTTSKVQLIGSGAILRSVCEAAEILLKDYSIT
FT                   TDIYSVTSFTELARNGEDCERWNMLHPNEKNKIAYVKQIMNKNPTVAATDYMKLFAEQI
FT                   RHYIPSQEYHVLGTDGFGRSDSRDKLRDHFEVNAYYIVIAALNLLANINDIKKKVVEDA
FT                   IMKFNIDANKINPRLS"
FT   CDS_pept        226513..227703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /product="dihydrolipoamide acetyltransferase"
FT                   /EC_number="2.3.1.12"
FT                   /note="BU206"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12923"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12923"
FT                   /db_xref="GOA:P57302"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57302"
FT                   /protein_id="BAB12923.1"
FT                   /translation="MPDIGLEEVEIIEILVSINEKIAPEQGLITVEGDKTSMEIPSPIS
FT                   GIVKHIFIKIGEKIKTDALIMRCEVENIDFHVKKKEEICLDNNVLNKVEKNFKKDIFFH
FT                   ATPLIRRLARNLNINLYDVVGTGPKNRILKEDLDLYQSNIKENLIEEKNKINFGDSKKS
FT                   KTKELELSDIQKNIGNNLHRNWMNIPHVTQFDEVDITILEKFRQKYNNEKRNQKKTNEN
FT                   ITILVFIIKVVAYALEKFPIFNSSLNINNKKIILKKYINIGFAIDVNNDLFVPVLKDVN
FT                   KKNIKQLSSELILLSEKARTRKLNIEDMTGGCFTISNLGGIGGSWFSPIINSPEVAILG
FT                   ISKSQIKPSWNGKEFIPSLMLPLSLSYDHRVINGAYAARFITFISRVLSDMHFLIM"
FT   CDS_pept        227748..229169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="BU207"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12924"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12924"
FT                   /db_xref="GOA:P57303"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57303"
FT                   /protein_id="BAB12924.1"
FT                   /translation="MNKKIYTQVVVIGSGPAGYSAAFRCADLGLDTVLIERYDKLGGVC
FT                   LNVGCIPSKTLLHIAKVIKEAKELHKTGVSFNKPDIDIKKIKNWKQHIVNKLTDGLSSM
FT                   RKKRKIRIFQGHAIFETDKSLCVTNTEDKFTIFFDNAIIATGSKPIKIPSIPHDDIRIW
FT                   DSTDALSLKKIPNNFLIIGSGIIGLEMATIYSALGSKVDIIDRFNHFLPVIDEDISSIY
FT                   KKSINQQFNLMLNTHIDKVEVKKDALIVDMIHENIPKKNILYDAVLVAIGRTPNIDSLG
FT                   LDRIGLKINNFGFIQVNNQLKTNIPHIYAIGDVAGTPMLAHKGVHEGHIAAEVISGKNH
FT                   YFEPKVIPSIAYTDPEIAWVGLSEKEAKQENINYEVAIFPWNASGRAIASNCSIGKTKL
FT                   IFNKQNNKIIGGSIVGSNAGELIGEVGLAIEMGCDAEDIALTIHAHPTLSESIGLSAEV
FT                   FQGTVTDVLNFKLNK"
FT   CDS_pept        complement(229342..230139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /EC_number="4.1.1.50"
FT                   /note="BU208"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12925"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12925"
FT                   /db_xref="GOA:P57304"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57304"
FT                   /protein_id="BAB12925.1"
FT                   /translation="MIKLQKLKLYGFNNLTKSLSFCIYDICYANTNDSRNSYISYIDEQ
FT                   YNAIRLTKILKKTCSIIGANVLNIFHQDYEPQGASVTILVCEEPMSMEKIDALNKNIVS
FT                   SSVLAHLDKSHICVHTYPESHPQSGICTFRADIEVSTCGIISPLNALNYLIHQLESDIV
FT                   TIEYRVRGFTRDIHGIKHFIDHKINSIQNFMSDDIKSMYDMVDVNVYQENIFHTRMLLR
FT                   EFNLKNYLFNINLENLEKEERSYIKKLLSKEMREIYYGRNISR"
FT   CDS_pept        complement(230158..231018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="BU209"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12926"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12926"
FT                   /db_xref="GOA:P57305"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57305"
FT                   /protein_id="BAB12926.1"
FT                   /translation="MDHKKTWHEKLYCHLGQYFLIEKMLYKKKTPHHQVMIFKNSVFGK
FT                   IMVIDDIVQTTERDEFIYHEMLTHVPIIAHGSIKSVLIIGGGDGGILREVCRYKMIENI
FT                   TMVEIDVNIIDLCKKYFPNHSNQAYQDSRLNLIIDDGLNFIKRTKEKFDLIISDSTDPI
FT                   GCGKNLFRSEFYFNCKNHLEENGIFVAQNGVFFLQKNETILTYKNLKKYFYDTRFYQAN
FT                   VPTYYGGVMVFAWGTNNIEYRKNSLEKIQIRIKNTKLDFNYYNAKIHISSFYLPQYILN
FT                   ELNES"
FT   CDS_pept        complement(231294..231992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /product="5'-methylthioadenosine / S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /note="BU210"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12927"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12927"
FT                   /db_xref="GOA:P57306"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57306"
FT                   /protein_id="BAB12927.1"
FT                   /translation="MKIGIIGAINQETERLKKIIHFYIEKKINTYKIYIGKFKSHDVFL
FT                   IKSGIGKVSASVATMILIDLYKPDTIINSGSAGSLQSFLKIGDIIIPKKTCYYDVDLTN
FT                   FGYTRGQIPGYPKEFTVNEKICNFFKKNADKYQLKYIKGLILSGDTFVRENESIKILKK
FT                   QFPSAIAVEMESSAIAQVCYKFNIPLIIIKSISDESDNNATVNFKENIDFVSYQLSKFV
FT                   KIILENLIDM"
FT   CDS_pept        complement(232056..232400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadR"
FT                   /product="hypothetical protein"
FT                   /note="BU211"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12928"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12928"
FT                   /db_xref="GOA:P57307"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57307"
FT                   /protein_id="BAB12928.1"
FT                   /translation="MENAFKSHLQFTEKAIKKIKNLIEIEKNHDLKLRIYINGGGCSGF
FT                   QYQFIFDTSINEDDIIITQSEVSLIIDPISLQYLYGGQIDYLENLEGSKFIVYNPNAKN
FT                   TCGCGSSFSI"
FT   CDS_pept        complement(232634..233788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /product="cell division protein ftsZ"
FT                   /note="BU212"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12929"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12929"
FT                   /db_xref="GOA:P57308"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57308"
FT                   /protein_id="BAB12929.1"
FT                   /translation="MFEPSELSNNAIIKVIGVGGGGSNAVEHMVRERIEGVEFFAINTD
FT                   AQALRKIEVGQTIQIGNNITKGLGAGANPEIGRTSAEEDKELLKSALDGSDMVFIAAGM
FT                   GGGTGTGAAPVVAEIAKELGILTVAVVTKPFNFEGKKRMIVAEQGIIELSKYVDSLIII
FT                   PNDKLLKVLSRGISLLDAFSAANNVLKGAVQGIAELITRPGLMNVDFADVRTVMLEMGY
FT                   AMMGTGISSGENRAEEASEIAISSPLLEDIDLSGARGVLVNITAGFDLKLDEFETVGNT
FT                   IRSFSSDHATVVIGTSLDPDMNDTLRVTVVATGIGMEKNLDVNQIKNKSSREVLMDYRY
FT                   QYLNISPKKTDKKIIKKEIKNTKEKINKEPEYLDIPSFLRKRAD"
FT   CDS_pept        complement(233846..235102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /product="cell division protein ftsA"
FT                   /note="BU213"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12930"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12930"
FT                   /db_xref="GOA:P57309"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57309"
FT                   /protein_id="BAB12930.1"
FT                   /translation="MIISKDRKLVVGLEIGTTKVVTLVGEVLIDDNIKIIGFGTCLSKG
FT                   IDKGKINNLDLIVSCIQESINKAEIMADCQITSVYLSLSNKYINCQNEIGIIPISDDEV
FT                   TKEDIEHVIHIAQSVQILNEHHILHVIPQEYSIDQQYGIKNPIGLSGVRMQVKVHLITC
FT                   HQNMARNIIKAVEKCDVKVDQVIFSGLASSKAVLTEDECNLGVCMIDIGGGTIDFTIYI
FT                   DGSIKYSQVIPYAGNIVTSDISYAFSTSRDNAENIKIKYGSVKKPPLGSSKNIDFSDIN
FT                   CNFQQNLQQDALIDVIESRYVELLSLVQDQIVHLQKKLHKKGEKYELLSGIVLTGGGSN
FT                   ISCLTDCAEKVFQKKVRVAKPFNISGLIEKITEPCYSTVIGLLHYGKESYINIDKKKKE
FT                   HSFFEIIFKRINNWFKKEF"
FT   misc_feature    complement(235298..236220)
FT                   /gene="ddlB"
FT                   /note="authentic frameshift; This 307 aa putative ORF is 53
FT                   pct identical to 286 residues of 307 aa protein DDLB_ECOLI
FT                   SW:P07862"
FT   CDS_pept        complement(236217..237671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /product="UDP-N-acetylmuramate-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="BU215"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12931"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12931"
FT                   /db_xref="GOA:P57310"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57310"
FT                   /protein_id="BAB12931.1"
FT                   /translation="MNIKDIKKINFFISEKKNKNIHLIGIGGAGMMGIALILLKLGYKV
FT                   SGSDLLESLMIKKLINLGATIYLQHSEKNIKNVDFIIKSSAISSNNKEILAAKKRNIPI
FT                   LLRAEMIEILMSFKKGIAVSGTHGKTTTTSMIADIFIDSGLDPTVINGGLIKSINSYAK
FT                   LGSSSYFITEADESDASFLYLNPNIIIVTNIEPDHIDHYDNSFKKLKQTFLIFLKKITL
FT                   YGTAIVCIDNNAICDILTNLKCKIITYGFNKNADVRIFLYKQNNFIGHFYIILKNNKKL
FT                   NIILNIPGKHNALNAAAAIALAIHEGINNDLMIASLKNFQGTCRRFEFLGFLSIDQGFD
FT                   KRANCMLIDDYGHHPTELSETIKTIRISWPNKNLIMIFQPHRYTRTYNLYHDFVQTLSQ
FT                   VDVLLILHVYSANEKFIVGADSLSLFNDIKKLGKNYVTLISNHNMILDTLIQTLQGNDI
FT                   ILIQGAGNIDTIAHKILIKKTKKVIK"
FT   CDS_pept        complement(237714..238778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /product="UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /note="BU216"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12932"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12932"
FT                   /db_xref="GOA:P57311"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57311"
FT                   /protein_id="BAB12932.1"
FT                   /translation="MIPKKIIIMAGGSGGHVFPGLTIARYLIEKGWLVNWIGTKNSIES
FT                   RIIPKYGIKIHYISIKGLRNTSLKNLIISPIYILRAYYAVKKIIKTWSPDIVLGMGGYV
FT                   SGPGGVASWNCNIPLLLHEQNKIAGITNKWLSRISTKNMQASPGVLRNAEVVGNPVCQS
FT                   IIKVPNPINRFKNRTGLLRVLVIGGSQGSSILNRILPEVSFLLKEKIIFWHQTGNYELE
FT                   KTKKKYNKLRLNQNLITSFIKNIASAYEWADLIICRSGALTVSEISIVGLGAIFIPYPH
FT                   KDKQQHRNAEDLELIGAAKIIDQSNLNTKLIVNILNSLDRDKLFIMAKKAHSLGVRDAI
FT                   FNIFNVINKISKKT"
FT   CDS_pept        complement(238775..239974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /product="cell division protein ftsW"
FT                   /note="BU217"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12933"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12933"
FT                   /db_xref="GOA:P57312"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57312"
FT                   /protein_id="BAB12933.1"
FT                   /translation="MKHLQKKNSKNPKKIEEKYNTRNSYFILYDRALVWLTLGLFSVGL
FT                   IMVISTSIPISQKIYHNPLFFIKREIFYFFLIFLLSFIFLRTPIIFWEKNSNIILIISI
FT                   VLLVLVLLIGHSIHGSFRWINIGFLHIQPSEICKISSFCYLASYLSRKSNEVRNNFWGF
FT                   FKPMSVIITQSMLLLAEPDLGTVVVLFFTTISVLFLSGAKIGQFFIIITVSILTIILLI
FT                   LLEPYRIKRVLSFWNPWEDPFGNGYQLTQSLIALGRGNFLGQGLGNSIQKLDYLPDAHS
FT                   DFIFSIIGEELGYIGSFLILLIIFTISFRAMYIGQKALEKKQIFSGFLACSIGIWLSFQ
FT                   TSINVGSVTGILPTKGLTLPFISYGGSSLIINSIAIFFLLRIDFETRLKTSQAFPRGPK
FT                   "
FT   CDS_pept        complement(239971..241293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="BU218"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12934"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12934"
FT                   /db_xref="GOA:P57313"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57313"
FT                   /protein_id="BAB12934.1"
FT                   /translation="MSYNYFGKKILILGMGLTGISCINFFLKKGIKPKIIDESKHPSNF
FT                   IKIPQNIEYSLGSLDHQWILESDLIVISPGISSFKPILIKARLLGIEIISDIELFSREV
FT                   TCPIISITGTNGKSTVATMIEKIAKKSGYKAFLGGNIGVPVLEILDKEADLYIIELSSF
FT                   QLENTFNLKSKIAVILNISEDHINRYPNGFQQYKNTKLSVYNQAEICIINSNDKIEKSL
FT                   IHSKNKKWISFGTNRSDYRICSKSNDPILFFKNKKILNTSEILLYGYHNYNNILVSLAI
FT                   SDAMQFPRNDAINVLKSFSNLPHRFQIIKNEKGVRWINDSKSTNVNSTQVALNSIKTTG
FT                   TIRLLLGGDSKSANFNILKNIFRTLKIKIYCFGRDGIKLSKICEKKSIYVENLKKAVIL
FT                   ISKQVKSGDTVLLSPGCSSLGQFSNFEERGNLFIKLIKEIT"
FT   CDS_pept        complement(241293..242366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="BU219"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12935"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12935"
FT                   /db_xref="GOA:P57314"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57314"
FT                   /protein_id="BAB12935.1"
FT                   /translation="MLIFFNKYLHINLNILSYIPYRAIFSLLTSFFINLYIGPYFIYYF
FT                   KKLQTYQIIRNNGPKTHYSKKNTPTMGGIFIIFSILFSTILYCNLSNIYIWYVISILIG
FT                   YGLIGFIDDYKKIKYKNSQGLKLKWKYFFLSIIAFIFICMIKINNKDIISTELIIPFCI
FT                   KNDFEINYLYIFLSYFVLVGTSNAVNLTDGLDGLAIMPVIFLTCGLTLISLFSDNINIS
FT                   HYLHVQYVKNSTELAILCMAIVGSGLGFLWFNSYPAKVFMGDVGSLALGGSLGAIAILL
FT                   HQELLLIIMGGIFVFETISVILQIISFKIRKKRIFQMAPVHHHYEVKGILEPLIIVRFW
FT                   IVSLILLLISLISLKVC"
FT   CDS_pept        complement(242360..243727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanyl
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="BU220"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12936"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12936"
FT                   /db_xref="GOA:P57315"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57315"
FT                   /protein_id="BAB12936.1"
FT                   /translation="MISLSLKKIALITNGTLYGADLLINEIVIDTKKIIPGCLFIALIG
FT                   RKFDAHIFIHDALKKKCAAFVTQKNIKPHVPYIIVENTSIALGQIAGWVRKKTKAKILA
FT                   ITGSCGKTSVKEMTASILRKNGNTISTIDNLNNNIGVPMTLLQLKQEHKYGVIELGASK
FT                   PGEIAYTSNISQPDIILINNIHCAHLQGFKSLLGVSKAKSEIFSGLKPNSTVIINLDSH
FT                   HFSQWKKDIKNSNILFFSIKKKKYSNFFCSNIKIHIHGTSFTMHTPCGKINISLPFLGY
FT                   QNISNALAASAFSFALKIPLKKIKIGLLDTPIVSKRLESIILEPNKILIDDTYNSNVSS
FT                   MISAIKVLERMPGYKILVTGDMAELGENSMMYHQMIGNTANSSAINKIFSIGDMSSEIT
FT                   KIFNNGKHFLNKKKLSEYLKNVFLKKKKITILVKGSRSTKMEKVVEDLIKESKKKC"
FT   CDS_pept        complement(243724..245217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate
FT                   ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="BU221"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12937"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12937"
FT                   /db_xref="GOA:P57316"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57316"
FT                   /protein_id="BAB12937.1"
FT                   /translation="MNKICLKYLLLPWIKNIPKKYISNLKMDSRTLTPGDLFIAVPGIK
FT                   KDGRHFIVQAINKKAAAILCETKKKDKHGIFKYIKNVILIYFFKLSENVSLLANRFYKE
FT                   PGKRLKIIGITGTNGKTTVTQLINQWSTILGTKTATMGTLGNGFYNSLQPTNNTTSSPI
FT                   FIQLFLSKVLEKQAELVTMEVSSHGLIQHRVKEVPFYIAIFTNLTQDHLDYHENLEKYE
FT                   SAKWLLFSTHKVKKIILNADDQYGKIWLKKLLNFYTVAVTIQNRKQKKYSTKWINATNI
FT                   EQNNNSIYITFESSWGTGRISSCLIGRFNVTNLLLSLACLLELGYSLSDLIHTSEKIIP
FT                   VQGRMELFSYVKKPTFIIDYAHTPDALKKTLNAIHSHYQRYIWCIFGCGGERDQKKRPI
FT                   MGAIAEKMSDKVIITNDNPRNEKEKKIIQDILNGCKNKEKILIIPDRKKAISYAYFGAK
FT                   YHHIILIAGKGHEEKQIIQNRSINYSDKKIVLNLLGKNI"
FT   CDS_pept        complement(245218..246957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /product="cell division protein ftsI"
FT                   /note="BU222"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12938"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12938"
FT                   /db_xref="GOA:P57317"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57317"
FT                   /protein_id="BAB12938.1"
FT                   /translation="MYKKEKNRFLKSKQINYINWRFFLLYGFIFLSLFILTLRVIFLQI
FT                   ISSNRLITEGDRRTLRTQSLLSTRGAIKDRRGYPLAVTVLVNAICADPSVILKTKNIKN
FT                   HKRWQALSEILSIPLKKMFLRINSHKKSKFIYLARQINPEISEYIKKLQLPGIFLLEES
FT                   KRYYPFKEISAQLVGFTNIDGIGIEGIEKSFDLLLTGKPGKRKIRQDNKGHVIEKISLV
FT                   HKRASNNLNLSIDTKLQTIVYNELQEGVKKSQSDSGTAILINIKSGEVLAMANSPSYNP
FT                   NNIRHIIQKNVRNKAITDLFEPGSTVKPIVIIEALKLGIIQENSIIDTKPFLIQKHQIK
FT                   DVSYHEKLTITGILQKSSNVGVSKIALSMPTLKLLDSYIKFGLGKPTQLGLIGEKHGFF
FT                   PPKKRWSNLDKATLSFGYGLMVTPLQLARLYSTIASYGIYRPLSIIKTDRPTGGKQIFP
FT                   PKYVKKVINMMESVSQPGGGGLQAAVRGYRVAVKTGTAKKVGIHGRYIKKYTAYTAGIA
FT                   PASDPRFSLIIILDNPQGKKYYGGAVSAPVFSNIMKLILKKMNIKPDNLSNQKMILKSN
FT                   KRN"
FT   CDS_pept        complement(247072..247275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /product="cell division protein ftsL"
FT                   /note="BU223"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12939"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12939"
FT                   /db_xref="GOA:P57318"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57318"
FT                   /protein_id="BAB12939.1"
FT                   /translation="MKIQRYDLPKIIKNDFLLYGKIHLTLLIAIILSASLVIITVYNTR
FT                   LLITEEEDVIQKKKKKMMNGEI"
FT   CDS_pept        complement(247278..248216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabC"
FT                   /product="hypothetical protein"
FT                   /note="BU224"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12940"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12940"
FT                   /db_xref="GOA:P57319"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57319"
FT                   /protein_id="BAB12940.1"
FT                   /translation="MNHIFKHIPVMKKELIDSLKIKKNGIYIDSTFGTGGHSNEILKKL
FT                   GQNGRLYSIDRDPIAFSIGSEIKDSRFHIINENFSKLLDFAKNEKIIGKVNGIIFDLGV
FT                   SSIQIDDYRRGFSFKNDGPLDMRMNPNYGISASEWLFESNVKEISFVLKNFGEERFSRK
FT                   IAYAIKRRSQIKKITSTLELANIIKKTIPTKNKFKHPARRSFQAIRIYINQELEEIQKA
FT                   LESTLKILKPGGRISIISFHSLEDRLVKKFMIKNSTKAIIPYGMPITEEQLNRLTTCKL
FT                   KIINRILPTQNEINNNPRARSSVLRIAEIQE"
FT   CDS_pept        complement(248338..248814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /product="acetolactate synthase small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="BU225"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12941"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12941"
FT                   /db_xref="GOA:P57320"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57320"
FT                   /protein_id="BAB12941.1"
FT                   /translation="MRRILSILLENESGALSRVIGLFSQRGYNIETITLAPTEDPTLSK
FT                   MTIQTVGNEKAIEQIEKQLHKLIDVLRVVQIGQSSHIEREIVLLKVQINNHRRDDIKHI
FT                   TEVFRGQIVDITSATYILQLSGTTKKIDAFLKIIRNFSEIIEVTRSGIVGISRG"
FT   CDS_pept        complement(248819..250534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /product="acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="BU226"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12942"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12942"
FT                   /db_xref="GOA:P57321"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57321"
FT                   /protein_id="BAB12942.1"
FT                   /translation="MEILSGAEMVVRSLIDQGIQHIFGYPGGAVLDIYDALKTVGGIEH
FT                   ILVRHEQAATHMADGYSRSTGKTGVVLVTSGPGATNAITGIATAYMDSIPMVVISGQVA
FT                   SSLIGYDAFQECDMIGISRPIVKHSFLVKKTEDIPIVFKKAFWLASSGRPGPIVIDLPK
FT                   DILKKDNKYLYKWPDNINIRSYNPTTKGHIGQIKKALHTLLKAQRPVIYAGGGIISSNS
FT                   SEELRIFAEKINCPVTTSLMGLGSFPGTHDQNISMLGMHGTYEANMTMHHADVIFAIGV
FT                   RFDDRTTNNLNKYCPNAIVLHVDIDPTSISKTVSANIPIVGDAKHVLQKMIELLKKEKK
FT                   ISLLEDWWNTIKKWKKINSLQYNQLSNKIKPQTVIKTLFKLTKGTSYITSDVGQHQMFT
FT                   ALYYPFNKPRRWINSGGLGTMGFGLPAALGVKLALPKETVICITGDGSIQMNIQELSTA
FT                   RQYNLAVLILNLNNSSLGMVKQWQDMIYSGRHSHSYMDSLPDFVKLSESYGHFGIQITE
FT                   PIELEEKLMLALSKLSDGHLVFVDVQIDNSEHVYPMQIQGGGMNEMRLRKKEVA"
FT   misc_feature    complement(250805..251880)
FT                   /gene="apbE"
FT                   /note="authentic frameshift; This 358 aa putative ORF is 45
FT                   pct identical to 314 residues of 358 aa protein APBE_ECOLI"
FT   CDS_pept        252152..253588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /product="protease do precursor"
FT                   /note="BU228"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12943"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12943"
FT                   /db_xref="GOA:P57322"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57322"
FT                   /protein_id="BAB12943.1"
FT                   /translation="MKKSAIILSKIILILTLLLSFGMSWNNVFSNTKNSIVSREISPSL
FT                   APMLEKVMPSVISINIEGSAITRTSRLPHQFQPFFGDNSPFCQGNSPFRHSPFCHINPD
FT                   SDDKKEKFRALGSGVIINADKGYAVTNNHVVENANKIQVQLSDGRRYEARVIGKDSRSD
FT                   IALIQLKNANNLSEIKIADSDNLRVGDYTVAIGNPYGLGETVTSGIISALGRSGLNIEH
FT                   YENFIQTDAAINRGNSGGALVNLKGELIGINTAILAPDGGNIGIGFAIPCNMVKNLTAQ
FT                   MVQFGQVRRGELGIMGMELNSDLAQIMKINSQKGAFVSRVLPNSSAFEAGIKAGDIIIS
FT                   LNRKPISSFSSLRAEIGSLPVATKMELGVFREGRIKNITVELKHSVKHNLNSENDYIGI
FT                   EGVDLSDYIFNEQKVIKVDNVKPHTPASKIGFKKDDIILNVNQKLISNVDELKKFLHSK
FT                   PKILVFNIKRGNDTIYLVSE"
FT   CDS_pept        complement(253632..254456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="BU229"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12944"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12944"
FT                   /db_xref="GOA:P57323"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57323"
FT                   /protein_id="BAB12944.1"
FT                   /translation="MKELKKIIEETYENKNKINLNNLDYEILQTIFRVIKLLNNGIIRI
FT                   SEKKDNTWITHEWLKKAVLLYIYIKENKFIEGSYTSYYDKVPLKYEKYNEKQFKKEKVR
FT                   IVPPATIRYGAFINYNTIIMPSYINIGAYIDQGTMIDTWATIGSCAQIGKNVHISGGVG
FT                   IGGVLEPLQNNPTIIEDNCFIGARSEIVEGVVIEKGCVISMGVFIGQSTKIYDRENGKI
FT                   FYGRVPAHSVVVSGTLPSENRNYNLYAAIIVKKVDAKTLGKTEINQLLRNIK"
FT   CDS_pept        complement(254517..255311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /note="BU230"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12945"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12945"
FT                   /db_xref="GOA:P57324"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57324"
FT                   /protein_id="BAB12945.1"
FT                   /translation="MSCIIKTESEIKKMRISGKLAAEVLEMIKEHLQPKISTEDINQIC
FT                   HDYIVYKKKAISACLGYHGFPKSICISINDVVCHGIPSKNQVFKEGDIVNIDIAIIKDG
FT                   YHGDTSKMFYIGKTSILSKRLCQVARESLYLSLKLVKPGIPLYKIGEIIQNYVESNNFS
FT                   VVKEYCGHGIGRNFHEEPHVLHYKNKKNNIILKKGMIFTIEPMINSGNPEVKCMKDGWT
FT                   VKTKDRSLSAQYEHTVLVTEYGCDILTWQKDEDISQKLVNIN"
FT   CDS_pept        255574..256308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /product="30S ribosomal protein S2"
FT                   /note="BU231"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12946"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12946"
FT                   /db_xref="GOA:P57325"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57325"
FT                   /protein_id="BAB12946.1"
FT                   /translation="MEIVSMREMLKAGVHFGHQTRYWNPKMKPFIFGIRNRVHIINLEK
FT                   TLPMFHFALSELKKIALKKGRILFVGTKKAASKGIKEVAINCEQFYVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLEIESKDGTFSKLTKKEALIRSRELFKLENSLGGIKNMGGLPDCLFV
FT                   IDAAHENIAITEANNLGIPVFSIVDTNSNPDGVDYIIPGNDDAIRSVNLYLKSIMLTIS
FT                   KINNQNSLDKVFIDTKNSTNIE"
FT   CDS_pept        256385..257191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /product="elongation factor Ts"
FT                   /note="BU232"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12947"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12947"
FT                   /db_xref="GOA:P57326"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57326"
FT                   /protein_id="BAB12947.1"
FT                   /translation="MKTNVDTGLIKELRSRTGAGFLACKRALLEENGDIESAIDNLRKS
FT                   GKLTAEKKINNITNQGAIFSKIKNNIGVMLELNCETDFVSKDNLFICLGEDILVEALEK
FT                   RIKDINQLKVIFESRRTELVSKVGENINIRRFHLIEGENIFSYLHGVRIGVLVSSSSLN
FT                   KTILKNIAMHIAASKPEYLHPKNVSSEVFQREYQIQLELAKNLNKPSNLLKKIIDGRME
FT                   KFVNNISLTSQSFIMNPIKTVGDILNENHAHIESFIRFELGELVSK"
FT   CDS_pept        257242..257970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /product="uridylate kinase"
FT                   /note="BU233"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12948"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12948"
FT                   /db_xref="GOA:P57327"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57327"
FT                   /protein_id="BAB12948.1"
FT                   /translation="MSTDKKFIYRRILLKISGEVLQGVNKFGIDINSLKRIAKEIEFIV
FT                   KIGVQVGLVIGSGNLFRGAKLSKLGLNRVASDHIGILSTVINSLAMRDTINSISSIKTC
FT                   LMSAIPLNGICEIYNYEKAMNLLSNHVVVIFSAGTGNPFFTTDSAACLRGIETESDIIL
FT                   KGTKVDGVYSKDPNKDSHAFLYRRLTYKDVLKKELKIMDLAAFTLARDYHMPIRVFNIH
FT                   TPGSLYRIIMGDDEGTLITR"
FT   CDS_pept        258051..258608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /product="ribosome recycling factor"
FT                   /note="BU234"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12949"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12949"
FT                   /db_xref="GOA:P57328"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57328"
FT                   /protein_id="BAB12949.1"
FT                   /translation="MINQIDIKTRERMEACIQTFHNNITNIKTGRASPTLLHNIYIEYF
FT                   GSKTPLRQVSNIIVEDSHTLKINVFDDSITSLIRKSILNSNLDLNPVLQGKDIIIPIPR
FT                   LTEERRKQLIKVIRGDAESSRIQIRNIRRDANDKVKRLLKDKIISEDNEHTSQSKIQIM
FT                   TNEYIKKIDCILEKKEKELMKF"
FT   CDS_pept        258691..259887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /note="BU235"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12950"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12950"
FT                   /db_xref="GOA:P57329"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57329"
FT                   /protein_id="BAB12950.1"
FT                   /translation="MKKITILGSTGSIGINALSIIQKNPDLFKVIALVANKNFSIMLRQ
FT                   CELFSPDWVAMRDEKSAHILRKKLKHSKINTQVLTGEKDICALAALEETDHVISAIVGM
FT                   AGLLPTLSAIHAGKTILLANKESLITSGYFFMKALSSSGAKIIPIDSEHNAIFQVLPLE
FT                   IQKNLGKTTLEKNSIKHLVLTGSGGPFYKFSSSDLSNVTPDQACSHPNWLMGKKISVDS
FT                   ATMMNKGLEYAEARWLFNALESEIKILIHPESIIHSMVQYYDGSLLAQLSVPDIRTSIS
FT                   YAMSWPDRICTEVDYLNFYKINNLTFFEPDFTQFPCLKLAIDAFSQGQASMTVLNAANE
FT                   IAVSSFLDSKISFTKIYEINMEILMSSCFSEPKCIQDILEIDRKVRILAKNKVSSLIF"
FT   CDS_pept        259980..260735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /note="BU236"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12951"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12951"
FT                   /db_xref="GOA:P57330"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57330"
FT                   /protein_id="BAB12951.1"
FT                   /translation="MQYKYLLEYNKKNHECNPCHVAIIMDGNGRWATRQGKIRIMGHKE
FT                   GFRAVKEAIKFSIANNLKILTLYAFSSENWNRPLFEIKALMELFLFALDTEIKNLKKHN
FT                   IRFKVIGDITCFDKKLQNSIHYAEQITFDNTGLILNIAANYGGRWDIIESVKKIINRVQ
FT                   RGILDVNKIHENTISQYLSTSELLPVDLVIRTGGEKRISNFLLWQIAYSELYFTDVLWP
FT                   DFNCHIFQHAIDSFVSRERRFGGFKKNKK"
FT   CDS_pept        260969..262822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeT"
FT                   /product="hypothetical protein"
FT                   /note="BU237"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12952"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12952"
FT                   /db_xref="GOA:P57331"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57331"
FT                   /protein_id="BAB12952.1"
FT                   /translation="MLIKNFFIAFLMFFSILVHAENKFIVKDIQFKGLKNFSQNEALKN
FT                   IPFRIGSTISQYDVKNSIKSLFKTGKFEDIKVSFLGKTIVFNIRERPIISNVIVSGNHI
FT                   IASSVLDPYLKKLNIETGKSFNNFFTNVLTKTIKDFYLDIGRCKPDIKILKIFSKNNSV
FT                   SIKILINEGTEIKINSIKILGVQAFSKEKILSLFKLQDYHSWWNLLSKSTYSPKELNND
FT                   LEHLKNFYLSNGYYYFNVNTKKVDFLQDKKQVDITIGVSEGKKYKISNFFVNGNLFPYQ
FT                   KLITNLININPNEFYNRDKIDIIVNKITRFLSEYGYVNTKVIVDPQIDHKKKTIALNFN
FT                   IDMKKRYFVKRIYFTGNEITQDRVLRRKIKQMEGKYFNTKLVELGKKLLEKTKYFSDVK
FT                   IIQKLNSYDSNQIDITYQVKEQTTGSINFGLGYGVDSGTSFNLAFSQDNIFGSGNSLKV
FT                   DIIKNDYQKYLDISTSYPYFFYNNADLNARFFYNDFKYNFDNISNIIKNTYGFEGNLGF
FT                   LINNYNKVNFGFGYTHNSINNEEKKIHGKFTGELNINKLYYFVGVDDTRFKKIAIPGDQ
FT                   IFIKVTILKSNKNILIFKNIAVVNNDIICKSKIVFAKKYLF"
FT   CDS_pept        262859..266344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /product="DNA polymerase III alpha chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="BU238"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12953"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12953"
FT                   /db_xref="GOA:P57332"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57332"
FT                   /protein_id="BAB12953.1"
FT                   /translation="MNEPKFIHLHVHSDYSMIDGLSKPEDLVKKAASLNMPAIAITDYN
FT                   NLYGVIKFYNMAHKLGLKPIIGITVNFFSDLINNQLTKLTLLASTQEGYKNLILLISRA
FT                   YQKGYVHNNHVTIEKKWFSEINKGLILLSGGPQGELGKVLLNGQSSLISICLSFYQKYF
FT                   PDSYYLELFRTNRDNEETYLHLAVDLSLSTGVPIVATNDVCFLSQEDFKIHKIRIAINE
FT                   GEILQHSKIQNNYSNQQFLKTTEEMSDLFSDIPEALINSVEIAKRCNVFIHSGKYFLPQ
FT                   FRTGKISVEKYLIKEAYKGIKKRLNSRYLDIEKYKDIYSQYINRLDMELTVINKMGFPG
FT                   YFLIVMEFIQWAKDNNIPVGPGRGSGAGSLVAYALNITEVDPLSFNLLFERFLNPERIS
FT                   MPDFDIDFCMEKRDQVIDHVSEIYGKNAVAQIITFGTLTAKAVIRDVGRVLGYPYGFIN
FT                   KLSKLVPLDPGITLKEAFSKESELFNLYKNNEDVKNLIDIAKKLEGTNRNIGKHAGGVV
FT                   ISPTKITDFCPLYCDEKGNNPVTQFDKNDIEYIGLVKFDFLGLRTLTIISYAVEMINTK
FT                   LNLNKKRTININSIPLDDAKCFKLLKNSETTGVFQLESYGMKDLIKRLQPDCFEDMIAL
FT                   VALFRPGPLQSGMVDNFINRKHGRENISYPDHKWQHILLKPILESTYGIILYQEQVMEI
FT                   AQVLSGYTLGSADILRRAMSKKNLKDMSEQRAIFEEGASNNGIDKKLSIKIFDLLEKFA
FT                   GYGFNKSHSVAYALVSYQTLWLKSHYPAEFIAAAMTSDIDNTEKIVILINESLNMGVKI
FT                   IPPNINLSKYEFYVNDQGDIVYGLGAIKGIGKNSVQVLIKEREENKFFHDLFDLCMRID
FT                   SQKITRRVLEKLIMSGSCDCFDKNRNYLLQSIDDAINASKESFRIKSFKQDSLFGIFQN
FT                   ELNQVKKNNLVNLVCPEKNKLQNEYQVLGFYLTGHPINQYKKELECYVNGVKLSQLKFI
FT                   KRNKKILVAGIIVSIKIKITKNKNRIAILVLDDNTSRLEVVIFTELLNAYESLVKLNKL
FT                   LFVHGMLNVSFIDKNIKMTAYALIDLSVLRKKYINKLIIILNKEKTNIFFLNNLYECLD
FT                   KQSKGNIPVFIFFDNKEVCLNKKLNKKWFVVITDDFLNKLKFLVGSKNIELKFN"
FT   CDS_pept        complement(266472..268190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="BU239"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12954"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12954"
FT                   /db_xref="GOA:P57333"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57333"
FT                   /protein_id="BAB12954.1"
FT                   /translation="MLTSQYLLSTSKDIPYDAKIISHQLMIRSGMIRKTSSGLYVWLPT
FT                   GMRVLKKIKNIITTEMEKINALEILMPIIQPEYLWKESRRLNLYGEELLRFLDRRKNQF
FT                   ILGPTNEEVVTNFIGSEIHSYKQLPLTVYQIQTKFRDEIRPRFGIIRTREFTMKDAYSF
FT                   HINQSCLENTYNKFYDSYINIFKKMNLNFCAVKADSGSMGGNISHEFQAFSQNGEDEIV
FT                   FSNDKLYSSNMNMAESIETIDFFKKKYSSCLIKNKTNTKKSIIMSEKLNTPLINQIQTF
FT                   LIQTKINDITSIAALLIRGDHELNFFKVEKIDIINKPLVFLNEKEVISLIGVKKEFLGP
FT                   LGLKVPIIADISTFNMKNFTIGSNINKHFFINVNWNIDLPMPIFKDIRKVTKNDLSPNG
FT                   SGYLNIKQSIEIGHIFQLGQKYSRKIQQSVKIKNGNLKNLYMGCYGIGITRIAAAVIEQ
FT                   HHDKNGIIWPDSIAPFEVVILPINMKKDNKIKIIAHFLYKKFKKTGIDVILDDRDERPG
FT                   VMFNEVDLIGIPHQIIISKRSINYDNVEYRERKNKENILINIKDIKNFIIQKLKK"
FT   CDS_pept        268530..269681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /product="flagellar biosynthetic protein flhB"
FT                   /note="BU240"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12955"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12955"
FT                   /db_xref="GOA:P57334"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57334"
FT                   /protein_id="BAB12955.1"
FT                   /translation="MNHNTNEEKTEHPTEHRIRKFRKKGKTRYSRELSSLFILLVGFIN
FT                   LWWYRDLIVLNFSKIMSDSFLFESNDFLNNNNNLLKILMSLKEILFSFFPFLISLLIVI
FT                   IIPPILFSGISLNFRSLTLNFSKLNPFHGFKRLFSFQIIVEFFKIILKLFIVSIISFWY
FT                   LQFSFSEILFLVNANYVSSLSHGYNIIFSCCFLVILGLFPIVFFDIAWQQFNYYKKLKM
FT                   TRQEMRDELKEKEGNPNIKMRIRQAMKAVMRRRMIINTPKADVIITNPIHYSVALKYDE
FT                   KNMNAPKVIAKGIGEAAIKIQNLALKHNISIISVPSLARSLYRYSEIGQYIPGPLYKAV
FT                   AEVLAWVWKVRKWKKEGGIFPEKPINISVPSELTFTGEHETND"
FT   CDS_pept        269665..271764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /product="flagellar biosynthesis protein flhA"
FT                   /note="BU241"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12956"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12956"
FT                   /db_xref="GOA:P57335"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57335"
FT                   /protein_id="BAB12956.1"
FT                   /translation="MKLMINFSSLLRIVKSLKTTQWQILAGPILILMILSMMVLPLAPF
FT                   VLDVFFTFNIALSIIILLVSMFTRHTLEFTAFPTILLFSTLLRLALNVASTRVIFLRGH
FT                   TGTNSAGRVIESFGHFLVGGNFAIGIVVFIILVIINFIVITKGASRIAEVGARFILDAM
FT                   PGKQMAIDADLNAGLIGEEKAKKRRIKITQEADFYGSMDGASKFVRGDAIAGILIMVIN
FT                   IFGGLIIGLIQHHMFLNKAVEVYTLLTIGDGLVAQIPALVISTAAGVIVTRVSSNQNVG
FT                   EQMASQLFYNPQVILLSAIVLGVLGLVPGMPNIIFLVFTVLLFILSWWLYEKKYDLEND
FT                   FIKSNKKYKFIHDAISEASWNDVELEDPIRIEIGYKLTPMTDINKKGDLLDRIRIVRKK
FT                   VAQEIGFLPPLVRIKNNMHLSGNSYRIFIKGVEVGQGKCFYGRFMAIHSGRETESLPFE
FT                   KVYEPTFGLSGYWIDEEFKNKAQKKGYSVIESSVVLSTHLNFLITNHIDDLFGRQEAQQ
FT                   LLERVTIDHPKLTEDLIPNTINLTIFHKILRNLLLEHVPIRDMRTILETLSEHADTQKD
FT                   PNELTSIVRIALRKIIIQKLFNQNNIIEIIGLEPNLERLLLNSLKSGTDTIEPNLSENL
FT                   LIQTKEAIKKQLLIGSPLVLLVRHSLRYFLSKFLRQNFPELTVLSQFEIIDVKEIKMTN
FT                   IIGTS"
FT   CDS_pept        complement(271888..273612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="BU242"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12957"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12957"
FT                   /db_xref="GOA:Q44683"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44683"
FT                   /protein_id="BAB12957.1"
FT                   /translation="MNLKNTIKEDIQDALIKIAIINCDPVITLNKKTKIGHYQLNNLIK
FT                   IANISNLKPFELANRIILNIKKKYMYKEITFSQPGFINFLINPYWISEQLEKIFLSPRL
FT                   GINHVNAQNIVIDYSSPNIAKEMHIGHLRSTIIGDVMARILDFLGHNVIRANHIGDWGT
FT                   QFGMLIAYLEVKKLVNSPLSLMKLEEYYCKAKKKYDIDQLFAEKSREYVVKLQNGDQYC
FT                   YSIWKKLVSITMLENCKIYKRLHVTLKKKHTMGESIYNKMLPNIIEDLKNKKIAIEKNG
FT                   STIVFLKEFKNRLGEPMGVVIQKKDKGFLYSTTDIACLKYRYQVLHADRIIYYTDSRQH
FT                   QHLLQAWTIAKKALYISQNLLLEHHIFGMMLSKDKRPFKTRDGDTIKLSALLDEATERA
FT                   MRLIKNKQPNLSKKKLNQLSNIIGVGAVKYADLSKNRNTNYIFDWNEMLSFEGNTAPYI
FT                   QYAYTRIVSILKKSNMPIKKLKEKIFLTKESEINLAIKILEFEEIILLISQKGTPHILC
FT                   KYLYHLATSFSHFYENCSILFPKKIKTCKSRLKLSILTAKTLKKGLNMLGIRVVKKM"
FT   rRNA            274065..275524
FT                   /gene="rrs"
FT                   /product="16S rRNA"
FT                   /note="BU243"
FT   tRNA            275637..275713
FT                   /product="tRNA-Ile (GAT)"
FT   tRNA            275728..275800
FT                   /product="tRNA-Ala (TGC)"
FT   CDS_pept        complement(275795..276550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /product="probable hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="BU246"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12958"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12958"
FT                   /db_xref="GOA:P57336"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57336"
FT                   /protein_id="BAB12958.1"
FT                   /translation="MILKKISILSDNYVWVLLNTSGSCIIIDPGLSEPIIQEIERKKWR
FT                   LRAILLTHNHIDHTGGTRKIIEYFPKISVFGPKETRQHGVNKIVSHGDRIILLDKIFYV
FT                   FFTPGHTSGHVSYYSQPYIFCGDTLFSAGCGRVFKNKHLEMYRSIKIISSLPDSTLLCC
FT                   SHEYTLSNLQFSMFILPNDNFIKLYLKKIEIKLKLGQSSLPSYIFFEKKINLFLRTNDN
FT                   YVKKSIGLKSTCTDFEVFKRLRLKKDFWS"
FT   misc_feature    complement(276591..277060)
FT                   /gene="rnhA"
FT                   /note="authentic frameshift; 57 pct identical to RNH_ECOLI
FT                   SP:P00647"
FT   CDS_pept        277113..277826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /product="DNA polymerase III epsilon chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="BU248"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12959"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12959"
FT                   /db_xref="GOA:P57337"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57337"
FT                   /protein_id="BAB12959.1"
FT                   /translation="MNRKRTIILDTETTGINQTSLPHINHRIIEIGAVEIIDRCFTGNN
FT                   FHVYIQPGRSIESGALKVHGITNKFLLDKPIFKDIADSFLNYIKNSILVIHNASFDVGF
FT                   INQELEILNKKIKINTFCSIIDTLKIARELFPGKKNTLDALCTRYKINKSHRNLHSAIV
FT                   DSYLLGKLYLLMTGGQDSLFSDNTINYKENFKKLKKNIQLKNNTLRILHPTLKENDLHE
FT                   KYLQYMKDKSTCLWN"
FT   tRNA            277895..277968
FT                   /product="tRNA-Asp (GTC)"
FT   CDS_pept        278052..278633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpcA"
FT                   /product="phosphoheptose isomerase"
FT                   /note="BU250"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12960"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12960"
FT                   /db_xref="GOA:P57338"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57338"
FT                   /protein_id="BAB12960.1"
FT                   /translation="MYKKIIFSEFNSASKILKNFLEDKKQIENIQKAAILIAQSFKNEK
FT                   KVISCGNGGSHCDAVHFSEELTSVYRKKRSGYPAISISDSSYISAVGNDFGYDQIFSRF
FT                   IQSVGHLGDILLAISTSGNSLNIVRAIEEAKKKKMKVIVLTGNNAGKIKNLSDIEICIP
FT                   HCGYSDRIQEMHIKIIHILILIIEKEMQKN"
FT   CDS_pept        278770..279216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /product="xanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /note="BU251"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12961"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12961"
FT                   /db_xref="GOA:P57339"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57339"
FT                   /protein_id="BAB12961.1"
FT                   /translation="MLQIHTRKLANRLVKKIHSWNGIIAVSRGGLVPSALLARELGLRC
FT                   VDTVCIESYNYDCLKENRKIIKKAEGNGEKIIVIDDLVDTGGTAKIIRKLYPKACFVTI
FT                   FAKPMGRSLVDNYIIDIPQNVWIEQPWDMSISYIPPLIQNYKIK"
FT   CDS_pept        279317..279901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE1"
FT                   /product="heat shock protein grpE 1"
FT                   /note="BU252"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12962"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12962"
FT                   /db_xref="GOA:P57340"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57340"
FT                   /protein_id="BAB12962.1"
FT                   /translation="MIHNEEEQLEKKIEKNQDPKINHKKYDSDNLIKKNLIQFLEIQLK
FT                   ESEEKIIEKEEIVEKEIVLIHNRFNKEIEKSIKFSLEKIIIDFLPIIDNIERALNLIET
FT                   INLKQEKYTEILKKLQFICNLLEKFFYLFNIKKINDTNVLFNPSIHQAMSIHYTNDIIS
FT                   NQIVTVMQSGYILHKSRLLRPAMVVVSKEKI"
FT   CDS_pept        complement(279980..280279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjF"
FT                   /product="hypothetical protein"
FT                   /note="BU253"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12963"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12963"
FT                   /db_xref="InterPro:IPR005346"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR037021"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57341"
FT                   /protein_id="BAB12963.1"
FT                   /translation="MKIIKVTVVYALPKIQYICQVDIALGSTVKDAILKSNLLNLTNDV
FT                   SFHHNRIGIYNKTVHLKFKIKDGDRIEIYRNLTIDPKEWRRNNVFLSKKLKKIY"
FT   CDS_pept        280373..280861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /product="small protein B"
FT                   /note="BU254"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12964"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12964"
FT                   /db_xref="GOA:P57342"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57342"
FT                   /protein_id="BAB12964.1"
FT                   /translation="MLQKKKYQKKSSKIIINKKAYYNYFIEKVFQSGLVLEGWEIKSIR
FT                   SGKVNISESYIINDRNEMYLCNCLIEPLQMSSNRFSCDPTRKKKLLLHKNEIDFLSLKK
FT                   KNTGYTMVSLSLFWKKSWCKLEFGLAKGKTAQDKRINLKKREWEQEKLKILKKTKETY"
FT   CDS_pept        280870..281355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhC"
FT                   /product="hypothetical protein yfhC"
FT                   /note="BU255"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12965"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12965"
FT                   /db_xref="GOA:P57343"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57343"
FT                   /protein_id="BAB12965.1"
FT                   /translation="MKYEKDKNWMKIALKYAYYAKEKGEIPIGAILVFKERIIGIGWNS
FT                   SISKNDPTAHAEIIALRGAGKKIKNYRLLNTTLYVTLQPCIMCCGAIIQSRIKRLVFGA
FT                   NCNSSDHRFSLKNLFCDPQKDYKLDIKKNVMQRECSDILINFFQKKRKNKIHICKKI"
FT   CDS_pept        complement(281356..281736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /product="holo-[acyl-carrier protein] synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="BU256"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12966"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12966"
FT                   /db_xref="GOA:P57344"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57344"
FT                   /protein_id="BAB12966.1"
FT                   /translation="MSIIGIGIDFVEILRIKNIFLKYGDKFARKILSTEEWKKYILIDD
FT                   SISFLAKKFVAKEAASKALGTGINHQITFNQLEFYKNKSGKPKLRFLKHALKKSKEIQC
FT                   KSIHVSISDQKLYAYALVILEN"
FT   CDS_pept        complement(281861..282712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /product="GTP-binding protein era"
FT                   /note="BU257"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12967"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12967"
FT                   /db_xref="GOA:P57345"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57345"
FT                   /protein_id="BAB12967.1"
FT                   /translation="MKIKKKYCGHVIIVGKANVGKSTLLNNIIGKKISIVSRKKNTTQS
FT                   NITGIKTEDNYQSIYIDTPGVVFDKNNNQMKHHKNNFYQTTQIATLIIFIIDRIDWTIH
FT                   DEIILNEIKKTKIPILIIINKIDKISNKIILLPFINFLKKKIDFIEILPISAKKISNLI
FT                   LLKNIIKSYLPENCHIYPECYITTNSDFFTVSEIIREQLILFLGDELPSIIKVEIESFK
FT                   KKEKIALYIKAIIWVKNVRQKSIVIGHNGEKIKKISMISRNNIEKKFYIKTHLVLWVKD
FT                   KN"
FT   CDS_pept        complement(282709..283389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="BU258"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12968"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12968"
FT                   /db_xref="GOA:P57346"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57346"
FT                   /protein_id="BAB12968.1"
FT                   /translation="MNHIVTKKIQKVLGYTFTHKDLLKQALTHRSASSKHNERLEFLGD
FT                   SILSFVIANALYQHFPYIDEGDMSRMRATLVRGNTLAEIAYEFDLGEYLKLGQGELKSG
FT                   GFRRESILANTVEALIGSIYLDSNIKTVEELILKWYEKRLEKISPGDTQKDPKTRLQEY
FT                   LQSKHLSLPLYFIVEVYGEAHNQLFTIHCKISTISEYLIGTGSSRRKAEQDAAQKALIK
FT                   LGVE"
FT   CDS_pept        complement(283520..284464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="BU259"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12969"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12969"
FT                   /db_xref="GOA:P57347"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57347"
FT                   /protein_id="BAB12969.1"
FT                   /translation="MANILTIFLLISTLVTGIFWSFYCIKSFKNYLINKKIINNNNFHQ
FT                   EKIEKSKNKTYFLKSLASFFPIFLAIFIIRSFIYEPFQIPSGSMMPTLLVGDFILVEKF
FT                   SYGIKEPITHKILIRTKKPNRGDIAVFQHPTDHNINYIKRIIGLPGDKIRYDLHDKHIH
FT                   ICTNYSDQRGCEKKISINYSQSRSSNFIQKIYFSNKNNIKEDKNIYNSLYFDIVEEIIE
FT                   DVKHSILLLNSIKNTKENYFQQKNMPKLTWIVPKGEYFMMGDNRDNSLDSRYWGFVPEK
FT                   NLVGKAIKIWMSFDKNENEWPTGIRINRIGSIH"
FT   CDS_pept        complement(284480..286312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /product="GTP-binding protein lepA"
FT                   /note="BU260"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12970"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12970"
FT                   /db_xref="GOA:P57348"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57348"
FT                   /protein_id="BAB12970.1"
FT                   /translation="MLKCIKHEYGIKNMKSIRNFSIIAHIDHGKSTLSDRLIQLCGGLS
FT                   EREMSNQVLDSMDLEKERGITIKAQSVMIDYKNKSGNIFNLNFIDTPGHVDFSYEVSRS
FT                   LAACEGALLVVDSTQGVEAQTLANCYTAIDMNVEIVPVLNKIDLPNSNADKVAKEIEDI
FT                   IGIPALDAIRCSAKTGEGIEDLIERIINDIPYPKGSINSPLQALIIDSWFDNYLGVVSL
FT                   IRIKNGILFERDKIQVMSTGKNYYVDQIGVFTPKKLNKNQLRCGEVGWIICGIKNIIAA
FT                   PVGDTLTTAKNPAKNMIIGFKKIKPQIYAGLFPLTSDQYEMFRDALGKLSLNDASLFYE
FT                   PENSVALGFGFRCGFLGVLHMEIIQARLEREYSIDLITTIPTVIYEIELINGKIIYLDT
FT                   PSNFPNMNDIKIIKEPIVECSILSPPQFLGSIIKLCIKKRGVQINMVYHSHQVLLKYNI
FT                   PMNEVILNFFDELKSVSSGYASLEYDFKYFQSVKMVRIDILINSEKVDALTILSYHKNA
FT                   QSRSREIVDKMKKLIPRHQFDISIQAVINNSVIARSTIKQLRKNVLSKCYGGDVSRKKK
FT                   LLQKQKDGKKRMKKIGNVNVPKTVFLSILNSRES"
FT   CDS_pept        286436..287614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="BU261"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12971"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12971"
FT                   /db_xref="GOA:P57349"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57349"
FT                   /protein_id="BAB12971.1"
FT                   /translation="MIYNVILNILKNIYKKILKLIPLIMIIKKNKKIIVAMSGGVDSSV
FT                   CAWILKKQNYQVEGLFMKNWEEDDQEGYCSSTKDLLDAENICKKLNIYLHKMNFSSEYW
FT                   EYVFENFLKEYKKGNTPNPDILCNKEIKFNMFLNYSIQELKADYIATGHYARIKKINGK
FT                   YLLLKGIDTNKDQSYFLYTLNSIQLRKILFPIGHLKKNKVRNIAKKIDLKIAKKKDSTG
FT                   ICFIGPKKLKNFLSLYISEKKGDIVTISGRVIGKHSGVFYYTIGQRQGLGIGGIKGEYN
FT                   IPWYVVEKNIEKNILIVAQGSYNKHLMSIGLIAKNINWINYDQLSFPLSCMAKTRYRQK
FT                   DIICKIEYINNHHIKILFDCPVAAVTPGQSVVFYVSDICIGGGIIESRLPLL"
FT   CDS_pept        287650..288285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfC"
FT                   /product="hypothetical protein"
FT                   /note="BU262"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12972"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12972"
FT                   /db_xref="GOA:P57350"
FT                   /db_xref="InterPro:IPR007451"
FT                   /db_xref="InterPro:IPR035932"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57350"
FT                   /protein_id="BAB12972.1"
FT                   /translation="MKKIHLITLSLAGICQSAHLVQQLAYSGKCDSNAFSICLKSILEI
FT                   NPTSFIAIYGNHEKNLIIGLEILLSTLTFSSFSYSYIELIKYISNMMIIEKKLKKSRTA
FT                   IYSLKNKISVISSEYYLNYNIKNLTRKLGELYLEIISSLGSRIVIKGIKDFLQDHQIQE
FT                   KIRCLLFSGIRAIVLWKQYGGNQLQLIYFRYFIIKKAKKILYHLKDAT"
FT   CDS_pept        288324..289694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="BU263"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12973"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12973"
FT                   /db_xref="GOA:P57351"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR013539"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57351"
FT                   /protein_id="BAB12973.1"
FT                   /translation="MELTSLTAISPVDGRYSNLTILLRNIFSEFGFLKYRLNIEVQWLK
FT                   KIISMSQILDINNIEYKEILFLDSIVEEFNEKDAILIKNIEKETNHDIKALEYFLKNKI
FT                   AQSKNLLTISEFVHFGCTSEDINNIAYSLMIKDARDKIILPLWYKIISTLKKMVFKYQH
FT                   YPLLSLTHGQPATPSTMGKEIANFYYRMKRQYIILKKIEILGKINGSTGNYNAHLAAYP
FT                   DINWHKISKDFITSFGINWNPYTTQIEPHDYIAEFFSCMSLFNTILINFNRDMWGYISL
FT                   NYFKQRTIDYEIGSSIMPHKVNPIDFENSEGNLGLSNALMNHMITKLPISRWQRDLSDS
FT                   TVLRNIGVAISYAIIAYNSVLSGINKLEINESELLKNLDKNWSILSEPIQTIMRRYGIK
FT                   NAYEKLKKLTRGKEINRNVIHTFISSLNIPEEEKKRLKNMTPFNYIGAASQIINEIE"
FT   CDS_pept        289718..290383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltE"
FT                   /product="membrane-bound lytic murein transglycosylase E"
FT                   /note="BU264"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12974"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12974"
FT                   /db_xref="GOA:P57352"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57352"
FT                   /protein_id="BAB12974.1"
FT                   /translation="MFQSSIYNKNYKKFLKNLKYQGEYAVTLGILAISILLLTGFNQFL
FT                   NTKPTLKKNYFLNQKSIKNTLKNWNDIIATTANKYKVDEKLIKSIVYVESSGNPYAKSQ
FT                   SNAIGLMQIKPSSAGAEVYRLNGKKGRPSIQELYDPKTNIDIGTSYISFLQKKFISIKN
FT                   KDVMRYAIIVAYVNGTSALLKTFSKSRKEAINIINTMTKKSFCTHIKKNTRQCKHFVI"
FT   CDS_pept        290497..291279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /product="enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /note="BU265"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12975"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12975"
FT                   /db_xref="GOA:P57353"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57353"
FT                   /protein_id="BAB12975.1"
FT                   /translation="MGFLKGKKFLIIGISSVRSIAFGIAKSLYNQKAELGFVCQNEKIR
FT                   KKIKKLVEPMKSCIVLCCDVSNDKNIKKLFIDLGQVWKKFDGLVHAIAYCPKQYFNGDF
FT                   IDNITREGFNISHEISSYSFIGLVKACRTMLNNFSSLLTLSYLGSQRVVPNYNVMGLAK
FT                   ASLEASVRYMASSLGKENIRVNAISSSPIKTISSYKITNFNKIRNCSYASSFLKNSVTS
FT                   ENIGNVASFLLSDLSLGITGSVIYVDNGFNVSSMNNIQ"
FT   CDS_pept        291466..293415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnb"
FT                   /product="exoribonuclease II"
FT                   /EC_number="3.1.13.1"
FT                   /note="BU266"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12976"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12976"
FT                   /db_xref="GOA:P57354"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011804"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57354"
FT                   /protein_id="BAB12976.1"
FT                   /translation="MFQNNPLLTQLKKNLHAKSPRVEGIVKSTERGFGFLEVDPQKSYF
FT                   IPPKNMKNVMHGDKIIALLTTEKDREIVEPEKLIEPFLNRFVGKIEKKDNRLFIVPDYP
FT                   FLKDLITCQPNKNCINIFQNGDWAVAQLKKHKLKGDHLFYAELTEKITQEDDPLIPWWV
FT                   TLARHDLDRKEPLAEDDDLILKESDNRKDLTDLDFITIDNTNTKDIDDALFVSEKNNGD
FT                   ISLIVAIADPTAYIKHGSKLDVIASKRIFTNYLPGFNIPMLPRNLSEDICSLNPNKRRP
FT                   VLACHITVLKNGNISNKIEFFLAWIKSKSKLSYDHVSDWIEKIGSWIPPTKSIANQILI
FT                   LHRLCLLRIKWRKKNAVLFKDSIEYRFHVSEHGKIIDVLIEKRRIAHKIIEESMIVANI
FT                   SAANFLSKNIGFGIYNVHSGFDLVNAENAVSFLRSYNLNFTVKEITTLKGFCNLRRVLN
FT                   IISNNYIDSRIRRFQSFGDFSTIPGPHFALGFSEYATWTSPIRKYSDMINHRLLKSIIK
FT                   KEKSIKPGEDIKIKISEQRRRNRMAERDVLDWLYTIFLQKKKYQNQKFNAEITDISRSG
FT                   IRARLIENGANVFIPGTLIHPIREELNFNQESGKVFINGIMHYKISDLIQVTLSDIRLK
FT                   TRSIIAKPVFEKFK"
FT   CDS_pept        293524..294171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychE"
FT                   /product="hypothetical protein"
FT                   /note="BU267"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12977"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12977"
FT                   /db_xref="GOA:P57355"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57355"
FT                   /protein_id="BAB12977.1"
FT                   /translation="MNISIFDLSIYIKFFIGLCALVNPIGMIPIFTTMTNNQSFLERKK
FT                   TNIVANFSVSLILLISLFFGSNILNIFGISINSFRIAGGILIISIAFSMISGQFIKTIK
FT                   TKKETKEENKIDNISVVPLAMPLIAGPGAISSTIVWSTYYSSWANLFLCSLVIFLFSFV
FT                   CWLCFEAAPYVVQILGNTGINIITRIMGLLLMSLGIEFISTGIGAIFPGLLH"
FT   CDS_pept        294209..294844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /product="lipoate-protein ligase B"
FT                   /note="BU268"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12978"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12978"
FT                   /db_xref="GOA:P57356"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57356"
FT                   /protein_id="BAB12978.1"
FT                   /translation="MKKKIIFLRNLGIEHWLTTFNKMNNFIISRNPCTYDEIWFVEHYP
FT                   IFTQGQSNEQKNLIVSNDIPVVQTNRGGQITYHGPGQQILYFLIDLKRRKMNIRQLINI
FT                   MEQTVIETLNNFSIQAYTKKKMPGVYINEKKICSLGLRIKKGFTLHGLALNVNMNLTPF
FT                   NYIHPCGDKNMKMTQIKDFNSNVKLKDVRFILIKELSKFLEIFIINSN"
FT   CDS_pept        294963..295934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /product="lipoic acid synthetase"
FT                   /note="BU269"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12979"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12979"
FT                   /db_xref="GOA:P57357"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57357"
FT                   /protein_id="BAB12979.1"
FT                   /translation="MKKNKDVLLKNKILKKLNIINIKNLDNIKEKLKKPDWIKIKIPVN
FT                   TSRIYQIKNALRKNNLYSVCEEAHCPNLSECFNNGTATFMILGSICTRNCPFCAVFHGR
FT                   PNPVNVEEPQKLSDTIFDMGINYVVITSVVRDDLYDGGAEHFVNCIKAIKNKNQVKIEI
FT                   LVPDFRGRIELILNIFNKALPDIFNHNIENVPRLFKKIRPGANYQRSLLLLESFKKKYC
FT                   SVLTKSGLMLGLGEKDVEIIQVMKDLYSSGVTLLTVGQYLQPSIHHLPVKRYIPLSEFE
FT                   NIKKEALSIGFTNAFCGPFIRSSYHASFQSHLPIKNNDINNI"
FT   CDS_pept        296039..296749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="BU270"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12980"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12980"
FT                   /db_xref="GOA:P57358"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57358"
FT                   /protein_id="BAB12980.1"
FT                   /translation="MLNPNIFHMPKIIIALDFCNKKSAMKLVNLLNPSIFYLKIGKEMF
FT                   TILGCKFVKELHQLGFNIFLDLKFHDIPNTVFNATKAAADLGIWMLSVHASGGKEMLIS
FT                   AKKALKSFKKAPLLIAVTALTSFKEEALKEIGINISLTEYILKLSKLSNDCGLDGIVCP
FT                   GKEAKKIKFLFGNKYKIITPGIRIAKDLLYDQNNIITPKEAKEYKIDYIVIGRSITMSK
FT                   NPIKKLDLIIKSMQ"
FT   CDS_pept        296797..297381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="BU271"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12981"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12981"
FT                   /db_xref="GOA:P57359"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57359"
FT                   /protein_id="BAB12981.1"
FT                   /translation="MQLIEKAMLPTPWGNFLIFGFEEKKNGKNHVALVYGDIKTNTPTL
FT                   SRVHSECLTGDAFFSLRCDCGSQLEMSMKRISQEGSGVLIYHRQEGRNIGLLNKIKAYA
FT                   LQDRGLDTVQANQKLGFSADERDFSLCADIFNILNIKKIRLLTNNPFKVQMLSDAGINI
FT                   VERVPLIVKKNPKNAYYLKTKAEKMGHLLSE"
FT   CDS_pept        complement(297485..297892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hns"
FT                   /product="DNA-binding protein H-ns"
FT                   /note="BU272"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12982"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12982"
FT                   /db_xref="GOA:P57360"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR027454"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57360"
FT                   /protein_id="BAB12982.1"
FT                   /translation="MNEILKILNNIRTLRVHSRECSLEILEEILEKFKVVINERKKEEK
FT                   KIKEEIAQRAIKLKKYREMLIADGINPNELLTKTNSIKSSEKRKRPKRPAKYKYINKNG
FT                   DFKTWTGQGRTPSVIKNAILERKKILEDFLL"
FT   CDS_pept        complement(298238..299698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /product="cardiolipin synthetase"
FT                   /note="BU273"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12983"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12983"
FT                   /db_xref="GOA:P57361"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="InterPro:IPR030840"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57361"
FT                   /protein_id="BAB12983.1"
FT                   /translation="MDIFYNLIKCLIFSTYWLLIANITFRVLIKRRNIPYSMSWLLTIY
FT                   IIPFIGISIWFFFGELYLGKRQKKIANRIWSISNKWLHELKSCTYIFQIKNSEVATSIF
FT                   QLCKNRQGLHGIKSKKIKLLTNTKKIMQILIRDIYLARKNIEMVFYIWKPGGMADDVAI
FT                   ALIDSAKRGIHCRLMLDSAGSIEFFQSPWVEIMRKSGIQVVEALKVNLLRVFLRRVDVR
FT                   QHRKIILIDNYIAYSGSMNLVDPYLFKKSSEIGQWIDLMTRIEGPIATTMGIIYSCDWE
FT                   IETGLKILPQLPNKKMLENQSNKNASIQVIASGPGFLKNMIHQALLTAIYSAKRELIIT
FT                   TPYLVPSEDLLEAICTAAQRGVEVSIIIPLYNDSILVKWASRVFFSELLEAGVKIFQFQ
FT                   KGLLHSKSILVDQQLSLIGTVNLDMRSLWLNFEITLVIDDSDFGRNLFCIQNKYISDSQ
FT                   LIDKKAWSMRAYWKRILEKIFYFLSPLL"
FT   CDS_pept        complement(300079..300486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciA"
FT                   /product="hypothetical protein"
FT                   /note="BU274"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12984"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12984"
FT                   /db_xref="GOA:P57362"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57362"
FT                   /protein_id="BAB12984.1"
FT                   /translation="MSEKNKLPKGIIVLKTLSMPENINANGDIFGGWIMSQMDLGGAIL
FT                   AKEISGGKVATVRVDSINFLKSVSVGDIVNCYANCIKIGKSSIKINVEIWIKKIYSKPL
FT                   GQYYCAAEAIFIYVAINKTGQPRELLPMSII"
FT   CDS_pept        complement(300523..301056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciB"
FT                   /product="hypothetical protein"
FT                   /note="BU275"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12985"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12985"
FT                   /db_xref="GOA:P57363"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57363"
FT                   /protein_id="BAB12985.1"
FT                   /translation="MKQILNILPMFIFFIFYKFYDIFIASGSLIVISGLICIIHWIFYN
FT                   EIDKISLFSFLSVFFFGSLTIFFHNSQFIKWKITIIYIIFSLVLLISQFFTRKPMIQRF
FT                   LEKDIKISNIYWRKINFIWSLFFLFCAILNIYIAYYFSETIWVNFKVFGFTSLTFFLIL
FT                   ITSIYINCKISKNK"
FT   CDS_pept        complement(301084..301827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciC"
FT                   /product="hypothetical protein"
FT                   /note="BU276"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12986"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12986"
FT                   /db_xref="GOA:P57364"
FT                   /db_xref="InterPro:IPR009627"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57364"
FT                   /protein_id="BAB12986.1"
FT                   /translation="MPITVNKLRHDTHHFFYKKIGAIFFISIFATFMNILIDMFIKPDM
FT                   HIVSIMENNKFINTSSLLEFIQNMNLNEKHELLKYSILKIMESLISKTTLLGSIIILIS
FT                   VVSEPKKKSIVSSIRTFFLFFPSLFILNFLTTFIIQIGFMLLIIPGILLSIILSLSPII
FT                   LFFKKNRLLDSIRLSMYISWKYIKIIGPGVLFWMCGKFILTMLLAHFSLINKNVLFLIS
FT                   NISMNILFSILIIYLFRFYMIFLRS"
FT   CDS_pept        complement(301932..302741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /product="tryptophan synthase alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="BU277"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12987"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12987"
FT                   /db_xref="GOA:P57365"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57365"
FT                   /protein_id="BAB12987.1"
FT                   /translation="MNRYQETFKRLSCLKEGCFIPFVVLGDPSLETSIKIIETLIKSGA
FT                   DALEIGIPFSDPLADGPTVQKSNLRALSKNNTFFEYFKILKQLRKKNKKLPIGILIYAN
FT                   LVYNQGIDNFYFQCFNSGLDSVLIADVPIEESKIFYNIANKYKINPIFICPPDADADFL
FT                   YKISLYAQGFIYVLSRPGVTGIKNNTIALPRDFINKIKKYNSVPLLQGFGISNPKQIKE
FT                   AISSGLSGVICGSAIINIIEKYLNQEKKMIKEIKKFTHLLKLSTKLE"
FT   CDS_pept        complement(302760..303926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /product="tryptophan synthase beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="BU278"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12988"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12988"
FT                   /db_xref="GOA:Q44685"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44685"
FT                   /protein_id="BAB12988.1"
FT                   /translation="MTLLNPYFGEFGGMYVPQILMPALFELEKNFVSAQKDAEFQKKFF
FT                   YLLQNYAGRPTPLTLCKNLTKGTKTKIYLKREDLLHGGAHKTNQVLGQAMLAIRMKKKE
FT                   IIAETGAGQHGVASAIACALFNLKCRIYMGIKDIKRQNTNVFRMKLMGAEVISVKNGSG
FT                   TLKDACNEALRDWSSSYKKSHYMIGTAAGPHPYPTIVREFQKMIGEETKKQILEKENKL
FT                   PDSIIACIGGGSNAIGIFSDFINDKVNLIGVEPAGYGIHTGKHGAPLKHGRTGIYFGMK
FT                   SHLMQNKQGQIQESWSISAGLDFPSVGPEHAWLNSINRAKYVSITDEEAISAFQVLSRK
FT                   EGIIPALESSHALAYALKLMKKDPTIEQILIANLSVVEIKIFLQYMMF"
FT   CDS_pept        complement(303964..305325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /product="indole-3-glycerol phosphate synthase /
FT                   N-(5'-phospho-ribosyl)anthranilate isomerase"
FT                   /EC_number="4.1.1.48"
FT                   /EC_number="5.3.1.24"
FT                   /note="BU279"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12989"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12989"
FT                   /db_xref="GOA:P57366"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57366"
FT                   /protein_id="BAB12989.1"
FT                   /translation="MQDTTLKKIIQDKSEWIRLRKEKQPLIDFKDKINKKTRDFYHSLK
FT                   EKKPCFILEYKKKSPSLGIIRNNFNLIEISNVYKKYASSVSVLTDEKYFHGNLNFINIV
FT                   RECVSQPVLCKDFFIDPYQVYLSRYYNADAILLMLSVLNDIQYKELSIIAKKLNMGILT
FT                   EVNNIEELKRALKLNANIIGINNRNLHDLSIDLNRTRTLSSLIKKDTIIISESGIKKYR
FT                   EIKELSKFVNGFLIGSHLMSQTNLETAVRSIIFGDNKVCGLTRSIDIEVSEKYGAIYGG
FT                   LIFVKNSPRYITKKTAKNISINRKLKLIGIFQNENINIIVDIAEELSLYGVQLHGQENK
FT                   QYIDKLRNILPKKINIWKAFSIQSELPDRNWDNVNMYIFDSDSGGSNTSFNWSILNHHI
FT                   LDNVILAGGINLKNCITASKLKCSGLDLNSGVEISPGIKDYKKIKSIFQKLRYG"
FT   CDS_pept        complement(305306..306334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="BU280"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12990"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12990"
FT                   /db_xref="GOA:P57367"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57367"
FT                   /protein_id="BAB12990.1"
FT                   /translation="MRNILLKIYDSKFLNQEESYQLFTLISSGKITDIKLASILTAMKI
FT                   RGESIEEITGAIKAFLDKMKYFPKPDYIFSDIVGTGGDAKNTINISTMSAFVAATCGLK
FT                   IIKHCNQRISSKSGSSDILEKFNINLNASPEKSRKTLDQLNICFLFAPKYHDGFKYSNN
FT                   VRTDLKTKTIFNFLGPFLNPATPPLSVIGVYNKNLINIAVNILKNLQYKRAIVLHSDNT
FT                   DEVTLYGTTYVSELLNKKIISYQLQPESFGLKMHPKKILKINSLEENYHIIKEIMKGKG
FT                   SKLYEELIAVNVAMLLKVFGYENLKENTKLALNKIRSGDVYKHIRNVANMLKEDNHARH
FT                   NT"
FT   CDS_pept        306569..307492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yedA"
FT                   /product="hypothetical protein"
FT                   /note="BU281"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12991"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12991"
FT                   /db_xref="GOA:P57368"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57368"
FT                   /protein_id="BAB12991.1"
FT                   /translation="MNKILVIILFSLVSLTWGTTWIAMKIATETIPPFFATGMRFLVAS
FT                   PILIILAYFTKTPLLFPYGQRWFQLIISIFYFSIPFALMLYGGMYVSSSVASIIFSSMP
FT                   VAVLTVSFLYLKKKLFLTQKIGMFISLITLLTILLIELESQCFFQWKGILALLFALFSH
FT                   AFIYSECQKKCLNVSVITFNALPSLLSGILLSTTSWFIESPHINTFSNRSILAIFYLGD
FT                   FSGIFGILSYFYLQQKVSAFYASTVFLIFPVIAGFLENYIYKNAILLCEIWFIFPLIIG
FT                   ILLTLIPVNYLKKIRNKITRLSCLLF"
FT   CDS_pept        307521..308273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciL"
FT                   /product="hypothetical protein"
FT                   /note="BU282"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12992"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12992"
FT                   /db_xref="GOA:P57369"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57369"
FT                   /protein_id="BAB12992.1"
FT                   /translation="MSEKIQKILSHLGYGSRRNIENMIKFGDISINGKKIVIGQRLNNK
FT                   NIEVITIKGETVSIKKTDFKTKIIIYNKPEGEICTRNDYKKRPIVFDKLPLLNIHRWIS
FT                   IGRLDINTRGLLLFTNNGNLANELMHPSNKIEREYYIRVFGKINKNTMNILKNGVKIKD
FT                   GNAAFKSIQTIDHACSKKNKWFKGVLCEGRNREIRSMWQAVQCQVSRLIRIRYGNIFLP
FT                   KNLKLGDWSELSSESVNNLSNLVSLKDS"
FT   CDS_pept        308270..309358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sohB"
FT                   /product="possible protease sohB"
FT                   /note="BU283"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12993"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12993"
FT                   /db_xref="GOA:P57370"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR013703"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57370"
FT                   /protein_id="BAB12993.1"
FT                   /translation="MKSFYIKNYFFILKNICSIFFKKVYCVNLLLNYELFLAKIITFII
FT                   ISISILILFYTIIKRKKNIQSKIKITLLQDNYKNVKNKILLSTMKNVEKKIWFKKQKEK
FT                   NKKELLLKNNKKKLFVLDFKGDVYANEVVGLREEISAILLVANKHDEVLLRLESSGGVI
FT                   HGYGLAASQLNRLRQKGIRLIVSVDKIAASGGYMMACVADYIVSAPFAIIGSIGVVGQI
FT                   PNFNKLLKKCNIDFELHTAGDYKRTLTMFGNNTESTRKKFCDELNTTHKLFKSFIKEMR
FT                   PSLDIEDVSNGEHWFGTIALEKKLVDQIGTSDDILISKMEEYTLLRIQYIYRKKILERF
FT                   TASVTHNLSETLLKIFFYKNYL"
FT   CDS_pept        309445..312030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="BU284"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12994"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12994"
FT                   /db_xref="GOA:P57371"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013263"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57371"
FT                   /protein_id="BAB12994.1"
FT                   /translation="MQKSLVIVESPAKAKTINQYLGSEYIVKSSIGHIRDLTKGKLYNK
FT                   EKNKKFLNENFIEKTNENKILIKQMGIDPYQNWKFEYHILPGKEKIISELKYIANQVKH
FT                   IYLATDLDREGEAIAWHLKEVIGGDSSKFSRVVFNEITQHSIQKAFKNVGHINMNRVHA
FT                   QQARRFMDRIVGYMISPLLWKKIARGLSAGRVQSVAVRIIADRESIIKNFVPEEYWKLD
FT                   VSLISQDKKKINMDVTHYNNKKFRPINENEVSFAVEKIQKSSCIVKNYEEKISYLKAPA
FT                   PFITSTLQQSASLRLGFSVKKTMFLAQKLYEEGYITYMRTDSNYLSEYAIKKVRKYIKS
FT                   NYGSNYLPKEPNIYSNEKHSQEAHEAIRPSDIKIKNIDSDHLNSSAKKLYELIWNQFLA
FT                   SQMKSVKYKSITVTVLADMFKLQKSERIVMFQGWNKVLIEEKNVFSQFPILQTGSQLFI
FT                   NKVTPSQKFTKPPPRFSEASLVRELEKKGIGRPSTYSAITSKIQDRGYVKIKKNKFYAE
FT                   KMGEILTIRLKKSFSNLIDYNFTAHMEKKLDQVAENKVTWRYLLDDFFKKFSEQLEQAK
FT                   KSPEEGGMELNNIVPTSLNCPICCKKMGIKTAITGVFLSCLGYNNTDNKKRCKKTINLI
FT                   TLNDFNKEQDNQKKISLQLIQKCDICNMYMDSYFINEKLKLHICANNPSCSGYKFEKGV
FT                   FKSPIYLSKTIQCEKCYNNMKLKIGPFGKFFTCINKICKNTRKILPNGEISDPKLEPIP
FT                   FPELLCKQSDAWFVLREGISGIFFAANTFPKSRETRSPFVEELVRFQHLLPEKIYYLSS
FT                   APVIDNYGNKTIVCFDKKKKTHYIASKKDGKFTGWSAVFIDQKWCVINK"
FT   CDS_pept        complement(312083..312883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /product="extragenic suppressor protein suhB"
FT                   /note="BU285"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12995"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12995"
FT                   /db_xref="GOA:P57372"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57372"
FT                   /protein_id="BAB12995.1"
FT                   /translation="MHPMLNIAIRAVRKGGNFIIQNYERRKFVKEDVEKNKVFLNNIIY
FT                   KTNKIISEIIHKSYPYHTILKKHENILVKKNEKNTVWIITELDGKTNFLKYFPYFCVSI
FT                   AVVVKNKTEISVIYDPIKNDLFTAVKGQGSQLNGYRTRCSAINTLNYSTVAVNPSNKIH
FT                   NLTSSYFEIYKKLIISGISFRCTGSSILDSAYVAAGKIDCLFDFNLDPNKFVASKLQVR
FT                   EAGCLINNFMGEYEHNNNNYSGNITSSSKFIRLINEKIRECYLI"
FT   CDS_pept        313130..314221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfgB"
FT                   /product="hypothetical protein"
FT                   /note="BU286"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12996"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12996"
FT                   /db_xref="GOA:P57373"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57373"
FT                   /protein_id="BAB12996.1"
FT                   /translation="MNNHIDIFNIPISKINLLDLNRQNLKYFLISLGAKNFCTEQVMSW
FT                   IYNYYCDDFNKMLNISIKTRKKLYEKSYIFASEFIEEKISYDGTIKWITDINNQKIETV
FT                   YMPEKKRSTLCVSSQIGCSLKCHFCATGQEGFQRNLKVSEIIAQIWQANKRLKEKNIKK
FT                   NITNIVFMGMGEPLLNLKNVVSALTIILDEYGFGLSKRRVTLSTSGIVPALDKLRNMID
FT                   VSLAISLHAPNDFIRNIIMPINRKYNISSVLSSALKYFKYSNANRGGITIEYVMLDRIN
FT                   DSNENARQLSVLLSKIPSKINLIPWNSFSGPSFLCSNTDRINMFANILRKKGFTTTIRK
FT                   NRGEDINAACGQLTGIITNYFKK"
FT   CDS_pept        314272..315378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcpE"
FT                   /product="gcpE protein"
FT                   /note="BU287"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12997"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12997"
FT                   /db_xref="GOA:P57374"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57374"
FT                   /protein_id="BAB12997.1"
FT                   /translation="MNNKCKIINRRKSDRIYVGKVAIGNNAPISVQSMTNTRTTNISET
FT                   INQILELQKVGVDIVRISIPNLKAAESFKEIKKQTNVPLIADIHFDYRLALQAIKYGAD
FT                   CLRINPGNIGNKRRVSEIISYAKDENIPIRIGVNAGSLEKDILKKYKIPTPDALVESAM
FT                   RHIEYFDALNFNQFKVSVKASDVFLAIESYRMLGKKITQPLHIGITESGGLRNGTVKSS
FT                   IGIALLLLEGIGDTIRVSLAAHPTEEVKVGYDILKVLSLRARGINFIACPTCSRQEFDV
FT                   INTVNQLEKNLEDISTPIDVSIIGCVVNGIGESKIATLGLAGSHKKSAFYEDGVRQKEK
FT                   IKNEEIIEKMEIKIRKKIDKLNNSKKNN"
FT   CDS_pept        315404..316675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="BU288"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12998"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12998"
FT                   /db_xref="GOA:P57375"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57375"
FT                   /protein_id="BAB12998.1"
FT                   /translation="MNKEIKSIRGMYDYFPKDLKIWNYIEIIFKEVLNSYCYLEIRLPI
FT                   LEKTEIFKRAIGNVTDVVEKEMYSFNDRKGNNLTLRPEGTVGCVRAIIQNNLLQKSNKF
FT                   WYLGPMFRYERPQKGRYRQFYQLGAEVFGLDTEDIDLEIIILTNRLWKRIGIDSFITLE
FT                   VNSIGSKIDRVQYKKELVNFLKKREYLLDEDCKRRLYTNPLRILDSKNQDIQNLLKEAP
FT                   LLSEYISFSENNHFKNLCNMMNHHGIKYKCNPHLVRGLDYYNSTVFEWKSNKLGAQNTI
FT                   CAGGRYDSLVQEMGGRKTPAIGFAIGIERLVLLVKSLKIFSEVIEESNVYIIFIGDNNK
FT                   CHAINLSEEIRDLYPKLRIFINFLHQNLTKKIKNAISSLARIIILIGDNEIKKGFFLVK
FT                   DLKEKKEYHLLKKELILKIQEIFK"
FT   CDS_pept        316735..317988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="BU289"
FT                   /db_xref="EnsemblGenomes-Gn:BAB12999"
FT                   /db_xref="EnsemblGenomes-Tr:BAB12999"
FT                   /db_xref="GOA:P57376"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57376"
FT                   /protein_id="BAB12999.1"
FT                   /translation="MLNNKIDFSKYDPKLWFAIEQEKKRQENHIELIASENYTSNYVMD
FT                   VQGSQLTNKYAEGYPGKRYYGGCEYVDIIEELAIERAKKLFNADYANVQPHSGSQANFS
FT                   VYTALLNPGDTILGMKLSHGGHLTHGSSVNFSGKMYNVISYGVDENGEINYEELLRLTK
FT                   KYKPKMIIGGFSAYSGICNWKKMRFIADNADAYFVVDMAHVAGLVAAGIYPNPINYAHV
FT                   VTSTTHKTLAGPRGGLILAKNGDDILYKKLNLSVFPGAQGGPLMHVIAAKAIAFKEALE
FT                   PKFKTYQKQIVKNSKVMVERFLEKGYKIISGHTFNHLFLIDLTNKKITGKDADIILSKA
FT                   NITVNKNTIPNDLKSPFITSGIRIGTAAVTRRGFKENEVSRISDWITSILNNVDDHNNV
FT                   LQIKKKVLEMCLKYPVYI"
FT   CDS_pept        complement(318076..318750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /product="dethiobiotin synthetase"
FT                   /EC_number="6.3.3.3"
FT                   /note="BU290"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13000"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13000"
FT                   /db_xref="GOA:P57377"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57377"
FT                   /protein_id="BAB13000.1"
FT                   /translation="MIKKFFITGTDTNVGKTIVSSILLKKATMSGYQTAGYKPVSSGGQ
FT                   KKSSGFFNQDAILLKKSSSIILSDREVNPIAFFENAPPHILSKFQKRSIKKEELSLGLN
FT                   NITKKSNWILVEGAGGWYTPLSCKDTFSSWVKQEKLTVIIIIAIKLGCINHAILTEKAI
FT                   ISDQIKCGGWIANNIFPKDKYNMHYIQTLLNYIKSPFLGVVPYFKNKNRINFKKIKIKL
FT                   PK"
FT   CDS_pept        complement(319115..320146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /product="biotin synthetase"
FT                   /EC_number="2.8.1.6"
FT                   /note="BU291"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13001"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13001"
FT                   /db_xref="GOA:P57378"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57378"
FT                   /protein_id="BAB13001.1"
FT                   /translation="MKKKWTLEETKMLFKKPFFNLMFQAQEEHRKNFDPNTIQISTLLS
FT                   IKTGSCPEDCKYCPQSSRYKTGLKKEPLLEIEQILSAAKKAKDSGSSRFCMGAAWKNPK
FT                   EKDMPYLEEIIKKIKEMGMETCMTLGTLNSTQAKKLADAGLDFYNHNLDTSKNFYNNII
FT                   TTRTYQERLHTLHAVRSSGMKVCSGGIIGLGEKKQDRIELLMELSNLSIQPESVPINML
FT                   VKIPGTPMADNKDVEPFDFIRIIAVARIMMPKSYIRLSAGRHKMNDQTQAMCFMAGANS
FT                   IFYGCKLLTSDNPEEKHDLELFKKLDLIPENKTQTLLKEDEYKTIIKSSKIKKDQYYNA
FT                   AII"
FT   CDS_pept        320225..321511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.62"
FT                   /note="BU292"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13002"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13002"
FT                   /db_xref="GOA:P57379"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57379"
FT                   /protein_id="BAB13002.1"
FT                   /translation="MSQSDTIFDYKHIWHPYSSMNNPHPCYTVISAKGVYLKLKNRKYM
FT                   IDGMSSWWAAIHGYNHPVLNKALKKQIRKMSHVMFGGITHPPAISLCRKLISLTPEKLD
FT                   CVFLSDSGSVAIEVAIKMLIQYWQALGQKRKLFLTIRNGYHGDTFSAMSVSDPKNSFHQ
FT                   IYHNLLPKHLFADAPVSSFYKNWDNEDILSFKKIIEKNSFKIAGVILEPIVQGVGGMNF
FT                   YHPMYLKQIKILCNHYSIPVIFDEIATGFGRTGKMFAFEHANVVPDILCLGKSITGGTI
FT                   TLAATLTSRHIADTISKGKVGCFMHGPTYMGNPLACAVANANIKILKTNQWKIQVLNIE
FT                   KQLFKSLMPLINHPYVTDVRVLGAIGVVECSRSINMISIQKFFVENGVWIRPFKKLIYI
FT                   VPPYIISPHTLKKLTNVISNALNKTELFI"
FT   CDS_pept        complement(321520..322524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhE"
FT                   /product="hypothetical protein"
FT                   /note="BU293"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13003"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13003"
FT                   /db_xref="GOA:P57380"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="InterPro:IPR022528"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57380"
FT                   /protein_id="BAB13003.1"
FT                   /translation="MKQVVYIANSESKNIEVWNLCKSGKMNLIQKIETDGKIQPINIIQ
FT                   KRNLLYAGIFPDNKIITYSINHNGFLEKKNESNIPGKANYISFDKKKEFLFCSSYHSNF
FT                   ISVSPLNKFGIPQNPIQIIYNIEGCHAAKMNYKYNILFVISLKEDCIYLYYLTDFGILK
FT                   STEQNILHTQKKSGPRHIIFHPNQDFIYTINELNGTIDVWKIYKKNNVIKVKNIQNIHV
FT                   LKNRFLKDYWCSDIHITSCGRFLYACDRFFNIISLFHINQNDNKLVFFKSYDTEEQPRS
FT                   FNINSHNTHLIVAGEKSNTFIIYSISNSTGELKKINVYSTGQRPVWILIHALC"
FT   CDS_pept        complement(322648..325086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /product="transcription-repair coupling factor"
FT                   /note="BU294"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13004"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13004"
FT                   /db_xref="GOA:P57381"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57381"
FT                   /protein_id="BAB13004.1"
FT                   /translation="MKITKNKILKNKKIINFKYQKLLDLFYNVNNQKKNNQLLSYLYSF
FT                   SGKIIFSLTEEKSLKKILRFLMRHKIHPQYIKRIIDIKKEIDYFYMIEEIKNGFIDKKN
FT                   NILFLCTKDLLPILIDDKYIGNIKKNTNNINKFNLSQLILNHPVMHIEHGIGRYKGLTT
FT                   IETASIQSEYLVISYAEGDKLYVPVSNLHLVSPYTGTSIENAPLHKLGGDDWNKEKHKI
FT                   SKTVYDHAAQLLHIYAKRESKTGFAFKKNIEKYDLFCNDCSFKTTSDQNEVMKFVLKDM
FT                   SKPIPMDRLICGDVGFGKTEIAMRASFLAVSNKKQVAILVPTTLLAQQHYKNFKIRFSN
FT                   WPVNINILSRFQTQKEQDLIFKHTKNGRINIIIGTHKLLFKNIEWCSLGLLIIDEEHRF
FT                   GVSHKEIIKKIYSNIDILTLTATPIPRTLNMAMTGIKDLSIIAKPPAQRLAIKTFIQEY
FT                   SPILIRKTILREISRGGQVYYIYNKVQNIMNIAERLSILIPEASIKIGHGQMKNIDLKK
FT                   VMNEFYNNKFNVLICTTIIESGVDIARANTIIIENSDHFGLSQLHQLRGRIGRSNNQAY
FT                   ALLLVNNFNKITSDAKKRLEAISSVDNFGGGFSLSNQDLEIRGVGEILGKEQSGHIKNI
FT                   GFSLYMDLLKNAIDLLKNGKIFSVEKSLKKPLEIDLHVSSLLPSSYILDINTRLFFYKK
FT                   LANAIHEKQIEEIKYELIDQFGKLPDFSKNLILIAKIRLIADKIGIKYIKSNNNIGIIE
FT                   FNDYGSINTEYLLKMFQKEPKIWKMETSTRIKFILHLKNDYLRLKWIINLLRNLFKKNI
FT                   "
FT   CDS_pept        325561..326760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfU"
FT                   /product="hypothetical protein"
FT                   /note="BU295"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13005"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13005"
FT                   /db_xref="GOA:P57382"
FT                   /db_xref="InterPro:IPR011925"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57382"
FT                   /protein_id="BAB13005.1"
FT                   /translation="MYKPISLFIALRYLWNTHLPNFKKIITILSIIGISITTASLIIIT
FT                   SIINGSEKNFEKNILSFIPHLIITNKNQCIKKDQFPENILKLNNIKNISDLISKEIIVQ
FT                   SKNDISMAEVIGIDHTNYYNIHNYNIKSVLKTLKPGYYNIIIGKQLARKLNVFIGDRLK
FT                   LIFLSNTKNFFSGEIFKQRTFKIINFFSTKKEVDYYQILMNKEDSLNFLNYSKDYVTGW
FT                   RVWLKNPLSLNVNEIKKITHPLFLLDWTTQKGELFKAMKIEKYIMFLFLFLVLLVSILN
FT                   IVVILTICTVEKQNAVAILQTQGLLNCKIMLIFIIFGSSTAIIGNILGTLISLTLIIQN
FT                   DFLKFFINIFIDETNIPIIVIPYQIFFINITITLFTILSTLYPSWKAIQLKPSRILSNE
FT                   "
FT   CDS_pept        326753..327439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfV"
FT                   /product="hypothetical ABC transporter ATP-binding protein
FT                   ycfv"
FT                   /note="BU296"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13006"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13006"
FT                   /db_xref="GOA:P57383"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011924"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57383"
FT                   /protein_id="BAB13006.1"
FT                   /translation="MNNIIIKCINLNKSYKDGDFTYTILKNISFQLNKGDIAGIIGKSG
FT                   SGKTTFLHLLAGLENPTSGDILFNGRLFSSMSSNKMSKFRNIELGFIYQFHHLMLDFNI
FT                   LENVSMPLLISNKSKKDSEEIAYNMLKKFNLEDKIKKYPSELSGGERQRVAVARAFINK
FT                   PSLIIADEPTGNLDEDNTNIIFNLITELNSDYNTSFIIATHDPTLIKKIPVLFKIENNQ
FT                   IFNYES"
FT   misc_feature    327457..328694
FT                   /gene="ycfW"
FT                   /note="authentic frameshift; This 423 aa putative ORF is 32
FT                   pct identical to 414 residues of 423 aa protein YCFW_ECOLI
FT                   SW:P75958"
FT   CDS_pept        328764..329774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapA"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase A"
FT                   /EC_number="1.2.1.12"
FT                   /note="BU298"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13007"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13007"
FT                   /db_xref="GOA:P57384"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57384"
FT                   /protein_id="BAB13007.1"
FT                   /translation="MVKNMTIKVGINGFGRIGRVLFRLAQKRSDIEIIAINDLLAPEYI
FT                   AYMLKYDSTHGVFKKHITFDKDNIIINGKNIRVTSIKDPEKLMWHDLSIDVVIESTGLF
FT                   LKREQAYKHILAGSKKVVVTGPSKDDIPMFVRGANFHKYQGESIVSNASCTTNCLAPLS
FT                   KVIDDNFGIIEGLMTTVHASTATQKIVDGASDKDWRGGRGALQNIIPSSTGAAIAVGKV
FT                   LPNLNGKLTGMAFRVPVSNVSVVDLTVRYKKSATYSEICQKIQQASQKEMKGIMGYTED
FT                   EVVSTDFNGEELTSIFDAKAGLSLNKNFVKLIAWYDNETGYSSKVLDLVSLVSKK"
FT   CDS_pept        complement(330105..330620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fldA"
FT                   /product="flavodoxin 1"
FT                   /note="BU299"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13008"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13008"
FT                   /db_xref="GOA:P57385"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57385"
FT                   /protein_id="BAB13008.1"
FT                   /translation="MKKIGIFFGSDTGNTEKIAKLIQKYIGDNVSCLYDISNTSQKDIE
FT                   DFNFLIFGVPTWYYGEVQCDWDDFLPTLKKINFSNKIVALFGCGDQEDYSEYFCDAIGT
FT                   IYDILKKNKANIIGKWSTEDYYFEQSKALLNKKYFYGLILDEDRQANKTEYRIKQWVKQ
FT                   IIPYFNTH"
FT   CDS_pept        330827..332278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB"
FT                   /product="deoxyribodipyrimidine photolyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="BU300"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13009"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13009"
FT                   /db_xref="GOA:P57386"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57386"
FT                   /protein_id="BAB13009.1"
FT                   /translation="MQKNLIWFRNDLRVYDNTALHQACQNDTDKVISLFISTPKQWHNQ
FT                   SVSKKKISFMYYHLISLQKELLKLNIILYYHESTDFLNSIEYLIFFCKKHKVNNLFYNY
FT                   EYAINERYRDYLVKKKLSQKGFLVKGFHDNLLFSNRQIRNQKNETYKVFTFFKKKVIQN
FT                   LHNNIPQCFPVPSKRKSDRDIFLTSISLKNVNLNFNKNFFPVGEKEAINRLKNFCIYKF
FT                   NDYFLKRDYPFLDATSMLSPYLSAGIISSRYCLKVLLKTKNSLPLNVLLTSPWFDQILW
FT                   REFYYHLLIGFPKISRSESLVTWEKEIHWINNIKHFNAWKEGNTGFPIIDAGMRQLNEL
FT                   GWMHNRLRMITSSFLVKNLLINWREGEEHFISNLIDGDLALNNGGWQWSASVGCDSVPY
FT                   IRIFNPLHQSKTFDESGNFIKKFIPELKNVPNHHIHQPHEWSKQKNFKIDYPNPIINYS
FT                   ESRKTSLSLFKQARLKLHKNGLKNS"
FT   CDS_pept        332275..333018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgI"
FT                   /product="hypothetical protein"
FT                   /note="BU301"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13010"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13010"
FT                   /db_xref="GOA:P57387"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57387"
FT                   /protein_id="BAB13010.1"
FT                   /translation="MNNFLLEDIINKKLLSNQYQDTVPNGLQIEGTEIVKKIITGVTAC
FT                   QALLDKALFYNADTLIVHHGYFWKNESKYIHNMQRQRLKTILSHNINLYSWHLPLDVHP
FT                   KLGNNAQIAKKLNIDIQGSILPYVLWGTTKNKMTGFEFANKIERKFKKYPIHLYENAPL
FT                   YISRVAWCSGRGQGFIKKACAFGIDAFLTGEISEETTHIAKELGIHFFSLGHHATEKDG
FT                   VKSLGEWLQRKYDLCVDFIDIYNPA"
FT   CDS_pept        333143..335872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /product="2-oxoglutarate dehydrogenase e1 component"
FT                   /EC_number="1.2.4.2"
FT                   /note="BU302"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13011"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13011"
FT                   /db_xref="GOA:P57388"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57388"
FT                   /protein_id="BAB13011.1"
FT                   /translation="MDKNKIEYWLNSSWLSRENQNYIETIYKSFLTNAQSIDDMWHKAF
FT                   LEFSEEQKNTYERNNTKNNKYLLIKKIDHMIHAFRSEGYQQSLIDPLKLKKRTKIHDLD
FT                   LSFYNFTEEETRQTVEINFKNCTNFRTNIISLYKILYKKYCGSIGFEYMYVNNLLEKQW
FT                   ITNHIESFFNENVFTIEEKINFLKELTYAETLEKYIGKKFPGAKRFSLEGAETLIPVLH
FT                   EVIRFSKKNNISKIVLGMAHRGRLNVLINVLNKSPKVLFDEFSNLNLFQKISGDVKYHM
FT                   GGTAEIQYEKKIIFHMACNPSHLEIINPVVSGISRSYIDNMKNIDNEVLPISIHGDASV
FT                   IGQGVVQETLNMSQTEGYKVGGTVHIIINNQIGFTTSNPKHLRSSEYCTDVAKIIQAPV
FT                   FHVNADDLEASIFAIQLALHFRKIFKKDVFIDLVCYRRNGHNEVDEPSVTQPIMYQKIK
FT                   NHPTSRTIYSDVLISKKIITSEKNQEIMNQYLSKLQKGHYIFSKSKNIHFKNEFFLEEK
FT                   KIKKIKKDVNFSDLKNLACLINQIPDSVKMHQRVKKIYEERLEMAQRLKLFDWGAAETL
FT                   AYATILNEGISCRISGEDVSRGTFFHRHAFIHNQINGSIYIPLNNISKKQGKFQIWDSV
FT                   LSEEAVLAFEYGYSLSSPNTLTIWEAQFGDFINGAQIVIDQFISSGEQKWNKKSNLVVL
FT                   LPHGYEGQGPEHSSSRIERFLQLCAEENMQICIPTTSSQIFHIFRKQIFDKILKPLIIF
FT                   TPKSLLRNPMASSSFDDLVYGKFQKILDEVDNVNKKEIRLIFCSGKIYYDLLRNRREKK
FT                   INSIILIRIEQLYPFPEGEILKILKNYFYIKDFIWCQEEPYNQGAWFYIKDCLSNILPL
FT                   DASLKYIGRSSSASPAVGYISIHKKQQEKIIYNALNIN"
FT   CDS_pept        335888..337150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /product="dihydrolipoamide succinyltransferase component
FT                   (E2) of 2-oxoglutarate dehydrogenase complex"
FT                   /EC_number="2.3.1.61"
FT                   /note="BU303"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13012"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13012"
FT                   /db_xref="GOA:P57389"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57389"
FT                   /protein_id="BAB13012.1"
FT                   /translation="MKKINILVPDLPESISDATVVKWHKKIGDTVHCDDNIVDIETDKV
FT                   MLEVSSPCDGILQSILEKEGKVVISQQTLGEINKSTVVDNHLSNNHIIEKEDNLLKKEE
FT                   KYITTEEKKEIEYLLKDNHKHLTPSMRRSVKIHNINNGFLNQVIETSKKTNFENIIKEE
FT                   KKESNQILFNHNIFNANENNKNNNNKVTNRVKMTRLRQRIAERLLDSKNNTAMLTTFHE
FT                   VNMKPIILLRKKYGEDFEKKHNVRIGFMSFFVKAVIQALKNFPEINAYIDQTDIVFYKN
FT                   FDISIAISTPRGLITPVIRNADTMTMAEIEKKIKDFSIKGLQNKINIKELMGGNFTITN
FT                   GGVFGSLMSTPIINPPQTAILGMHVIQERPVVVNGQIKILPMMYLALSYDHRLIDGKES
FT                   VGFLINIKNILEDFNRIAIDV"
FT   CDS_pept        337248..337943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmA"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="BU304"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13013"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13013"
FT                   /db_xref="GOA:P57390"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57390"
FT                   /protein_id="BAB13013.1"
FT                   /translation="MKINQVVLIRHGQSEWNTLNKFTGWHDAELDKKGKDEAKFAAILL
FT                   KKEKFFFDCAHTSLLKRAIHTLQYILDELNQTWLSVKKSWRLNERHYGALEGLNKDEVI
FT                   EKYGQKQVLLWRRSFDISPPQINIKDKRFPGNDPRYSHLNIHDIPLGESLEKTAKRVIP
FT                   YWNKIVYPELKNNKKILIVAHGNSLRALIQHLYKIDNKAILDLNIPTAQPIILDFDNEK
FT                   NPIKWHYLT"
FT   CDS_pept        338127..339089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /product="6-phosphofructokinase isozyme I"
FT                   /EC_number="2.7.1.11"
FT                   /note="BU305"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13014"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13014"
FT                   /db_xref="GOA:P57391"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57391"
FT                   /protein_id="BAB13014.1"
FT                   /translation="MIKKIGVLTSGGDAPGMNAAIRGVVRTALSERLEVFGIYDGYLGL
FT                   YENRMVQLDRYSVSDMINRGGTFLGSARFASFYQDKIRSIAVQNIKKRKIDALVVIGGD
FT                   GSYIGAQKLTEMGIPCISIPGTIDNDVSGTDYTIGYFTALQTVVEAIDRLRDTSSSHQR
FT                   ISIVEVMGRHCGDLTLAAAIAGGCEFIVLPEIDYKKEDLVIEIQAGIAKGKKHAIVAIT
FT                   EYICDVEELAQYIEKKTNRETRATILGHIQRGGAPVVYDRILASRMGAYSVELLIKGYQ
FT                   GKCVGIQNEKMVFNDIKNALKNMKRTFKKDWLITAKKLY"
FT   CDS_pept        339155..339946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /product="glycerol uptake facilitator protein"
FT                   /note="BU306"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13015"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13015"
FT                   /db_xref="GOA:P57392"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57392"
FT                   /protein_id="BAB13015.1"
FT                   /translation="MNIYRKKNIIKKCFMEFFGTGLVMFFGIGCLAASKLTNANFTQFE
FT                   ISCIWGFGVSIAIYFSSSISGAHLNPAVTIFFWLSSKLNKRKVLPYIISQTLGSFFFTM
FT                   LTYYLYNNLLISFERNNNVVRGTQESLNLASIFCVYPNYNNSFIYDFIIEIFSTALFIL
FT                   IVLEFNNRNSNYFLYNRSVAPILTGFLVCMINLVINPLNNISLNPARDLGPKILLSLTG
FT                   WGLFSFTGGNDNILYCFIPIMGPILGANLGGWIHKTLINNS"
FT   CDS_pept        complement(339955..340722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="BU307"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13016"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13016"
FT                   /db_xref="GOA:P57393"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57393"
FT                   /protein_id="BAB13016.1"
FT                   /translation="MKKFFITANWKLNGNIKMISSFFKYLKLYSSSYLEKNTVIIAPPT
FT                   IYLERVCKNISNMNIFLGSQNVDINLNGAFTGETSILMLRDIGVKYVIIGHSERRFLHH
FT                   ETDDIIAKKFHLIKKSNLTPILCVGETEIEKKHNQTEQVIQRQLNLILKNLGTSAFKNI
FT                   IIAYEPIWAIGTGVSADPEHVQLIHVFIKNYILKYSSINRNDIIIQYGGSINHTNVKKF
FT                   IEQPDINGLLIGNSSLSAKEFLEIIKIAHEHYS"
FT   CDS_pept        complement(340821..341105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="himD"
FT                   /product="integration host factor beta-subunit"
FT                   /note="BU308"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13017"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13017"
FT                   /db_xref="GOA:P57394"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57394"
FT                   /protein_id="BAB13017.1"
FT                   /translation="MIKSELFERIAEQKINISNKMIERAAKEMLEHMIISLANGKRIEI
FT                   RGFGSFSLHYRSSRIGRNPKTGKSVKLNEKYVPYFKPGKKLRDRANIHK"
FT   CDS_pept        complement(341201..342877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /product="30S ribosomal protein S1"
FT                   /note="BU309"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13018"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13018"
FT                   /db_xref="GOA:P57395"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57395"
FT                   /protein_id="BAB13018.1"
FT                   /translation="MNESFAQLFEESLKEIKTRPGSIIRGTIVSIEKDMVLVDAGLKSE
FT                   SAIPVEQFQNSQGLLDIQVGDQIDVALDAIEDGFGETLLSREKAKRHEAWLILEKAHEK
FT                   SETVIGIINGKVKGGFTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKR
FT                   NNVVVSRRAVIESENSAERDQLLENLQEGMHVKGIVKNLTDYGAFVDLGGVDGLLHITD
FT                   MAWKRVKHPSEIVNVGDEINIKILKFDRERTRVSLGLKQLGEDPWIAISKRYPEETKLS
FT                   GRVTNLTDYGCFVEIEEGVEGLVHVSEMDWTNKNIHPSKVVTVNDVVEVMVLDIDEERR
FT                   RISLGLKQCKINPWKEFSETHKKGVHVLGKIKSITDFGIFIGLNGGIDGLVHLSDISWT
FT                   IPGEEAVVKYKKNDEISAVVLQVDAERERISLGIKQLEEDPFNTYIANHKKGAIITGII
FT                   KSLDKKNIIVKLPENLEGVIKLTEITRVYSETMINKLKIEDKILVKLSSFDRKNRIIYL
FT                   TIHMIDEDEKKDLTAPSNNKTNDDSFSNVMTEAFKAAKNTE"
FT   misc_feature    complement(343005..343660)
FT                   /gene="cmk"
FT                   /note="authentic frameshift; This 218 aa putative ORF is 47
FT                   pct identical to 195 residues of 227 aa protein KCY_ECOLI
FT                   SP:P23863"
FT   CDS_pept        complement(343716..344999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="BU311"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13019"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13019"
FT                   /db_xref="GOA:P57396"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57396"
FT                   /protein_id="BAB13019.1"
FT                   /translation="MQNSLDLKPISHVNGTVCLPGSKSISNRVLLLSSIAKGTTCLTNL
FT                   LNSHDTQHMLNALKKLGVRYNLSDDKKTCHVQGIGGPFHLSEAISLYLGNAGTAIRPLL
FT                   SVLSLHKNNILLNGDDRMHERPIGDLVDALIQGGAVIEYKKNKGYPPICTKGGFLGGSI
FT                   FLNGNISSQFLTSLLISTPLALKDTTIFIKGNLVSKPYIDITLNLIKIFGVNIEHDSYN
FT                   VFYIKGKQQYKTPGKYTIEGDASSASYFLAAAAIKGGSIKVTGVGKKSIQGDIEFANIL
FT                   EKMGATIFWEDYSITCTRNKLNAIDLDMNHIPDAAMTVAILALFSKGTTIIRNIYNWRV
FT                   KETDRLSAMTIELRKIGAIVEEGRDFLSISPPIFFQYSSIETYNDHRMAMCFSLISLSG
FT                   VGVNILNPNCISKTFPSYFKDFLSISKI"
FT   CDS_pept        complement(345066..346151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /note="BU312"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13020"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13020"
FT                   /db_xref="GOA:P57397"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57397"
FT                   /protein_id="BAB13020.1"
FT                   /translation="MNLIYNFSAGPAMIPRDVLNQAKKELHNWKNLGSSIMEISHRSEE
FT                   FIQMALEAEKDLRDLLKIPDSFKVLFCQGGARGQFSAIPMNLLNNLQTADYINSGYWSN
FT                   SAFMEAKKYCTPRSIFIRETNGVKESLLPMHKWNINENSAYIHYCPNETIDGLSIYEEP
FT                   VFENKIVVGDFSSFILSRSINIKNYDLIYAGAQKNIGPAGITIIIIRKNIIGYSSKMTP
FT                   SILDYKKISDHHSMFNTPPTFAWYLSGLVFKWLKKQGGLKAIEKLNKKKSDLLYKKIDN
FT                   SDFYINKINSKHRSQMNVVFHLVNPKLNYIFLKEASKTGLNYLRGHSIVGGMRASLYNA
FT                   MPLEGVESLVKFMSYFEKRYG"
FT   CDS_pept        complement(346190..347473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="BU313"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13021"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13021"
FT                   /db_xref="GOA:P57398"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57398"
FT                   /protein_id="BAB13021.1"
FT                   /translation="MLNPYLLRNELHLTAKKLLKKGYKLNISKISSMEEKRKTLQIQTE
FT                   NLQFKHNALSNLFKENKNIKNKNELLRHQVIQSSKDLNASKIELNSLKEKIHHFSMCIP
FT                   NIPSDDVPEGNTSINNKEIKYWGQKKKYDFEIQDHIELGKKFNELDWKSSAQMSGSRFV
FT                   IMKGKIALLHRALSQFMLDLHTLKHGYIESYVPYLVHSEALYGTGQLPKFSDDLFHINL
FT                   TDKKKYILIPTGEVPLTNLVYDQIIDEKDLPIMLTAHTPCFRSEASSYGRDTKGLIRLH
FT                   QFDKVELVQIVKPEKSYEALEKLTNHAEKVLQLLNLPYRKMLLCTGDTGFAAVKTYDLE
FT                   VWFPSEKKYREVSSCSNMSDFQARRIKARYRKKSEQKNFFVHTLNGSGLAIGRTLAAIL
FT                   ENYQHSNGRIEIPKVLQKKYMQGLEFIN"
FT   CDS_pept        347821..348780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="BU314"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13022"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13022"
FT                   /db_xref="GOA:P57399"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57399"
FT                   /protein_id="BAB13022.1"
FT                   /translation="MDKVKHSKIIILGSGPAGYTAAIYAARANLDPFLITGTNKGGQLM
FT                   NTNEIENWPGDYNKISGSELMNRMYKHAIELKTKVICDTVISVNFKKNPFFLIGENNKY
FT                   TADSVIIATGANPRYLGLQSESLFKGKGVSTCAVCDGFFYKNKEVAVVGGGNTAIEETL
FT                   YLSNFVKKVHLIHRGINFRAEKILLDRLEKKIKSQKIIIYLNSIVKNILGNSSGVTALL
FT                   IEQKNSKEKTESKIQVSGLFVAIGYTPNTNIFVNKLKMKDGYIQVTRQEHGNYTQTSIP
FT                   GIFAAGDVIDHVYRQAITSSASGCMAALDSERYINSLV"
FT   CDS_pept        348887..349105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /product="translation initiation factor IF-1"
FT                   /note="BU315"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13023"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13023"
FT                   /db_xref="GOA:P57400"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57400"
FT                   /protein_id="BAB13023.1"
FT                   /translation="MSKEENIEMQGVVIDTLPNTMFRVELENKHIVTAHISGKMRKNYI
FT                   RILTGDKVTVELTPYDLTKGRIIFRSR"
FT   CDS_pept        349274..351034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="BU316"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13024"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13024"
FT                   /db_xref="GOA:P57401"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57401"
FT                   /protein_id="BAB13024.1"
FT                   /translation="MRTKYCGNIRISHVNKKVKLCGWVHKVRNLGQFIFVDMRDYTGLV
FT                   QVIFELKNYKIFKKALNLRNEFCIQVFGTVQKREKKNQNIKIRTGEIEILANVLNILNT
FT                   SKSLPLNFTQENNDDSRLKYRYLDLRSFDILENLKIRNKITYLIRNFMTKKNFLDIETP
FT                   ILTKSTPEGARDYLVPSRNHYGKFYALPQSPQLFKQILMISGIDRYYQIVKCFRDEDLR
FT                   SDRQPEFTQIDIEVSFMSAKKIRNLVENLIKKLWLEIRNINLKKFPQISFHEAMKKYGS
FT                   DKPDLRNPIEIIDVSNIFKDKKFISFFNLNPQKNNRIALLCISKGAHLSRKKIDDYTKY
FT                   VQRFDAKKLFYMKIKECKLGCLGIHSSIKNILDEIILKEIIEKSQSKNGDILFLIADQE
FT                   HIVNKSLGMLRLKIGIDLNITKKNRWEPLWIVNFPMFDKDIQGNLSSVHHPFTAVKNMD
FT                   REILKNSPDLAISDSYDLIINGYEIGGGSVRIHDVNMQKQVFDIIGIKKSMQNEKFGFL
FT                   IEALKYGAPPHAGIALGLDRIVMLLTNSKNIRDVIAFPKTTSATCLMTNSPSTVDNLLL
FT                   QELAIKHLKK"
FT   CDS_pept        complement(351045..351833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuB"
FT                   /product="high-affinity zinc uptake system membrane protein
FT                   ZnuB"
FT                   /note="BU317"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13025"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13025"
FT                   /db_xref="GOA:P57402"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57402"
FT                   /protein_id="BAB13025.1"
FT                   /translation="MFELIFPGWLAGVLLSLTTGPLGSFIVWRRMSSFGDTLSHSSLLG
FT                   IALSIAFNINSFYAILILMSFIAIILAWLEELLPVSLDTVLNIISHSSLSLGMVFISLI
FT                   SSKKEINITNYLFGDLLSVTKNDLITISISSILILSILLFRWHSILSSTINEELSQIDG
FT                   INVLYARLTIMLMTAFTIAIAIKFVGALLITSLLIIPPATAQHFSGSPEKMVIIAIIVS
FT                   ILSVTGGISLSVFYNTPASPSIVLCSSFLCLISNIKKHFY"
FT   CDS_pept        complement(351891..352607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuC"
FT                   /product="high-affinity zinc uptake system ATP-binding
FT                   protein ZnuC"
FT                   /note="BU318"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13026"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13026"
FT                   /db_xref="GOA:P57403"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57403"
FT                   /protein_id="BAB13026.1"
FT                   /translation="MFEFVKLKNVCVNLSHRSILTDISLSLISNRVLTLIGPNGAGKST
FT                   LVRIILGLIKPNSGTIIRSNNLSVGYVPQKLHLNTLLPITVERFMKLSRKTNNIKIEEM
FT                   LKRVKAESLKFCQLQKLSGGEMQRILFAKALLNNPNLLVLDEPTQGVDVMGQLALYKLI
FT                   NEIRHELQCAILIVSHDLNFVMAKTDDVICLNNHICCSGTPETVCNNLEFISIFGLKRV
FT                   QELAIYHHNHNHIHNF"
FT   CDS_pept        complement(353925..355367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pykA"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="BU319"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13027"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13027"
FT                   /db_xref="GOA:P57404"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57404"
FT                   /protein_id="BAB13027.1"
FT                   /translation="MLNRLRRTKIVATLGPSTDINNNLEKIIRSGVNVLRFNFSHGSKD
FT                   EHKSRANQAREIMTRLNFHIALLGDLQGPKIRISKFIKNNIFLNVGDFFILDANLDQNN
FT                   GNQERVGIDYKQLPYDLKVGDVLLLDDGRIQLKVIKSTGHEILTKVVIGGILSNNKGIN
FT                   KLGGGLSADALTEKDKKDIILATEINVDYLAISFPRCSNDLKQARKLAKEFGSNAKIIA
FT                   KIERAEAVLNQNTIEDIILASDAIMIARGDLGVEIGDSELAGIQKKLIRTARQLNRIVI
FT                   TATQMMESMITNPLPTRAEVMDVANAVLDGSDAVMLSAETASGEYPAETVIKMAKICKG
FT                   AEKVPSINVSRHRIHAKFDDIEEAIAMSAMYVANHLKGITAIITMTESGKTALMTSRIT
FT                   SGLPIFALSKNKETLNLASLYRGVTPIYFNSKNNNFKAANEAIVLLRKRGFLCRGELVI
FT                   ITQGDIMGKIGKTNTSRILKVV"
FT   CDS_pept        355650..357125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="BU320"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13028"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13028"
FT                   /db_xref="GOA:P57405"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57405"
FT                   /protein_id="BAB13028.1"
FT                   /translation="MIIETNHACDLVIFGAKGDLTKRKLLPALYKLEKSKKIHKYTRII
FT                   ASGRADWSTEDYIEKIKTEVKNFLNEEINDLIWKNLSSRIFFCNIDVHEPLHFFRLKTI
FT                   LKQKKNIIVYYCAVPSNTLNSIFIGLGNAHLNSVPSRIVLEKPLGVCLKTSKKINDQIS
FT                   KYFLESQIFRIDHYLGKESILNLFALRFSNTCLFYNWNNKTIDHIQITVSEEVGIEDRW
FT                   NYFNMMGQMKDMVQNHLLQILTILTMDQPKNISSESIQHEKVKILRSLNPINIHNINKK
FT                   TVRGQYCSGVINEKKVPSYLEENGANKNSLTETFVAIKVDLNNKQWSGVPFYLRTGKRL
FT                   AHKYSEIVVFFKKKPTNLFKNLNSELLQNKLIIRLEPNPNIIFDFSVKAPGLEQEYKIE
FT                   NSQLKSSQFSKKYSKNSIDAYERLLFEIMRGVQSLFVCRDEIEAAWKWIDPIIHAWKNS
FT                   KNNAPQLYMSGTWGPKNSDLLLAHDGRVWYEFH"
FT   CDS_pept        357310..358188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /product="heat shock protein htpX"
FT                   /note="BU321"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13029"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13029"
FT                   /db_xref="GOA:P57406"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57406"
FT                   /protein_id="BAB13029.1"
FT                   /translation="MTRIVLFLLTNLAVMLIFSLILFLTGIQSNTIYGLLIMSGLFGFS
FT                   GSILSLILSKWIALRSVNGEIITHPRNEVESWLINTVRQQSIQKGIIMPQIAVYHATDI
FT                   NAFATGARRNSALIAVSTGLLENMTHHEAEAVIAHEISHIANGDMITMTLVQGVVNTFV
FT                   IFISRFLSQIISNVMSSNRNENNTEEKNSFVYFLVSTFLELIFGILASIITMWFSRHRE
FT                   FYADASSAKMVGREKMIAALNRLKTSHEPQESDSMIAFCINGKSKSFLKLFASHPSLEN
FT                   RIEALYNQEYM"
FT   CDS_pept        358537..358746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspC"
FT                   /product="cold shock-like protein cspC"
FT                   /note="BU322"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13030"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13030"
FT                   /db_xref="GOA:P57407"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57407"
FT                   /protein_id="BAB13030.1"
FT                   /translation="MAKIKGQVKWFNESKGFGFITPSDGSKDVFVHFSSIQGNGFKTLT
FT                   EGQNVEFEIQDGQKGPAAVNVFSL"
FT   CDS_pept        359049..360614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yoaE"
FT                   /product="hypothetical protein"
FT                   /note="BU323"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13031"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13031"
FT                   /db_xref="GOA:P57408"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57408"
FT                   /protein_id="BAB13031.1"
FT                   /translation="MEFFLDPSTWAGLLTLVILEVVLGIDNLIFVAILSEKLPPNQRDK
FT                   ARLIGLGLALVMRLALLSLISWIVTLNSPIVHNKFFSLSIRDIILLFGGFFLLFKTTME
FT                   LHERLENNHHENSENKNYAGFWAVVIQIVVLDAVFSLDAIITAVGMVNQLLIMMIAVIL
FT                   ATFLMLLASKALTNFINLHQTVVVLCLSFLLMIGFSLVTEALRFCIPKGYLYAAIGFSI
FT                   LIEIFNQIARHNFMKNQSRRPMRQRAAEAILRLMVGEQNKKQQIKKIEINSQKTDSIQS
FT                   SKEMETFKDEERYMINGVLTLAGRSIRSIMTPRSNISWVNTEKNTDEIRMQLLDTPHSL
FT                   FPVCKGELDEIIGIVRAKELLVAIEKKIDASTFSSKILPIIIPDTLDPIKLLGVLRRAQ
FT                   GSFVIVSNEFGVVQGLITPLDVLEAIAGEFPDADETPDIIQENNSWLVKGETDLHSLQQ
FT                   LLNTEELIKEDNYASLGGLLIAQKGQLPIPGEIIHIHPFYFHIVKATEYRIDLVRIIKN
FT                   QDDN"
FT   CDS_pept        360644..361309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaZ"
FT                   /product="hypothetical protein"
FT                   /note="BU324"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13032"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13032"
FT                   /db_xref="GOA:P57409"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57409"
FT                   /protein_id="BAB13032.1"
FT                   /translation="MSNIILSIESSLDCCSVAIYKNEYIHSLSEKCKKKHTTHILPMIK
FT                   EILSQTKTEFKELNYVSFSKGPGNFTSIRIAASIAQSLSISLKIPIISVSTLAIMAEKT
FT                   FRKYKQKDVIVAIHAKKKQVYWAKYTRNKNSIWIGEYTESLLEKKIIQEKIENLKKRWT
FT                   LVSDQSELIEFQNILNVKKNYVFLPNAKDIIPFVLLKIKNKNKSFSIENNINYLYNQF"
FT   CDS_pept        complement(361455..361706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minE"
FT                   /product="cell division topological specificity factor"
FT                   /note="BU325"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13033"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13033"
FT                   /db_xref="GOA:P57410"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57410"
FT                   /protein_id="BAB13033.1"
FT                   /translation="MALLDFFLSRNKNTANVAKERLQIIVAEQRKYNNEPDYFPQLKRE
FT                   ILSVICKYVNIEPNMVTVQLDQKNEDISILELNIILPD"
FT   CDS_pept        complement(361710..362522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /product="septum site-determining protein minD"
FT                   /note="BU326"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13034"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13034"
FT                   /db_xref="GOA:P57411"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57411"
FT                   /protein_id="BAB13034.1"
FT                   /translation="MTRIIVVTSGKGGVGKTTSSAAIGTGLAQKGKKTIVIDFDIGLRN
FT                   LDLIMGCERRVVYDFINVIQGDATLNQAIIKDKKTNNLFILPASQTRDKDALTRIGVEK
FT                   VLTELIKMNFDFIICDSPAGIETGAILAIYFADEAIITTNPEVSSVRDSDRILGIISSK
FT                   SKRAEKNITPIKEYLLLTRYNPRRVKKGEMLSMTDVLDILQIPIIGVIPEDQSVLRASN
FT                   QGESIILDINSNAGCAYSDTVNRLLGEERHFRFIEEEKKSFLRRLFGR"
FT   CDS_pept        complement(362549..363262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minC"
FT                   /product="cell division inhibitor minC"
FT                   /note="BU327"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13035"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13035"
FT                   /db_xref="GOA:P57412"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57412"
FT                   /protein_id="BAB13035.1"
FT                   /translation="MQKKSIELKSNNFTLLVLYLNNQNIDLINQSLYKKIQECPKFFKN
FT                   APIIVNVSKLCNTVDWKKIKKIIISHGFFVVGVSGCQDGILKKNIIDSGLPILSERKNN
FT                   KSNIITNFFINSYKNKKKETINKVEKTHIIDIPVRSGQKIYAKHADLIVINNVSAGAEL
FT                   VADGNIHVYGIVRGRVLAGANGDTSRKIFCTGLFAELVSISGEYWLSDQIPSEFIGKSA
FT                   QIYLKNKFLTINSLS"
FT   CDS_pept        363663..364505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjjT"
FT                   /product="hypothetical protein"
FT                   /note="BU328"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13036"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13036"
FT                   /db_xref="GOA:P57413"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57413"
FT                   /protein_id="BAB13036.1"
FT                   /translation="MNNNIVHNNLLISQEMIQNCDVIIYYWPKDKSEAKFQLMNIISCS
FT                   PINTEIFIVGNNSSGVKSAPLMLKKWIELEKIDSAKHSILISGLIKKKAIFVLEDFFKT
FT                   HLWKNLIIKSLPGVFGHKKIDSGSKLLASTFSNRITGKVLDIGCGTGFLSASLLYFSPD
FT                   AILTLVDNNMYALKCSQYTLNSNKFNGKIVYSNLYSNVFKKFDLIISNPPFHNDLQINF
FT                   NIIEKMICGAKKYLTKTGELRFVTSRFINCHFLLNKFFQKYYVIKETSQYKVYQAFYK"
FT   tRNA            complement(364524..364607)
FT                   /product="tRNA-Leu (TAA)"
FT   tRNA            complement(364619..364692)
FT                   /product="tRNA-Pseudo (GCA)"
FT   tRNA            364863..364947
FT                   /product="tRNA-Ser (TGA)"
FT   CDS_pept        complement(365056..366105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompA"
FT                   /product="outer membrane protein A precursor"
FT                   /note="BU332"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13037"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13037"
FT                   /db_xref="GOA:P57414"
FT                   /db_xref="InterPro:IPR000498"
FT                   /db_xref="InterPro:IPR002368"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57414"
FT                   /protein_id="BAB13037.1"
FT                   /translation="MKKRALAIAFLLASLIPSAAQAEEENGWYLGAKFGWSHFNPLKYD
FT                   MNNSQVNNNDSSIENLSAPIVGLFLGYEFNPYFSLEIENDTNGFFPHLIFQKNNEHIQS
FT                   NSVQLATKLSYPITDEFHLYTKLGGIVSWNDLSSKNTLKNLFSKESALLPSLSLGAEYI
FT                   FNETFITRLDYTWKNSVKNIANASIKPALGDAVLSIGWKFGKSDISDMFSSDDSEPLNE
FT                   QYSVLNENINFPFNSTELKPSSYDKLNKLDDDIKDMQLKNVSIVLLGHADKIGSDEYNQ
FT                   KLSEDRAYSIKNYLASRGFSRDKITVKGMGKLYPLTNQVCRDVVNKPLLISCLAPDRRV
FT                   EIEVLSDVQ"
FT   CDS_pept        complement(366242..367777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /product="virulence factor mviN homolog"
FT                   /note="BU333"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13038"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13038"
FT                   /db_xref="GOA:P57415"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57415"
FT                   /protein_id="BAB13038.1"
FT                   /translation="MNLLKPLISVSLMTLISRILGFVRDILIASIFGASMFTDAFFISF
FT                   KIPNLLRRIFSDGTFSQAFIPVLMEYKSDKNEKNIKNFLSSILGFMSFFLLLLTILGGF
FT                   FSQSIILIRAPGFLNPPEKLILSTNLLRIMFPYILLISLSSLCSSILNSWNYFSIPAFS
FT                   PIFLNISIIFFSVFFSSFFCPSIIVLAWSVIIGGLVQLLYQLPFLYKINMLVLPNFHWN
FT                   NIGLLRILKKMGPAILGASANQISLIINTIFSSLLNSGSISWIYYADRLIEFPVGILGV
FT                   SLSTVLFTSLAKNYKNGIKLEYKKLLDWGLRISLIVSLPGSVILFFLAKPVIIVLFQYG
FT                   KFTDFDVLMTARVLKLYSCGLISFIFVKILSSAFYACEEIKIPMKASLFTLLLNQLMNP
FT                   FLIFYFQHAGIALSLSITSWVNFLLLSRKLYQRKIVSLQRSEFIFIIYIILATLVMIVI
FT                   LFVVLHMMSVWNIGTFINKIIRLFFGKYVSGITYLFMMNILGIRLLNFFYKNS"
FT   CDS_pept        368052..369104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="BU334"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13039"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13039"
FT                   /db_xref="GOA:P57416"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57416"
FT                   /protein_id="BAB13039.1"
FT                   /translation="MSKFVKKIKIIKPDDWHVHLRDNEILNQVIKYTGKFYKRAVIMPN
FT                   LNSPITSCLKSIAYRNRILKSMHLNYKFKPLMTCYLTNSTSPKELEFGFSKKIFVAAKF
FT                   YPNGCTTNSKTGIKKISDITPVLECMEKIGMPLLIHGEEINQNIDIYDREAKFIEKTLD
FT                   PLRKKFPKLKIVLEHITTKESVEYIKNNDVNYLSATITPHHLMLNRNDMFYGGIQPYLY
FT                   CLPILKKNKHRMALRKAISNGDKHFFLGSDTAPHLHKNKINMLGCAGIFNAPSSLLSYV
FT                   KVFEEMRALKYLQSFCSENGPKFYNMPINKETITIIKKPCKIIKKINVGRNVIIPFLSG
FT                   EILNWSIESD"
FT   CDS_pept        complement(369124..369531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgN"
FT                   /product="flagella synthesis protein flgN"
FT                   /note="BU335"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13040"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13040"
FT                   /db_xref="GOA:P57417"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57417"
FT                   /protein_id="BAB13040.1"
FT                   /translation="MNNLIDTIKKIENILYSLERILKQECHNLLKSKTSNEEILELIKR
FT                   KKILFKKLIILSQDRLCLEKEYNIFPPYESNNKLNNYWKKIINTCLILRKLNLKNKIIM
FT                   NKKFYLNQRFLELSSSYKKSVTYNLDGNLEI"
FT   CDS_pept        complement(369604..370284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /product="flagella basal body P-ring formation protein flgA
FT                   precursor"
FT                   /note="BU336"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13041"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13041"
FT                   /db_xref="GOA:P57418"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57418"
FT                   /protein_id="BAB13041.1"
FT                   /translation="MKITIYFFLLLLSFTINSVSATVQKFNFFDLNKQLNIFLKKEYPL
FT                   NEDSIKIIIHTPLKKNIYCRKPDFSILSNTHNLGLINILLTCSKQHYYLTVEVQSEGEY
FT                   IVANRKIPRGTRIKESDLKILIGRLDVLPNNTYRKKKDVVNRISLREFFPLQPITSFMT
FT                   RPFWLVKVNQQVTVIINGNNFKMSSKAKSLSNGAQNQNIRVKTNSGKIINGIINENGEV
FT                   IVSP"
FT   CDS_pept        370621..370968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /product="flagellar basal-body rod protein flgB"
FT                   /note="BU337"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13042"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13042"
FT                   /db_xref="GOA:P57419"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57419"
FT                   /protein_id="BAB13042.1"
FT                   /translation="MFSRQEILSANIANADTPGYKSIDFNFKNELNKTLYKNKKTIFLK
FT                   KTSPNHLNEKHKNLFLLKTIPVLTNQIKQDGNTVNMDRERIEFLNNSIKYQSSLVFIKN
FT                   EIKNMMYVLKG"
FT   CDS_pept        370977..371387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /product="flagellar basal-body rod protein flgC"
FT                   /note="BU338"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13043"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13043"
FT                   /db_xref="GOA:P57420"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57420"
FT                   /protein_id="BAB13043.1"
FT                   /translation="MSLLNIFNIAGSAMIAQSQKLNVIASNLANMDSTIYKNGKFYPYI
FT                   AKQVVFSLDTAKNSKIGGVKISAIIDDPSPMKLIYDPNNPMANNKGYILASNVNPITEM
FT                   VNNIAAARSYQANIEVLKTAKSMIMKTLTISE"
FT   CDS_pept        371399..372109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /product="basal-body rod modification protein flgD"
FT                   /note="BU339"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13044"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13044"
FT                   /db_xref="GOA:P57421"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57421"
FT                   /protein_id="BAB13044.1"
FT                   /translation="MSTININSSDINLPNIQPPIINNEAVKKNDNNLPNDINPPDLQKN
FT                   FLSLLIAQIKNQDPTDPIKNSDLTSQLAQINTASGMQKLNNTVDQFSNQISKNQNIQLS
FT                   TLIGRHVMVPNKKIIHTKDTKTQFGIELFEKATSVEIKITDDNNKTLYLKQLKETEAGR
FT                   HNFFWDGQDLNKNSVMSGQYNISVIAKKNNQNIPVNSLSVGVVNSIIMSSGNAIIDLGE
FT                   SGQITPLSIREILK"
FT   CDS_pept        372159..373376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /product="flagellar hook protein flgE"
FT                   /note="BU340"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13045"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13045"
FT                   /db_xref="GOA:P57422"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57422"
FT                   /protein_id="BAB13045.1"
FT                   /translation="MIAISGLLANNDYMEIISNNIANASTIGYKSRKPLFFDMFSHSFY
FT                   SNTTNGYGVGISSIIQNFNNGMLVETGRDLDLGIIKDGFFRLVDSQGHVYYTRDGQFFL
FT                   DKDQNIINIQGMYLTGLNTSCSKSDFNNRSNLEPINLKNSNILKNKPTSEIMLKAFLNR
FT                   NTESKSSVDNSDNKLSKPEDYMTYISIYNKEGKKEDITVSFNKKETNKWTVNVESNDSD
FT                   DKETIKNSFDLTFNDDGELTSDNVFNITSKDSKKYENITLNLTGTIEQSNSDVSWEEHS
FT                   QNGYPQGNLKTFDIVTNGEIIGTYCNQKQQTIGQILLSKFINPEKLQPESGNLWSATAE
FT                   SGEAKTAMKAGIQESGVLSNKTLEVSNVDLNKELINMIIAQRNYQSNAQSFKTEDKIIN
FT                   TLINLQ"
FT   CDS_pept        373427..374161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /product="flagellar basal-body rod protein flgF"
FT                   /note="BU341"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13046"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13046"
FT                   /db_xref="GOA:P57423"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57423"
FT                   /protein_id="BAB13046.1"
FT                   /translation="MIAANQLLEKQSIISNNLANISTTGFKEKFIFAIQNHNVKNLYNS
FT                   DKKITKEYYNLSPGILRYTGRNLDLFIKDDGWLTVKDTNGQEAYTKNGHLKINSKRKLT
FT                   IQDNEVIGNNCNIIIPKNIILKILSNGVITSVKNKHKHIVETKIGSLKLVQLPSQDLIQ
FT                   NENGLFYLKKNNEINKKHTNTIKHSKKIRVQSGMLEESNVNASKNMIEMISNARQFEMQ
FT                   MKMISMCDQNAEYANQLININN"
FT   CDS_pept        374179..374961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /product="flagellar basal-body rod protein flgG"
FT                   /note="BU342"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13047"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13047"
FT                   /db_xref="GOA:P57424"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57424"
FT                   /protein_id="BAB13047.1"
FT                   /translation="MIPSLWISKTGLDAQQINMNIISNNLANVSTNGFKRSRAVFEDLM
FT                   YQTIREAGTNSSLETTLPSGLQLGTGVRPVSTERIHTQGNLSKTDASKDVAINGSGFFQ
FT                   VQLPDGNIAYTRDGSFQLDQNGQLVTNSGFPIIPEINIPSNSTNINIARDGVISVVVQG
FT                   QTQPVLLGQLNLINFVNNSGLESLGENLYQETQASGSPIETTPGLNGTGVLYQGYVETS
FT                   NVNVAEELVNMIQTQRAYEINSKSISTSDQMLQKLSQL"
FT   CDS_pept        375045..375761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /product="flagellar L-ring protein precursor"
FT                   /note="BU343"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13048"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13048"
FT                   /db_xref="GOA:P57425"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57425"
FT                   /protein_id="BAB13048.1"
FT                   /translation="MIKLFICQKKYYLTAIFLLTIQSCASVEYKPLVTGATTAIAPNIW
FT                   PKVVNGSLFQEKIPINYGYQPLFEDHRPHNIGDTITVVLQENISASNSSISNMSRDGSA
FT                   NFGLKIAPGQLNNILGVNFQDNTTSLDSFGRNNFSGKGSNSANNKFTGLITVTVKRVLP
FT                   NGNLKVIGEKQVSINKGTEFIRFSGVINPTNINKNNFISSTQIADARIEYLSHGGLDDV
FT                   QKMGWLQKLLLKISPI"
FT   CDS_pept        375942..377099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /product="flagellar P-ring protein precursor"
FT                   /note="BU344"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13049"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13049"
FT                   /db_xref="GOA:P57426"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57426"
FT                   /protein_id="BAB13049.1"
FT                   /translation="MTLLKRQINKGFFMSKKILFLIKVIVFIFTTFSLPLYAEKIRDLT
FT                   SIQGIRDNPLIGYGLIVGLDGTGDQSTQAPFTNQSLKNMLSQLGVSIPSNTNMNTKNVA
FT                   AVIVTANLPPFSHAGEKIDVVVSSMGNARSLKGGTLLMTPLKGANNQIYAIAQGNILVS
FT                   EKNNKKSKIHNFYSNQVNSGKIHHGATIEREIDNNFGKQKTINLQLNQENFSTAQRISD
FT                   MINTKYPDTATPINSKTVQLNTSANNDVQVHMLSNIQDIDISLPSQEAKVVVNSRTGSI
FT                   VINQSVRLGSCVVSNGNMSIIVHQIKNKKRDLYFLKSFNKNIKKDQSIEDMADKNYMND
FT                   IATNKENLHNIVRALNKLGTKPDELMSILQLMKSAGCLNAKLEIV"
FT   CDS_pept        377099..377398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgJ"
FT                   /product="flagellar protein flgJ"
FT                   /note="BU345"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13050"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13050"
FT                   /db_xref="GOA:P57427"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57427"
FT                   /protein_id="BAB13050.1"
FT                   /translation="MNDNLLLSNISDYNVQFINELKYQVRINPKKHALQTAKEVEGVFI
FT                   QVLLKSMRSSLLKDNLLDNNQSRLYTDIYDQQLSQEISKKGIGLTDIILKQIEK"
FT   CDS_pept        377500..379131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /product="flagellar hook-associated protein 1"
FT                   /note="BU346"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13051"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13051"
FT                   /db_xref="GOA:P57428"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57428"
FT                   /protein_id="BAB13051.1"
FT                   /translation="MSDILNSAISGMNAMKIMIDNTIDKINHPNNKTLGKRVVIENTVQ
FT                   NENKNSTVKVKEIYDNYNDFILEEKRKTNAEVQDEQTKIEQLLKLEDLLCEKSNIFSQL
FT                   LNDYYAQIEEDIVLAKKNVFNENIQKKLSNIVFAIKDFDKKLKFLEKDIKDSVINNLKK
FT                   VNSLIDEIHDLTIDIRCFPVLKFPNRVDGLIEQRDRLVDELNGLIGIKVIKDHDNYKLN
FT                   LNNGISIIDNNKKQNLIALTSTSDERYISVGYVDTNDKVAKKIEDMIPTATLGALLKFR
FT                   REELTNTRNKIGQLIINFADSINSYHAIGYDMFGHLGRQIFNISQPEVIASSSNRSSSK
FT                   VSAKWLVISDAKNTNYVIYFKDKNFIVTRLSDHSTIQPKVHVENNKTLFTFDGIECSIE
FT                   GENADNDIYMIKPYSKTLEELELLIKPNEPFAYSSTDDLNNPNRNNAIIINKFYNNVLV
FT                   DHKETLDQAYQKFSQSISHKCNALEEEVPFKRNMIGILENKKMSISNDMEQEYAELNYE
FT                   QECYLANVKVLQTAENILNEIIERYS"
FT   CDS_pept        complement(379296..382004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rne"
FT                   /product="ribonuclease E"
FT                   /note="BU347"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13052"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13052"
FT                   /db_xref="GOA:P57429"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR028878"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57429"
FT                   /protein_id="BAB13052.1"
FT                   /translation="MKRMLINATQQEELRVALVDGQRLYDLDIEHSGSEQKKSNIYKGK
FT                   ITRIEPSLEAAFVDYGEEKNGFLPLKEISKNYFPENHIETLGFNIKNVLQEGQEVIVQI
FT                   SKEERGTKGAALTTFISLAGSYLVLMPNSPKSGGISRRIEGNDRIALKELLTLLELPEE
FT                   MSLIIRTAGAGKSIESLRWDLSLRLQHWKTIQIIAKSRTAPFLIHQESNIIVRAFRDYL
FT                   RQDIGEILIDNPKILDLARKHITFLGRPDFVNKIKLYSGEVPLFSYFQIETQINSAFQR
FT                   KVRLPSGGSIMVDSTEALTAIDINSSRSTSGTDIASTAFNTNLEAVDEISRQLRLRDLG
FT                   GLIVIDFIDMSAISHQRAIENRLREIARDDRARIQIGQISRFGLLEMSRQRLSSSLGES
FT                   SHHICPRCTGTGTIRDNESLSLSILRLIEEEALKENTYEVRAIVPVEIACYLLNEKRDA
FT                   VHAIEKRQAGGKTIIVPSKKMKTPHYSVSRIRKSESKNYTRYGLSNIRQSKITSFLKKN
FT                   LLKKKQKEILDVANFNFYDNCYNKIQEAQENILKKNNYNNILLKVLSNNRNFIFKMITW
FT                   FKNSFFIKNMLITSDIFKKNTLKNTNNIFFKKKYSSLNKKNNNQKKRVILSKLFEANIE
FT                   NIPLKNKKLDTSSANYLYDNIERKKNITKKNDLIQKNIHENSYLKHVLMNRYNVINIIN
FT                   NNYIFYKIFNRTKIFKNQNTNNSFLKFSSVTSPIFIFSSVFSLELALGKVWIKYPIAIL
FT                   DETKKQKKLNRKQILHISSISETNTIVNKNNYSGIKKIKHETYSFKKYVKNNIQNQEVT
FT                   QSQLIKRTKKRNVFILDKKNFLYKRTCNRKNKIHQSSAPITKISKQSDLNKKEKEFHYN
FT                   LSMMKSSLRGKNSAGVHSATNFSNSPVSKLK"
FT   CDS_pept        382339..383283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluC"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="4.2.1.70"
FT                   /note="BU348"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13053"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13053"
FT                   /db_xref="GOA:P57430"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57430"
FT                   /protein_id="BAB13053.1"
FT                   /translation="MTHKILPISIIYINKEMLNQRIDNFMRSKFKSVPKSMIYRIIRTG
FT                   KIRINKKRIKPHYKLKIGDILKIPPIKILCDIKNTFFPLNHSTNLLNRILYEDSHLLII
FT                   NKPSGIAVHGGSGLNFGVIEYFRKLRPLNKFLELVHRIDRDTSGVLILAKKRTSLVSLH
FT                   EQLREKKIKKEYIALVHGLWPDHIKKISEPLLKIQFKNKQKMVLIDKKGKPSETYFQIK
FT                   KKFSSSTLLSIIPKTGRTHQIRVHALHAGHPIFFDKRYGKNDLDADIKNNHKINRLLLH
FT                   SSGVHFIHPKNGNKIYIKAPLDIDFQNYLNTII"
FT   CDS_pept        383329..383493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /product="50S ribosomal protein L32"
FT                   /note="BU349"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13054"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13054"
FT                   /db_xref="GOA:P57431"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57431"
FT                   /protein_id="BAB13054.1"
FT                   /translation="MAVQKNKPTRSKRGMRRSHDSLTAPHLSIDKFSGETHIRHHITNN
FT                   GYYKGKKVI"
FT   misc_feature    383914..384872
FT                   /gene="fabD"
FT                   /note="authentic frameshift; This 319 aa putative ORF is 42
FT                   pct identical to 293 residues of 319 aa protein FABD_ECOLI
FT                   SW:P25715"
FT   CDS_pept        384859..385593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="BU351"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13055"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13055"
FT                   /db_xref="GOA:P57432"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57432"
FT                   /protein_id="BAB13055.1"
FT                   /translation="MNINRQTAFITGANQGIGKAIAKKLIKKGIQVIGTSTTEDGVKRI
FT                   NDYLEGNGFGFVLNLKNIDSITEKIQEIYKKKHSIDILINNAGIKEDNLLVNMKSTEWD
FT                   DVIKTNLSSVFHLVKSVIRSMIKKRQGRIITIGSVIAYTGNKGQVNYSASKSGLIGFHK
FT                   SLALEVASKGITVNIVSPGLIKTNFTEKLNSIQYQKYLSNIPMKRFGQKEEVADAVIFL
FT                   ASKKASYITGHTLHVNGGMYMI"
FT   CDS_pept        385670..385912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /product="acyl carrier protein"
FT                   /note="BU352"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13056"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13056"
FT                   /db_xref="GOA:P57433"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57433"
FT                   /protein_id="BAB13056.1"
FT                   /translation="MKNIEERIKKIIFEKLDIKQEKIFNDASFIDDLGADSLDTVELIM
FT                   ALEEEFDIEISDEEAEKINTVQKSIDFIQKKNLKK"
FT   CDS_pept        385983..386621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="BU353"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13057"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13057"
FT                   /db_xref="GOA:P57434"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57434"
FT                   /protein_id="BAB13057.1"
FT                   /translation="MIKSKFIVIEGLEGAGKTNACICIKNLLKKNSIKNVLLVRQPGST
FT                   PIAEDIRRLIKKKFNDDNLIKETELLLMYAARIQLVEKKIKPALKNGIWVISDRHDLSS
FT                   LAYQGGGLGIPKKIIYQLQSLFLNNFIPDLTIYLDVSPEIGLARALKRNPLDLIESRSL
FT                   FFFKKTRRCYLEKSKLDKKTIIINANLNIKKVTQNITKKMLNWLNKQVI"
FT   CDS_pept        386618..387598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /product="DNA polymerase III delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="BU354"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13058"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13058"
FT                   /db_xref="GOA:P57435"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57435"
FT                   /protein_id="BAB13058.1"
FT                   /translation="MKLYPWLIKPYNNIVQQYQKKKAHHAILIKTPRGIGVSLLIWFIS
FT                   KWLLCLKPIGLNSCDKCHGCKLMSANNHPDWHNFTPEKNNLFSIESVRIINEKIFTCSR
FT                   QGGSKIIFLSDTGKLTESAINAFLKTLEEPPRKTWFFLVNYKNLNSHSTLNSRCLIYKL
FT                   FIPEEKKSLYWLKKETVKKNRSCLTALRINQGSPLYAKKFINSNLWIDRINFYECLHDS
FT                   FKKNNLLKILPLITEKDSQVKIDWICFLLFDSIKFYFNENDNLTNSDQIELIQFFSYNY
FT                   KNTILDTSIRTWLHCKYRLSNISGINCELLLSEQLLIWEKILNFS"
FT   CDS_pept        387632..388426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfH"
FT                   /product="hypothetical protein"
FT                   /note="BU355"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13059"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13059"
FT                   /db_xref="GOA:P57436"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57436"
FT                   /protein_id="BAB13059.1"
FT                   /translation="MFLIDSHCHLDRLNYNLPLENIEDVLKKSYQNHVKNFLTVSTCIS
FT                   NFYNIKKLFKKYNTIFYSCGVHPLNCKKELNLFHTIENLSNEIKKLSCIKDVIALGETG
FT                   LDYYYSSDTKKIQQDFFREHIRVAIKLKKPIIVHSRNASEDTIKILQEENAEKCKGVLH
FT                   SFTGDYNTACKLLDLGFYISCSGIITFKNSLELCKTIRKIPLNRLLIETDSPYLSPAPY
FT                   RGKGNQPAYLFYIAEYLSILKEIDIHALGHITTSNFRTLFNI"
FT   CDS_pept        388571..389956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsG"
FT                   /product="pts system glucose-specific IIBC component"
FT                   /EC_number="2.7.1.191"
FT                   /note="BU356"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13060"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13060"
FT                   /db_xref="GOA:P57437"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011299"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57437"
FT                   /protein_id="BAB13060.1"
FT                   /translation="MLPVSVLPIAGILLGIGSAHFNFLPDILSQIMAQTGGSVFSNMPL
FT                   IFAIGVALGFTNNDGVAALAAVVSYGILIQTLTAVEPIVLHTTIEVIKNKHLSDTGILG
FT                   GIIAGAISAYMFNKFYRIQLPEYLGFFAGKRFVPIISGLSAILIGVILSLIWPPIGHGI
FT                   QIFSKWAAYQNPILAFALYGLVERALVPFGLHHIWNVPFQMQIGEYTNSIGQVFHGDIA
FT                   RYMAGDSTAGNLSGGFIFKMYGLPGAALAIWHTSKKENKTKIGSIMISAALTAFLTGIT
FT                   EPIEFSFIIVAPVLYVIHAILAGLSFPLCIFLDMRAGTSFSHGFIDFIVLSGNSHHILL
FT                   FPIIGILYGLLYYILFYLFIINFNLDTPGRENIKNNILEKDNNEIAPYIITALGGKNNI
FT                   KNLDACITRLRITVSDISKVKQKDLKNIGAAGIIISGSGIQVVFGTRSENIKTAMDECI
FT                   KNI"
FT   CDS_pept        389976..390320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfF"
FT                   /product="hypothetical protein"
FT                   /note="BU357"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13061"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13061"
FT                   /db_xref="GOA:P57438"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57438"
FT                   /protein_id="BAB13061.1"
FT                   /translation="MQDNSIFKNIIQRKIPANIVYQDKKITAFEDIKPKAPVHILIIPN
FT                   FFISSSNDINKKNKWIMSHMFYIAVKIAKQKKINQEGYRIIINCNEYGGQEINYLHMHL
FT                   LGGKKLKSFS"
FT   CDS_pept        390397..390906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycfM"
FT                   /product="hypothetical protein"
FT                   /note="BU358"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13062"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13062"
FT                   /db_xref="InterPro:IPR014094"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57439"
FT                   /protein_id="BAB13062.1"
FT                   /translation="MILFIIFFINSCSYSKNIENTFSKVKKTNFILLKFDSAIEKIISE
FT                   MLKPNHILIFNKKLFFIDLLENQTNIFIDREKITDLIKHKISIKNNDIHFLEKNMIKKN
FT                   KKKIGILEIKKSLDTSTAIFFSRNNNVEYYIHSCISGKNEPFLLKIELILVKTGEIVFM
FT                   KEERCY"
FT   CDS_pept        complement(391155..392303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompF"
FT                   /product="ompF-like porin"
FT                   /note="BU359"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13063"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13063"
FT                   /db_xref="GOA:P57440"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57440"
FT                   /protein_id="BAB13063.1"
FT                   /translation="MTNRKSLAMVIPMLLAASNGVNALEVFHKHGNKLELYGSINPNHK
FT                   LNHSFLANKITSHKDDTNAILGLSGEVNIADELFSYATIEYGIDLSVPEQLLDKQQPNN
FT                   LRLGYAGFKYGNWGSIDYGRNYGVLHDVQALTNRSPYINKDSIFSYNDNYMTGRSNSLL
FT                   TYKNDDIFGLIDGMSFILQYQDQSENRAQNQTNGPGWGISIKYETDVGLTAIGSCFSSQ
FT                   RFQSDKSNQDNKLTPSVGAYGLGFKYDANDIYIAAFYGEGRNLTPSLNILSDNNASKDQ
FT                   PYINKTQNIEAIAEYNFHSGFHPSLSYLDSKGQNLNIKDATTVPKNLELAKQINISTRY
FT                   EFNKNISTYMNYTINLLKSDNVIKEQNIPTDNTIGAGIVYHF"
FT   CDS_pept        complement(392443..393843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /note="BU360"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13064"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13064"
FT                   /db_xref="GOA:P57441"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57441"
FT                   /protein_id="BAB13064.1"
FT                   /translation="MNRVSISDIYKDDIIVNSLITVCGWVRNRRSSKSGFSFITIYDGS
FT                   CFNSIQVIANNTLPNYYKEILHLTTGCSVMLSGKLILSIGDKQKYEIQLKKIKVLGWVE
FT                   NPETYPISSKKHSTEYLREVAHLRSRTNLIGAIARIRNYILHSLHHFFYKEKYYWVPTP
FT                   IITSLNTEGAGEMFRVSTLDMENIPKNLDSSVDFKKDFFGKESFLTVSGQLNLETYACS
FT                   LSKVYTFGPTFRAENSNTGRHLAEFWMLEVESAFTDLNDISDFAECMLKYVCKSLLKKC
FT                   ITDINFLENYTNSNIVDRLEKFLLVDFVRIDYVEVINILLDSKIKFNNSVFLGIDLSSE
FT                   HERFLVENYFKIPVIVKNYPKELKAFYMRLNNDKKTVAAIDILVPNVGELIGGSQREER
FT                   IAILDERLLELGLKKEDYWWYRDLRRYGTVPHSGFGMGFERLISYFTGITNIRDLIPFP
FT                   RTVNNAYF"
FT   CDS_pept        complement(393991..395190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="BU361"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13065"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13065"
FT                   /db_xref="GOA:P57442"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57442"
FT                   /protein_id="BAB13065.1"
FT                   /translation="MKRYDYPIVKTLLDTDAYKLHMQQAVFYHYKNVNVVAEFLCRGDN
FT                   FLGCYANILLDQISMMRSLSLSHEEYVYMTSFPFFKKEYLHWLKKFRYNVSQVKINSYQ
FT                   GRLHIRISGLWKEVILWEVPILALISEVFHGNFSPEITSQSALQYLDIKLKKFFNRTKY
FT                   IDLSHLKIVDFGTRRRFSYDVQYSIVKRLKESFPFLIGSSNYHIARILKIKPVGTQAHE
FT                   WFQAHQQIGSNLKNSQILALQKWLYQYKNHLGIALTDSITMDAFLDDFNLHFASFYQGI
FT                   RHDSGDPVKWGEKALKHYEKLGIDPCTKTLLFSDNLDFKKIISLYKKFHKKINVIFGIG
FT                   TKLTCDIPYVKPLNIVIKLVECNGKPVAKISDSPGKTFCLDRIFLKNLCQVFNVSLKNR
FT                   "
FT   CDS_pept        395612..396475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /note="BU362"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13066"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13066"
FT                   /db_xref="GOA:P57443"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57443"
FT                   /protein_id="BAB13066.1"
FT                   /translation="MGLIFDNKLGTAAGIDKNGEYIDALSKLGFGFIEVGTVTPLPQVG
FT                   NPKPRMFRIVSMEGIINRMGFNNLGIDNLIRNIKKSNFKGIIGVNIGKNKSTSLENSVD
FT                   DYLICIEKIYCYAGYIAINISSPNTTNLRNLQYGILFKKLLYKIKKKQKELHKKYLKYV
FT                   PIAIKISPDLSIKELVDISKQLIRYKIDAVIATNTTLDHSSLFGLKNSSEQGGLSGLPL
FT                   QKKSTNTISILSKSLQKKIPIIGVGGINSINSAKEKIESGATLIQIYSGLVYHGPKLIK
FT                   KIINHI"
FT   CDS_pept        396651..398756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbY"
FT                   /product="hypothetical protein"
FT                   /note="BU363"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13067"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13067"
FT                   /db_xref="GOA:P57444"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR017244"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57444"
FT                   /protein_id="BAB13067.1"
FT                   /translation="MNDLFASTNFGTEKLLEKELLSLGVSDIKIIKGGIYYKSNDLLLY
FT                   KSLMWSRIASRIYLCIKIFTINNIDDLYDHVYSINWTEIFHIHNTFLVNFKGTNNFIRN
FT                   SLFGALVTKDAIIDQFQNKYASRPNVNLIEPDIRIKLVLLNNNILHIMLDLSGEPLNKR
FT                   GYRQFYNTTPIKENLATAIVLSSGWNENTPMIDPMCGSGTFLIEAAMISSDRAPGLKRL
FT                   KWGFQFWKKYNKNLWKKVLEEAEEKFKIGIKKCFQNYFIGYDYDPEIIKKAKKNASNAG
FT                   VLKIIQFLTKDVNNLKNVYHKEQEGIILSNPPYGERYQTENKLVGLYVQLGITAKKYFK
FT                   NWKLSIFSASTFLLDFLQMQSHEKYFFKNGPLNCIQKNFLIFFKNSSITTNEFKDRLNK
FT                   NFKKLKKWINSEKLESFRVYHADLPNYNIIVDVYDKWVVIQEYQAPKSIDHNKAFKRLC
FT                   DAIYYTKEVLSISINNIVLKTRIKNKNKTQYKKLFNSNDFITIKEYHAKFLVNLTDYVD
FT                   TGLFSDKRLVRKLLGVLAKGKDFLNLFSYTGTATVYAGLGHANSTTSVDISNTYIKWSA
FT                   RNMSLNNLTSSQHNFIQYDCLKWIKKTNQKFDLIFINPPTFSNSKKMQQSFDLKRDYLD
FT                   VMIHLKKILRHDGTIIFSSSTRNFEINFNCIKKMQLHAKKITNKIQSKDHLKNSNIYHS
FT                   WLIKHIK"
FT   CDS_pept        398776..400566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uup"
FT                   /product="ABC transporter ATP-binding protein uup"
FT                   /note="BU364"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13068"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13068"
FT                   /db_xref="GOA:P57445"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57445"
FT                   /protein_id="BAB13068.1"
FT                   /translation="MSLINIHNASLSFSNLQILEKSTFHINKNERVCLIGKNGAGKSTL
FT                   LKIINKKQDLDEGQIIYKKNTTTAYLEQNNPKNLNISIYDFIALGLKEHEKNKKKHTNE
FT                   IVKIEKIIELIKLNKNTLLSHLSGGLLRKVALGRVLVREPDILLLDEPTNHLDMKTIKW
FT                   LETFLKKFSGSILFVSHDRNFIQNVSTRIIDLDRGKLVSWPGDYENFIKLKNESYRIEK
FT                   IQKQLFDKNLEKEEQWIRKGIKARSTRNEGRVKKLKILQKEQKDYKKIEKINNIEINQS
FT                   KNYLGKIIFKLDNIDFLVNNKIIIKNFSSIIQHGDKLALIGDNGCGKSTLIKIIIGENK
FT                   PQKGKIYIGKGLKISYFDQNRSFLNPNKSIIENIDYGKEKILLNSREQHIIRYLKNFLF
FT                   KPNQLKSLVKTLSGGECNRLLLAQLFLKPSNVLILDEPTNDLDLDTLQLLEKIIIAYKG
FT                   TVIIVSHDKTFIKNTAKKCWFFEKNGFINTHFSQYDSLKKEKNNFHKEKIQKNKSKINL
FT                   AIKIKNNFKKELNAILYEIETIELDIKTLQKKVNEPDFFKKTLEEKLPTLKMLAQKERK
FT                   LGKKILFWEKLEKNIINTKI"
FT   CDS_pept        complement(400570..401544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceA"
FT                   /product="hypothetical protein"
FT                   /note="BU365"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13069"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13069"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57446"
FT                   /protein_id="BAB13069.1"
FT                   /translation="MSILHNIVSKKELKRRMFFETEPRLTLSFYKYFFIKNTQEYRDRL
FT                   YKTFYKYNVLGRIYVASEGINAQISVPKKYYSILKKFLYNFDIELNNLRINKSLDNEKS
FT                   FWVLCVKIKKKIVQDGIKEHFFNPNNVGIYIQSEQVNSMLNDKKTIFIDMRNSYEYAIG
FT                   HFENAIEIKSITFREQLKKVIQLMAYAKNKKIVMYCTGGIRCEKATSWMLFNGFKHVYH
FT                   LEGGIIGYVHDARKNGLPVLFKGKSFVFDNRMSEKISDEVISYCKQCGKSSDVYINCKY
FT                   SSCHLLFIQCENCSVKFHSCCSLECMKKYKFYMLNNDLKKISY"
FT   CDS_pept        complement(401601..404468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="BU366"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13070"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13070"
FT                   /db_xref="GOA:P57447"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57447"
FT                   /protein_id="BAB13070.1"
FT                   /translation="MEKIYNPKHIEESLYFFWEKNGFFKPNHLEKSTFCIMMPPPNITG
FT                   SLHMGHAFQQTIMDILIRYHRMQGKNTFWQVGTDHAGIATQILVERQIFEKEQKTKKDY
FT                   SRDDFIKKIWEWKKQSSNIITKQMRRLGISVDWDYEKFTLDPDISNSVREAFIILYKNN
FT                   LIYQKKKLVHWDSKLETVISDLEVEHRLIKGKKWFIRYPIIENDMSLRSKVKYLIVSTT
FT                   RPETLLGDTAIAVNPEDYKYNQFIGNHVSCPLTNRIIPIIKDRYADLEKGTGCVKITPA
FT                   HDFNDYKVGLHHKLPMINIFTFDGRIKSTAEVYNYKGEKSNQYSTCIPMQFQHLDILSA
FT                   RIEIIKEITKLGFLEKIEECNVTVPYSERSGVIIEPMLTNQWYLKTSTLAKVALNAVKD
FT                   KKIKFIPQQYESMYSSWMNNIEDWCISRQLWWGHRIPVWYDDQKNIYIGQNEKEIRQAY
FT                   SISENVLLKQENDVLDTWFSSGLWTFSSLGWPKKTTFLKTFHPTNVLVSGFDIIFFWIA
FT                   RMIMLTMYFMKDKHNNPEVPFKNIYITGLIRDEFGKKMSKSKGNVIDPLDMIDGISLSE
FT                   LIKKRTNNLLQPNLSDKIIQRTIKQFPEGIKSTGTDALRFTFSALASSTRDIQWDMNRL
FT                   KGYRNFCNKLWNASRFVLINTQDHNFSKFDVKRKMLLINKWILIEFNNTVKLYRESLDT
FT                   YRFDIAANILYDFIWNIFCDWYLEFVKIVIKLGSSKEVYCTKNVLVYVLELLLKLAHPI
FT                   MPFITETIWQRIKLIQNISEKTIMLQDFPEYNHKLFDKKILVQMNWMKKIIVFLRNIRT
FT                   NMNVSSTKLLPLFLYNINSEQEKVIKENISLIKNISFLDKITILSEKYDKDLCIKEIID
FT                   GAEIIIPILKLVDTKVELKRLVKEQKKTELNIFKIKTKILNKDFLSYAPTKIVTQEKNK
FT                   LLKLNEINLKLSEQIKIFRNMSYKK"
FT   CDS_pept        complement(404545..406044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /product="aminopeptidase A/I"
FT                   /EC_number="3.4.11.1"
FT                   /note="BU367"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13071"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13071"
FT                   /db_xref="GOA:P57448"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57448"
FT                   /protein_id="BAB13071.1"
FT                   /translation="MNFFIKSCFLDKEKTDCIVVSVFELSELSDSAIYLDKCSNGHITS
FT                   LIKLGDIQGKIGDTLMLYKVPKILSKRILLVGCGKKDEINIIRFKKILKNTIHAIKKKS
FT                   ITNIVYSFSNINIDNIYWMIRRMVLSLKESLYETIKINNINIKNTNIHSITLNIIKKND
FT                   LFIAKTALKHALAIDHAITSTKNLSNLPPNICNPLYLSYKAQELSKKYENNIVVEIIDI
FT                   KKMKELGMNAYIAVGNGSKNKPFMSVIKYSGNNIVNKKIIAFVGKGLTFDSGGISIKPA
FT                   LHMHEMKYDMCGAAAVYGTLIMAAELQLPLTVIGILSGCENMVGSHSFRPGDVLTTMSG
FT                   QTVEILNTDAEGRLVLCDSLTYLERFSPDIVIDVATLTGACVTALGESVSGLFSNNEEL
FT                   SNQLLHASQETDDKIWSLPLFSEYHKELNSDIADFSNIGRGKAGAITAACFLSKFTKKY
FT                   NWAHLDIAGTAWKSGKKSGATGRPVELLCQFLLNQSNYIYN"
FT   CDS_pept        406304..407320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /product="ornithine carbamoyltransferase chain F"
FT                   /EC_number="2.1.3.3"
FT                   /note="BU368"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13072"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13072"
FT                   /db_xref="GOA:P57449"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57449"
FT                   /protein_id="BAB13072.1"
FT                   /translation="MNNLYQRDCLRLLDFTSLELQNIITLAQKLKQYKKNNKEIQLLKK
FT                   KNIALIFEKESTRTRCSFEVAAFDQGAHVTYLGPGSTHLGTKESIEDTAKILGRLYDGI
FT                   QYRGHHHSTIEILAKNSKVPVWNGLTEKFHPTQLLADLLTIKEIFPERKFYEIKCAYVG
FT                   DAHNNMGNSLLEAASLVGLDLRLVAPKECWPEKNIFKFCKEQMKNKKGNIICTENINEG
FT                   VKNVDFIYTDVWVSMGESQEVWKKRIELLSSYQVNSLMLKITNNPQVKVLHCLPALHDQ
FT                   KTCTVKSILKKYGFKNGMEITDEVFQKNQKIIFEQAENRLHTIKAILVSSLLKTIKF"
FT   CDS_pept        407439..408371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /product="aspartate carbamoyltransferase catalytic chain"
FT                   /EC_number="2.1.3.2"
FT                   /note="BU369"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13073"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13073"
FT                   /db_xref="GOA:P57450"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57450"
FT                   /protein_id="BAB13073.1"
FT                   /translation="MRNSLYKKNIISINDLQRNELELVLNKSAMLKKTPQPNLLKNKVI
FT                   ASCFFEASTRTRLSFETAIYRLGASIVGFSDGNNISLEKKGETLTDTISVISSYVDAII
FT                   IRHPQEGSARLAAEFSNKKPIFNAGDGANQHPTQTLLDLFTIQETQNRLTQLNIAIVGD
FT                   LKYGRTVHSLTQALAKFKHNKFYFISPDALKMPNYINNMLDKKEIYWKRHNNIEEIISE
FT                   IDILYMTRIQKERLDSTEYANAKSKFVLRAAILKNARNNMKILHPLPRIDEIDRDVDYT
FT                   PYAWYFKQAANGIYARQAILSLVLIEKHL"
FT   CDS_pept        408379..408843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrI"
FT                   /product="aspartate carbamoyltransferase regulatory chain"
FT                   /EC_number="2.1.3.2"
FT                   /note="BU370"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13074"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13074"
FT                   /db_xref="GOA:P57451"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57451"
FT                   /protein_id="BAB13074.1"
FT                   /translation="MEINKLQVEAIKSGSVIDHIPEYIGFKLLSLFRFTETEKRITIGL
FT                   NLPSKKLGRKDIIKIENTFLSDEQINQLAIYAPHATVNYINEYNLVRKVFPTLPETIDR
FT                   ILICPNSNCVTNHHLINSSFILKEDQFFNMNLKCKYCEKEFYKKIVLSCQ"
FT   CDS_pept        408889..409275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhaR"
FT                   /product="hypothetical protein"
FT                   /note="BU371"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13075"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13075"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57452"
FT                   /protein_id="BAB13075.1"
FT                   /translation="MNHIIETKDAPKPIGPYSQALKIDNFIILSGQIPIDVISNQIPEN
FT                   IAEQTYLVLKNIKLILVHAKFQVHNIIKTTVFTTDLKKINIINEIYKKFFIDNKSNFPA
FT                   RSCVEVQKLPKNVKIEIEAMAFKK"
FT   CDS_pept        complement(409362..411167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /product="ATP-dependent RNA helicase deaD"
FT                   /note="BU372"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13076"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13076"
FT                   /db_xref="GOA:P57453"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="InterPro:IPR034415"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57453"
FT                   /protein_id="BAB13076.1"
FT                   /translation="MTHIESTFSFLGLNPFIIQSLNEMGYVKPSPIQASCIPLLLEGRD
FT                   VLGMAQTGSGKTAAFSLPLLHNLNINLKAPQILVLAPTRELAVQVAEAFSDFSKYMIGI
FT                   HVLPLYGGQRYELQLRALRQGPQIVVGTPGRLLDHLKRGTLNLSNLHGLVLDEADEMLR
FT                   MGFIEDVETIMAQIPKEHQTALFSATMPEAIRRISKRFMRNPKEIKIQSNITTRPDIKQ
FT                   SYWMVYGRKTDALIRFLEAEDFSATIIFVRTKNATLEVSEALERNGYNSAALNGDMNQA
FT                   LREQTLERLKNGRLDILIATDVAARGLDVDRISFVINYDIPMDSESYVHRIGRTGRAGR
FT                   AGRALLFVENRERRLLRNIERTMKQSIPEVQLPKVELLCQRRLEQFAKKVQQQLESRDL
FT                   DEYSALLDKLYSTDDLDIKTLAAALLKMAQGERPLIIKPDVIKRQSRDLLFQDDRRRED
FT                   NRNSRTRRDRRDINKDAELYRIEVGRNDGVEVRHIVGAIANEGNINSRNIGNIKLFSSY
FT                   STIELPKGMSKDLLQTFNRTRILNKPINMKLLRDSRHYENKTTHRSIFNKDKNSNRRVS
FT                   DGSFNKSNSPKKTEFKSSFFRRRNV"
FT   CDS_pept        complement(411548..413671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="BU373"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13077"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13077"
FT                   /db_xref="GOA:P57454"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57454"
FT                   /protein_id="BAB13077.1"
FT                   /translation="MLNPIVRKFQYGQHTITLETGVIARQANAAVMASMDETAVFVTVV
FT                   GQKKIHTGQKFFPLTVNYQERTYAAGRIPGGFFRREGRPSENEILTARLIDRPLRPLFP
FT                   KKFLNEIQIIATVVSVNPQINPDIISIIGASAALSLSGIPFYGPVGAARVGYINNQYIL
FT                   NPISDDMKNSSLDLVVSGTQNAILMVEAESKILSEEKILGAIIFGHQQQQVVINNIRSL
FT                   SNEASKLPWVISYPETNKTLELKIINSFEKNISDAYVIFNKQDRIEKLNSIKENIIKLF
FT                   LDENSNIDTLEIEDIFQKIEKKVVRKRILSNQTRIDGREKDMIRALDVRTGILPRTHGS
FT                   ALFTRGETQSLVSVTLGTSRDAQNLDELLGDRIDNFLFHYNFPPYSVGEIGMVGSPKRR
FT                   EIGHGRLAKRSLLAVMPTLENFPYTIRVVSEITESNGSSSMASVCGASLALMDAGVPIK
FT                   SAVAGISMGLVKEGNQHVLLSDILGDEDHLGDMDFKVAGTEEGITALQMDMKIEGITNE
FT                   IIHSALNEARLARLHILNVMNQALNESRSEISEFAPRIHIIKINPEKIKDVIGKGGSVI
FT                   RMLTEETGTIIEIEDDGTVKISSTVKEKAKNAIRRIKEITAEIEVGRIYSGKVTRIVDF
FT                   GAFVSIGLGKEGLVHISQISDKRVDKVSNHLKIDQIISVKVLEIDRQGRLRLSIKEIDS
FT                   SILSNKSINNSII"
FT   CDS_pept        complement(413873..414142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /product="30S ribosomal protein S15"
FT                   /note="BU374"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13078"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13078"
FT                   /db_xref="GOA:P57455"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57455"
FT                   /protein_id="BAB13078.1"
FT                   /translation="MSLSAIDTKKIILKYGKSEQNSGITEVQVVLLTNQINYLQIHFSQ
FT                   HKKDHCSRRGLLNMVSKRRKLLDYLKKKNISRYSALIEDLHLRR"
FT   CDS_pept        complement(414247..415185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /product="tRNA pseudouridine 55 synthase"
FT                   /note="BU375"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13079"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13079"
FT                   /db_xref="GOA:P57456"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57456"
FT                   /protein_id="BAB13079.1"
FT                   /translation="MFFHKKRDVHGLLLLDKPQGISSNNALQKVKMLFSAKKAGYIGTL
FT                   DPLATGMLPICFGECSKFSHYLMESNKKYHVIAKLGEKTSTSDSDGIIIKKRPILINSF
FT                   KIKSALKELTGLIEQIPPMYSAIKHNGVPLYKYARQGLNIKRSIRKVLIHDISSIHQEK
FT                   NLIEFKIFCSKGTYVRTLVEDLGEKLGCGAHVIFLRRLEMASYLHSQLVTISYLHKLLR
FT                   KEKNNNFNFFEKIDNLLMPIDSPVSFLPKVYLFPQQSYNFQLGQTVIFFSDIKNSLVRV
FT                   IALENNKFIGLGRINTEELLIPYRLVSRSIN"
FT   CDS_pept        complement(415223..415585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /product="ribosome-binding factor A"
FT                   /note="BU376"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13080"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13080"
FT                   /db_xref="GOA:P57457"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57457"
FT                   /protein_id="BAB13080.1"
FT                   /translation="MEKLFNRSDRIAQELQKKIAAIIQHSLKDPRIKTIITVSEVQVSK
FT                   DLSYAQIFVSFLESDNNEKVKKKITILNRASSYIRKLLCKRMKLRIVPNIIFHHDDSFL
FT                   KGNKISCILENLTKKE"
FT   CDS_pept        complement(415631..418225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /product="translation initiation factor IF-2"
FT                   /note="BU377"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13081"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13081"
FT                   /db_xref="GOA:P57458"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57458"
FT                   /protein_id="BAB13081.1"
FT                   /translation="MPDISLKVLSNEIKISIQELIKELSIIGITKTEDNYINVLEKNIL
FT                   LKHLESKKKYSLDTLVLQRKTRSTLRISTVGGKNKSVQVEVRKKRAYVKNNKFENESFL
FT                   NEKKVIKHSMQKTSSLKNKEKKYIKNIEKIELNKSDSRSLNTKKENKLKISNKDEQNKK
FT                   FNQHRESNSFDLNHKKRIKENKDIRISHKEEKQDYHLTTFLHARQAEDENDREVEIDKR
FT                   NHGRILKNYRQKKNNKNFHNGRYNKEEIRTFNRNKKNSKQKNKPILLQQVFQKPESIIN
FT                   RDVIISNTITVSDLANKMAIKSSEVIKNMMNMGIIGTINHVLDQDTAQLIAEEMGHKVI
FT                   VHRENALEELIMKDRDTGNDVSAIRAPVVTIMGHVDHGKTSLLDYIRSTKTAFYEAGGI
FT                   TQNIGAYHVKTDLGSITFLDTPGHSAFTAMRSRGVQITDIVILVVAADDGVMPQTIEAI
FT                   QHAKEANVPVIVAINKIDKTDSDIDKVRNDLMKYNILSEEWGGENIFVSVSAKTGKGIN
FT                   KLLNVILLQAEMLELKAVTTGMAEGIVVESFLDKGRGPIATVLVKKGQLKKGDVILCGF
FT                   EYGRIKSLRDASGNEVFSAGPSIPVEVLGLSKVPFSGDVVTVVRDEKKAREVASYRKEK
FT                   SREKKLSNQNRINLENMFDDINKNNVSELKIILKSDIQGSLEAISGALLKLSTEEVKIK
FT                   IIGLGIGGITETDASLALASNAIILGFNVRADTSAKKIINSEHLDLRYYSVIYDLLDEV
FT                   KAAMTGLLSPEYKENIIGLAEVRNTFKSPKFGLIAGCMVTEGVIKRSNPIHILRNNIVI
FT                   YEGELESLRRFKEDVNEIRNGLECGIGIKNYNDIRVGDIIEVFEVREMKRIL"
FT   CDS_pept        complement(418243..419733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /product="N utilization substance protein A"
FT                   /note="BU378"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13082"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13082"
FT                   /db_xref="GOA:P57459"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57459"
FT                   /protein_id="BAB13082.1"
FT                   /translation="MNKEILAVVEAVSNEKSLPREKIFEALEMALATATKKKHEQEIDI
FT                   RVSINRKTGGFTTFRRWMVVETVTQPTREITLEAACFDGEKVYLNDYIEEQIESVDFDR
FT                   ITTQTAKQVIVQKVREAERAMLVEQFRKYTGQIITGIVKKINRDNIMLDLGNNAEALIL
FT                   REGMLPRENFRPGDRIRGILYGVYPEARGAQLFISRSKTEMLTELFRIEVPEIGEEVIE
FT                   IKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELCGERIDIILWDDNPA
FT                   QFVINAMAPADVASIVVDEDCHTMDIAVDINNLAQAIGRNGQNVRLASQISGWELNVMT
FT                   TEDLHSKHKEEAHTAFNFFKKNLNINENIIKILVKEGFSSLEELAYIPFNELLEVKNLT
FT                   EDQAKKVREGAKSKLLLMESDKNKMIIQERKTEKELLKINGMNAVLALQLAEKNIFTIE
FT                   ELADQGIDDLTDIKNLNSEQAGLLIMTARNICWFSSKV"
FT   tRNA            complement(420072..420157)
FT                   /product="tRNA-Leu (GAG)"
FT   CDS_pept        complement(420206..420535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /product="protein-export membrane protein secG"
FT                   /note="BU380"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13083"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13083"
FT                   /db_xref="GOA:P57460"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57460"
FT                   /protein_id="BAB13083.1"
FT                   /translation="MYLFFLIVFIFISFSLIFFILLQPGKGLNNTVHSHTKNNIKFFNS
FT                   IGTNNFITKIIKILAFFFLLISIILCNINSKRIDSDFFWEDNQNNTITKKHVLDKKKLN
FT                   LDIPN"
FT   CDS_pept        complement(420797..422131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrsA"
FT                   /product="mrsA protein"
FT                   /note="BU381"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13084"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13084"
FT                   /db_xref="GOA:P57461"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57461"
FT                   /protein_id="BAB13084.1"
FT                   /translation="MTFLQYFKTDGIRGKVGVNPITPDFLLKLGWSIGIVLGKNKTQKI
FT                   IIGRDTRISGTMLQSILEFGILSTGVSTLLAGCMPTSAISYFTKSLNASAGIVISGSHN
FT                   PFYDNGIKIFYKNGVKLTKEIEFSIEQKVQHTFLYPDYVNFGHSNNILDPESLYIDFCK
FT                   KNFPKDLNLSKFTIILDCANGATFKIAPKIFEDLGARVITVAINPNGVNINQNSGSTNI
FT                   LMLKKIVLSESADLGLAFDGDGDRVIMVDHLGNQVDGDQIIYIIAKEYLKENKLKGGVV
FT                   GTSMTNMGVILGLKKLGIPFCPAQIGDRNVYEKIKEKKWILGAEKSGHIVLLDKHSTGD
FT                   GIIASLQVLLTMINNHMTLYDLSNQIKLFPQVFLNIFLKQDKDFEKDIKIQNILTQYKN
FT                   ILGQNSRVLVRRSGTEPCIRIMVEGEDYLKVYELAQYIGKTIKLL"
FT   CDS_pept        complement(422351..424141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflB"
FT                   /product="cell division protein ftsh"
FT                   /note="BU382"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13085"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13085"
FT                   /db_xref="GOA:P57462"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57462"
FT                   /protein_id="BAB13085.1"
FT                   /translation="MSIFQNFNTNDVNNHKVDYSTFLSEVNQDQIREAYINGRMISVTK
FT                   KDSSKYTTYIPINDPKLLDNLLVKRVKIIGAIPEEPSLFISILISWFPMLLLIGVWIFF
FT                   MRQMQMGGGKGAMSFGKSKARMLSEDQIQTTFADVAGCDEAKEEVSELVEYLKEPSRFQ
FT                   KLGGKIPKGILMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMF
FT                   EHSRKSAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFDGNEGIILIAA
FT                   TNRPDVLDPALLRPGRFDRQVIVALPDIRGREQILKVHMRKVPLSKDVDPMIIARGTPG
FT                   FSGADLANLVNEAALFAARLDKRVVSMLEFERAKDKMMMGSERRSMVMSDFQKESTAYH
FT                   EAGHVIIGRLVPDHDPAHKVTIIPRGRALGVTFFLPESDTLSISRQKLESQISTLYGGR
FT                   LAEEIIYGAKNVSTGAYNDIKIATSLAKNMVTQWGFSEKLGPLLYAEEEGEIFLGRSVA
FT                   KAKHMSDETARIIDEEVKLLIEINYSRARNILNENIDILHAMKEALIKYETIDAFQIDD
FT                   LMKRREVRQPKGWIETDTNK"
FT   CDS_pept        complement(424252..424872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsJ"
FT                   /product="cell division protein ftsJ"
FT                   /note="BU383"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13086"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13086"
FT                   /db_xref="GOA:P57463"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57463"
FT                   /protein_id="BAB13086.1"
FT                   /translation="MIVQKKKHRSNRWLLEHFQDQYVKAAKKNNIRSRAWFKLEQLDKN
FT                   NKIFKIGMNVIDLGAAPGSWSQYASNRIGKKGRIIACDILPIRPITGVDIFQGDFRNKK
FT                   TLNLMLNTFSNITFHLVMSDMAPNITGNFSIDMPRIIELCKLALKISEHVLSKNGIFLL
FT                   KSFQGEGFNELYKEIKMLFKKIKICKPKTSRTRSREIFILATR"
FT   CDS_pept        complement(424946..425425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /product="transcription elongation factor greA"
FT                   /note="BU384"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13087"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13087"
FT                   /db_xref="GOA:P57464"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57464"
FT                   /protein_id="BAB13087.1"
FT                   /translation="MINLIPMTVRGAEKLRRELKKLKSINRPRIIAAIAEAREHGDLKE
FT                   NAEYHSAREEQSFCEGRIKEIELKLSNSQIIDVTKISNNGRVIFGSTVSILNIKNNEKF
FT                   TYRIVGDDESDFKKNLISINSPIARGLIGKEINDVVIICTPGGDVEYKILKINYI"
FT   CDS_pept        425949..426191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbA"
FT                   /product="hypothetical protein"
FT                   /note="BU385"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13088"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13088"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57465"
FT                   /protein_id="BAB13088.1"
FT                   /translation="MDNQEIKLLLIKKLNLEQANITGDSNHIKIIAIGNIFKNVSQVKR
FT                   QQIIYAPLIDMIKEKHIHAVSIMSYTPEEWEKTKK"
FT   CDS_pept        426253..427503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="BU386"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13089"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13089"
FT                   /db_xref="GOA:P57466"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57466"
FT                   /protein_id="BAB13089.1"
FT                   /translation="MEKLYVEGNKILNGHVIISGSKNAALPILFMTILTEGKIKIGNIP
FT                   NLTDINIALKLLVYLGVKITGNETLCIDASSINIFCPPYNLINKIRASIWMLGPLLARF
FT                   GKAKIFLPGGCKIGSRPIDLHLNGLTQLGATINLKNNCIDAYVKGRLQGKYILMEKISV
FT                   GATITIMSAATLAKGSTIIDNAACEPEIVDIAKFLNTLGADIIGAGSNKICIKGVLKLT
FT                   GGTHQVIPDRIETGTFLVAAAASQGHITCHKTEPKHLTNVLMKLTEAGAKIKTGKDWIK
FT                   LDMRGKRPKSLNICTAPYPGFPTDMQAQFALLNSISKGIGTITETIFENRFIYTSELIR
FT                   MGAKIKIKNNTIICYGIPKLISSNVFSSDLRASATLILAGCIAAGITIVNHTYHLVRGY
FT                   ESFPKKLNKIGANIKII"
FT   CDS_pept        427642..427968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /product="50S ribosomal protein L21"
FT                   /note="BU387"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13090"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13090"
FT                   /db_xref="GOA:P57467"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57467"
FT                   /protein_id="BAB13090.1"
FT                   /translation="MYAVFISGGKQYRVVKNQIIRLEKLNSPLGTTIEFDKILMLFDKD
FT                   SIKIGTPFVEGGTIKAHIQNHGRLKKIKIIKFNRRKHYKKQQGHRQYFTDVKIIDINSI
FT                   KGEV"
FT   CDS_pept        427973..428227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /product="50S ribosomal protein L27"
FT                   /note="BU388"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13091"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13091"
FT                   /db_xref="GOA:P57468"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57468"
FT                   /protein_id="BAB13091.1"
FT                   /translation="MAHKKAGGSTRNGRDSNAQRLGVKCFGGQLISAGSIIVKQRGTKF
FT                   HPGKNVGCGKDHTIFAIVKGKVEFKKKGLKKRTYINIIN"
FT   CDS_pept        428379..429383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbZ"
FT                   /product="hypothetical 43.3 kD GTP-binding protein in
FT                   dacB-rpmA intergenic region (F390)"
FT                   /note="BU389"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13092"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13092"
FT                   /db_xref="GOA:P57469"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57469"
FT                   /protein_id="BAB13092.1"
FT                   /translation="MKFIDQAIIHVIAGNGGNGCVSFRREKYIPKGGPDGGNGGDGGNI
FT                   WLEANNNLNTLIDLRFKKKFQAQNGQNGSSRKSSGKKGDDIKIHVPIGTKVINYQTREI
FT                   IGDLIQHKQKMLIAKGGWHGLGNARFKSSTNRTPRQSTLGSIGEKRDIQLELMLLADVG
FT                   TLGMPNVGKSTLVTNISGAKTKISDYPFTTLHPVLGSVNIQKNKKFIIADIPGIIKGAS
FT                   YGAGLGIRFLKHLERCKLLLHIIDLVPQNNCHPSDNIKTVLNELKKYSLKLYNKPRWFI
FT                   FNKIDLLSVEELNQIIKEIIFQFKIHEKYYLISSMKKIGIKKLCSDITKYLKK"
FT   CDS_pept        complement(429451..429843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /product="30S ribosomal protein S9"
FT                   /note="BU390"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13093"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13093"
FT                   /db_xref="GOA:P57470"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57470"
FT                   /protein_id="BAB13093.1"
FT                   /translation="MIQTQNYGTGRRKSSSARVFLRSGNGEIVVNKRSLNEYFGRETSC
FT                   MIVRQPLELVDMVDKFNIYITVKGGGISGQAGAIRQGITRALIKYNQTLRFELRKAGFV
FT                   TRDSRQVERKKVGFRKARKRPQFSKR"
FT   CDS_pept        complement(429864..430292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /product="50S ribosomal protein L13"
FT                   /note="BU391"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13094"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13094"
FT                   /db_xref="GOA:P57471"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57471"
FT                   /protein_id="BAB13094.1"
FT                   /translation="MKTFSIKSSNIKRHWYYVDATNKILGRLASALSFHLRGKHKTEYT
FT                   PHLDTGDYIIVINASKILVTGNKRINKIYYHHTGYVGGIKQSRFEEMISSHPERVIEIA
FT                   VKGMLPKGALGRSMFKKLKVFSNENHEHIAQCPQLLNI"
FT   CDS_pept        430544..431701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /product="chorismate mutase / prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /EC_number="5.4.99.5"
FT                   /note="BU392"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13095"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13095"
FT                   /db_xref="GOA:P57472"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR010952"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57472"
FT                   /protein_id="BAB13095.1"
FT                   /translation="MPANNSLLIFRDEINNIDKKIVKLLAERKNLVFKIAQSKIENNQA
FT                   IRDIEREKKMLQKLIFLGKKYNLKSEYITQLFQLIIEESVATQKKLLKKFCNHNKLIPA
FT                   NFSFLGPKGSYSHIAAYKYADLNFQKCITNECSTFEEVVLSVENNQSDYAVLPIENTCS
FT                   GSINEVFDILKKTNLFIIGEINIFINHNLLTLKKIELNKIKTIYSHPQPFQQCSDFIKK
FT                   FPEWKIKYTKSTADAMKKIKKYNDVTNAALGSEIGSKIYGLEILMKNLANKENNITRFI
FT                   LLNRNPKKISKNIPTTTTLIFTTGQEAGSLSKVLSILQEKKLIMKKLTSQKIYKNPWEE
FT                   MFYIDIQVNLSSTLMQDALEKIKKITRFIKILGCYPSEKITPIAP"
FT   CDS_pept        431883..433238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /product="signal recognition particle protein"
FT                   /note="BU393"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13096"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13096"
FT                   /db_xref="GOA:P57473"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57473"
FT                   /protein_id="BAB13096.1"
FT                   /translation="MFNNLTQRLSDSLKKILNKGRLTEENIKETIREVRKALLEADVAL
FT                   SVIKKFIENVKKKSIGHEINKSLTPGQEFIKIVKHELIFAMGEKNHSLNFSIEPPAVIL
FT                   VVGLQGSGKTTSLAKLGKWIKNKYKKKILITSTDTYRAAAIEQLKILSDQIEIDFFESD
FT                   KHHTPIEITKNAIKYAKLKLYDVLLIDTAGRLHIDKKMMNEIQQIQVISKAIETLLIVD
FT                   SMMGQDAINMAKIFNNDLLISGIILTKTDGDSRSGIALSMRYITGKPIKFIGTGEKIIS
FT                   LEPFHPERIADRILGMNDIMSLIEDIEEKVDQSQIQKLTKKLKKGHDFNLNDFLTQIKQ
FT                   MKKIGGLNYFANKFSINHQLSNNISLLNTDKNTLKKIEAMICSMTPKERIKPIIIKGSR
FT                   KRRIALGSGTQIQDVNKLLKNFDDIRRIMKKIKTDGIAKVIRGIKNMLPKKF"
FT   CDS_pept        433347..433586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /product="30S ribosomal protein S16"
FT                   /note="BU394"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13097"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13097"
FT                   /db_xref="GOA:P57474"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57474"
FT                   /protein_id="BAB13097.1"
FT                   /translation="MVKIRLARYGTKKRPFYKLVVADSRFSRNGRFIERLGYFNPIAKG
FT                   KSEILKLNLERIEHWTNQGAQMSERTKKLIKQKR"
FT   CDS_pept        433588..434118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /product="16s rRNA processing protein rimm"
FT                   /note="BU395"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13098"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13098"
FT                   /db_xref="GOA:P57475"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57475"
FT                   /protein_id="BAB13098.1"
FT                   /translation="MINISINKPIQPLLIGKVGKSYGILGWINIFSFTEEQEKIFNYLP
FT                   WFFFKEKNWTRIQIKNWKKYKNNFIVHIKDISDRSVVSQFTNADIIISKHTLPALKKND
FT                   YYWNDIINYKVFNIDQHYLGTVINLIRTRNNDILIVKNKLKIHQKNILIPFIDNKIIKN
FT                   VNTDKKFILVQWD"
FT   CDS_pept        434133..434846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /product="tRNA (guanine-n1)-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="BU396"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13099"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13099"
FT                   /db_xref="GOA:P57476"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57476"
FT                   /protein_id="BAB13099.1"
FT                   /translation="MKKKYNETIICFNIITIFPEMFYAITNYGIIGQAIKKKIININFF
FT                   NPRNFSKNKYKSVDDRPYGGGPGMLMSFEPLYLAIQQAKSTSKNVTVIYLSPQGKELKQ
FT                   NHIEELLVKKKKIVFICGRYEGIDQRIIDNQVDEEWSIGSYILTGGELAAMVMIDAISR
FT                   LIPGVIKTKKSIEEDSFTNDLLDYPNYTRPKIIKNMSVPQVLLSGNHNEIRLWRLKQSL
FT                   GTTWIKRPDLIKKKY"
FT   CDS_pept        434945..435292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /product="50S ribosomal protein L19"
FT                   /note="BU397"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13100"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13100"
FT                   /db_xref="GOA:P57477"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57477"
FT                   /protein_id="BAB13100.1"
FT                   /translation="MFSIIQNIEKEQIKKNIPVFRSGDTIEVKVWVIEGSKKRLQSFEG
FT                   IVIAIKNRCLNSSFTVRKISNGEGVERVFQTHSHGIEEILVKRKGLVRKAKLYYLRTRT
FT                   GKAARIKERLN"
FT   CDS_pept        complement(435376..436827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /product="tldD protein"
FT                   /note="BU398"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13101"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13101"
FT                   /db_xref="GOA:P57478"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57478"
FT                   /protein_id="BAB13101.1"
FT                   /translation="MTFELVTESLLNANKINDQDVFIALEELCTRQLDYGDLYFQSHIH
FT                   ESWILENSIIKEGNYHSDAGIGVRAIRGESTGFAYSDQISLDSLRRSTKKAHSIILTKG
FT                   SGKTKTLSKKTIEPIYKNVNPLEGFSSKEKTDLLYRANYIARSLDHRVIEVNASLTGSY
FT                   EQILVASTDGNLVSDIRPSIQFSISVLVEDHGKRERGRSGGGSRTDYNFFLNQDDSSKE
FT                   IRIDHWSKEAVRIALLNLSSKEALSGTFPVVLGSGWPGVLLHEAIGHGLEGDFNRKGTS
FT                   IFTNMIGKKVASELCTIIDDGTIKNQRGSLSIDDEGTPGQKNILIENGILKKYMQDKLN
FT                   ARLMGVKSTGNGRRESYSCLPMPRMTNTYMLSGKSKLDDIIKSVDYGIYAVNFSGGQVD
FT                   ITSGKFVFSTSEAYLIKNGKIVTPIKNTTLIGSGLEVMQKISMVGDDLKMDEGMGICGK
FT                   DGQNIPVGIGQPSMKLENLTIGGTV"
FT   CDS_pept        436985..437437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /product="type II 3-dehydroquinase"
FT                   /EC_number="4.2.1.10"
FT                   /note="BU399"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13102"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13102"
FT                   /db_xref="GOA:P57479"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57479"
FT                   /protein_id="BAB13102.1"
FT                   /translation="MKNNINILLINGPNLNLLGTRETEIYGDITLPDLLKNLEKRAKKL
FT                   NMSLKHIQSNAEHVLIDKIHSSRKNINYIIINPAAFTHTSIAIRDALIAVEIPFIEIHI
FT                   SNIYSREDFRSHSWLSDISQGVICGLGLDGYHWALETISNRLIHLK"
FT   CDS_pept        complement(437630..437926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fis"
FT                   /product="factor-for-inversion stimulation protein"
FT                   /note="BU400"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13103"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13103"
FT                   /db_xref="GOA:P57480"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57480"
FT                   /protein_id="BAB13103.1"
FT                   /translation="MLEKKTNTEFLVLSTTNTQDKNIKQPLCELVKKSLKYYLSNLNGK
FT                   DVNNLYELALSELEQPLLDMIMQYTRGNQTRAALMLGINRSTLRKKLKKYSMN"
FT   CDS_pept        complement(438095..439033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /EC_number="4.2.1.70"
FT                   /note="BU401"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13104"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13104"
FT                   /db_xref="GOA:P57481"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57481"
FT                   /protein_id="BAB13104.1"
FT                   /translation="MKKIQLNSIASSCSLSGQRLDLVLSKLFREYSRSYLKKLIIMNQV
FT                   LVNESIVNQPDKKILGGETLTIHPFSKDLLVDIPENIFLDIVYEDSDILIINKPAGLVV
FT                   HPGSGNKSGTILNALLYHYKNSKDLPRAGIVHRLDKDTSGLMVIAKNIFSYNHLLLLLK
FT                   EKKIIREYEGIVHGKMIAGGTINKPIMRHYNRRTCMMVHHLGKPSVTHYKVLSRFKFHT
FT                   HIAIRLETGRTHQIRVHMLHIKYPLVGDPCYSGFKIQSNYRKDKKTNKIYKFPRQALHA
FT                   NHLSLHHPIKKNVMSWTVPLPQDIQELLLKI"
FT   CDS_pept        439198..439938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiO"
FT                   /product="hypothetical protein"
FT                   /note="BU402"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13105"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13105"
FT                   /db_xref="GOA:P57482"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57482"
FT                   /protein_id="BAB13105.1"
FT                   /translation="MKKKNSIIFVFMILFFNSTVQSQSFKKNYFTERYTLYEKSNKELR
FT                   KENFDNAISILEKIKKNNNTANISNDKIQIDLIYAYYKILNFDQARKNIEEFMYFYPNH
FT                   PNIDYVVYIQCLISMSLDKNRFFSVFPINYYKNDYFYAKNAFFQLKYFIYQYPKSRYVV
FT                   NAKKNLIYIKNRLSEHDLSILKFYFFHKEYIAVINRGEEMLQRYSETPSARKALIYIEK
FT                   SYYALKIFDTAKKISKIILLNKIQ"
FT   CDS_pept        440103..442739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="BU403"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13106"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13106"
FT                   /db_xref="GOA:P57483"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57483"
FT                   /protein_id="BAB13106.1"
FT                   /translation="MKKTTDKIRQDFLKFFKEKGHMIIPSSSLVPYNDSTLLFTNAGMN
FT                   QFKEIFLGEKKSNYPRVATVQRCLRTGGKHNDLENVGYTSKHHTFFEMLGNFSFGDYFK
FT                   KQAIEYAWELLTSKKWFNIPQNKLWISVYKDDTETYKIWNDIIKIPSERIIRIGDKNKE
FT                   KYNSENFWQMGDTGPCGPCTEIFYDYSDTMKIDPIEFLENKNGRFVEIWNIVFIEFNRI
FT                   SKTKIISLKNKSIDTGMGLERISAVLQNVYSNYHIDVFQKLIKNIAQLSSINNLDHISF
FT                   QVIADHIRSCSYIIADNILPSNEHRGYILRRIIRRALRHGHKIGIKKNFFHKLVSSVIH
FT                   VMGKTGDILKEKQEKIENVLKIEEMQFSYTLEKGLKILNSEIEKIDNNILSGKTAFYLY
FT                   DTFGFPIDLTSDVCREKNIKIDYNSYELAKEKQKEQSNINKKFYKNYNNNIILNDTCIF
FT                   EGYTKTITRSLVKYIFVNNQSVSKIIKDEKGVIFLDKTPFYSESGGQIGDIGQLYHKKS
FT                   SFLVEKTKKYGKTIGHIGKLISGQITLNDSLFSHIDEDYRYAIQLNHSATHLLHATLRK
FT                   ILGDSIVQKGSLVTNTYLRFDFSYVKSIDTSQIQKIENIINTNIRNNIKIKTEELNLEE
FT                   AKKKKAMALFDDQYGSIVRVVFINNFSIELCGGTHTQRTGDIGLFKIISQSSVASGIKR
FT                   IEAVTGQKAIDYLHEKDNYIKDISLLLNCSTVDIKEKTKKLTIKTKNLEKKIIQLQKKE
FT                   NTQYIKKILKNVTEIKGTKLLTNIFYDYEQKSLRMIVDQLKKELKNTIIILINIINNRF
FT                   TIIVGVTRNLLDYITAIKIMEMIINKTNGKGGGKKEIAEGGGANTKQLPSILNTIKLWI
FT                   NDKLNEK"
FT   CDS_pept        442934..443107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /product="carbon storage regulator"
FT                   /note="BU404"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13107"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13107"
FT                   /db_xref="GOA:P57484"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57484"
FT                   /protein_id="BAB13107.1"
FT                   /translation="MLILTRRVGETLIIGDEITVTVLGVKGNQVRIGVNAPKEVSVHRE
FT                   EIYQRIQAEKKK"
FT   tRNA            443263..443354
FT                   /product="tRNA-Ser (GCT)"
FT   tRNA            443372..443445
FT                   /product="tRNA-Arg (ACG)"
FT   CDS_pept        443565..445121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /product="glutamate-cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="BU407"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13108"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13108"
FT                   /db_xref="GOA:P57485"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57485"
FT                   /protein_id="BAB13108.1"
FT                   /translation="MIEDISKKIAWLKKNPKMLKGIFRGIERETLRIQKNGHFSKTIHP
FT                   YLIGSSLTHKWITTDFSENLLEFITPTSDNIDYLLSFLTDLHSFTASKIKNERMWPFSI
FT                   PYCFNDQTNIQIAQYGKSNIGKMKTTYRIGLKNRYGDLINTISGIHYNFSLPLFFWTNW
FT                   ENNQNKKNNTDLISSGYLNLIRNYYRFGWIVPYLFGSSPAISSFFLKNTKKKYKFKKNK
FT                   EDIFYLPWSTSLRLSDIGYSNTNILDLNIMFNDFNEYIESFQNALKTPSKKFINIGLKD
FT                   EHGNFKQLNTNILQIENELYTQIRPKRKTKDGESLLEALKNRGIEYVEIRSLDVNPFSP
FT                   IGINKNQILLLDLFLIWCALIDSPKIDKTDFLLTTKNWERIIYEGRKPNQKIYINNNNE
FT                   TKTLIEIGQIIFKDLNEIALILDSNSNDLLYQKACKETQLFLKNPELTYSAQCLNFLMT
FT                   TGIKKTGLYLANKYHEKFINKNYFNLNQSVLEQEVIRSHQKKIEIEREDILSFEEYIRN
FT                   K"
FT   CDS_pept        complement(445268..446404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="BU408"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13109"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13109"
FT                   /db_xref="GOA:P57486"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57486"
FT                   /protein_id="BAB13109.1"
FT                   /translation="MTEYLFTSESVSEGHPDKIADQISDALLDEILKQDLKARVACETY
FT                   VKTGMVLIGGEITTTAWVDVEEITRKTINDIGYVNSDAGFDANSCAVLSAIGKQSPDIN
FT                   QGINRFDPLKQGAGDQGIIFGYATNETEFFMPAPITYAHLLMQKQSELRKKNILPWLRP
FT                   DAKSQVTFKYNNGNIIAIDTVVLSTQHQENITQKYLKEAVMDEIIKPVLPDKWLTKNTK
FT                   FFINPTGRFVIGGPMGDCGVTGRKIIVDTYGGMSRHGGGAFSGKDPSKVDRSAAYAARY
FT                   VAKNIVASGLAARCEIQLSYAIGIAEPISIMIDTFNTGKISNSALISLVRSIFDLRPYG
FT                   LIKMLNLLQPIYLKTAVYGHFGRKEFPWENLDKVNELS"
FT   CDS_pept        446639..447391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="endA"
FT                   /product="endonuclease I"
FT                   /EC_number="3.1.21.1"
FT                   /note="BU409"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13110"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13110"
FT                   /db_xref="GOA:P57487"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57487"
FT                   /protein_id="BAB13110.1"
FT                   /translation="MKKFCFLKIEKIKNDKKNVYCYNKYVFFFSSNKRSYFKKKTIENF
FT                   YQAKIISIKIHKNAPGSFYCGCQIIWKQKKGIPNLYSCGYKIRKNKNRATRIEWEHVVP
FT                   AWQFGHQKTCWKKGGRKKCMEDKKYKHIESDLHNLQPAIGEINGDRSNFMYGQLNNSVA
FT                   QYGRCNMKIDFKRKIVEPPERARGAIARTYFYMNKKYNIILSEKERKMFTIWDKIFPVT
FT                   KWECEREKLIFNIQGNHNDYVYKHCYKK"
FT   CDS_pept        447363..448124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggJ"
FT                   /product="hypothetical protein"
FT                   /note="BU410"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13111"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13111"
FT                   /db_xref="GOA:P57488"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57488"
FT                   /protein_id="BAB13111.1"
FT                   /translation="MFTSTAIKNKKIPRIYIEDDLDLNQFYFLSDENRHYVTKVLRMKI
FT                   EDILEIFNNTHYIFFAKIIDISKKIIKIQTFKKILKNLESPLHIHLGQVISKNEKMDFT
FT                   IQKSIEIGVKTITPLFFENDHFQKKRINFSNKIKRWEKIAISACRQCNRNIIPKIKIPM
FT                   NVFHWCENNQNNDKKIIFHPKSTLTMKCLTEPIKYIQIIIGSERGFFNDEFQKIIKYGF
FT                   IPIRLGPRILRTETASVVAITALQTMFGDFK"
FT   CDS_pept        complement(448198..448869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="BU411"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13112"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13112"
FT                   /db_xref="GOA:P57489"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57489"
FT                   /protein_id="BAB13112.1"
FT                   /translation="MNLNKLKKKAAWAALDYIDPGTIIGVGTGTTIFYFIEALGTIKNL
FT                   IYGAVSSSNSSTVLLKKHGIEVFDLKNFSSLAIYVDSADEINNHMQMIKGGGGALTREK
FT                   IIASMSKKFVCIIDKSKKVDVLGTFPLPIEIIPMALSYIFREMIKIGGTPKYRKNVITD
FT                   NGNIIIDVYNLCIKDPISMEKKINSLPGVVTVGLFASRSADIVLIGTQKGIRTINKKEN
FT                   R"
FT   tRNA            complement(449053..449127)
FT                   /product="tRNA-Gln (TTG)"
FT   tRNA            complement(449220..449301)
FT                   /product="tRNA-Leu (TAG)"
FT   tRNA            complement(449313..449389)
FT                   /product="tRNA-Met (CAT)"
FT   CDS_pept        449495..451210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /EC_number="6.1.1.18"
FT                   /note="BU415"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13113"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13113"
FT                   /db_xref="GOA:P57490"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57490"
FT                   /protein_id="BAB13113.1"
FT                   /translation="MDTKKEIKNNNFICQIINKDLNENKNLSFYTRFPPEPNGYLHIGH
FT                   AKSICLNFELASLYKGRCNLRFDDTNPLKENIKYIESIKHDINWLGYKWHGNVRYASEY
FT                   FLKLYQYAQELIKKGLAYVDHLTKEQIREYRGTLNTPGKNSPYRNRTIQENIELFEKMK
FT                   KGDFSEGEACLRAKINMSSSSIIMRDPVLYRIIFIKHHQTQNKWCIYPMYDFAHCLSDS
FT                   IEGITHSLCTLEFQDNKFLYNWILKNTSVKHYPKQYEFSRLNLEFSILSKRKIKILIDK
FT                   NIIEGWDDPRIPTLSALRRKGYTPSSIKNFCQKIGVTKQNNLIEFSMLEHCIRKELNQT
FT                   AIRTMAILDPIKIFLYNLDSNYKEEFIVPNHPNNPEMGTHKIIFTNTIYIDRSDFKEKY
FT                   DKKYKRLKLGEKIRLRYSYIIHAEKIEKDEYGNISNIICYCDLNTLGRKPKDNKNPAVI
FT                   HWISEKNTLSAEFKLYDQLFNIKNPEQQENFLLYINSKSLIKKFGFIEKKIGEEIQKKI
FT                   SNNNIEIFFQFERIGYFCIDFIDSKKNQLVFNRTVGLRDTWDSKKIKTKNITNN"
FT   CDS_pept        451384..453021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="BU416"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13114"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13114"
FT                   /db_xref="GOA:P57491"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57491"
FT                   /protein_id="BAB13114.1"
FT                   /translation="MTKNYIFITGGVVSSLGKGIAAASLGAILKARNLNITIIKLDPYI
FT                   NVDPGTISPIQHGEVFVTEDGAETDLDLGHYERFIHTKMTFLNNFTTGGVYSQVLKKER
FT                   RGDYLGATIQVIPHITNAIKERIILCSENSNIILVEIGGTVGDIESLPFLEAIRQMAVD
FT                   IGRKNVIYIHLTLVPYIATAGEIKTKPTQHSVKQLLSIGIQPDILICRSEKTVPLHERK
FT                   KIALFCNVPVDAVISLKDVNSIYKIPKLLKNQKLDDYICNYFKLNVPEADLQEWEEVIY
FT                   AEKNFNNTIVIGIIGKYIKLPDAYKSVMEALKHAGFKNKIKVDIQLIDSQEVENKNFQI
FT                   LKNLNGILIPGGFGDRGIVGKLLSIQYARENHIPYFGICLGMQIAIIEFAQNVVGIKEA
FT                   NSTEFDPQCKYPIIDLIKNRPNNSSKNYNKIENRINLGGTMRLGSQPCKLSANSLSRKL
FT                   YNQEIIIERHRHRYEVNNLLFKKIEAAGLQVTGRSQKNNVVEIIELSNHPWFLACQFHP
FT                   EFTSTPRDGHPLFIDFIKSAGKHKKNFI"
FT   CDS_pept        453051..454355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="BU417"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13115"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13115"
FT                   /db_xref="GOA:P57492"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57492"
FT                   /protein_id="BAB13115.1"
FT                   /translation="MSKITKIIAREIIDSRGNPTVESEVHLEGGFVGLASSPSGASTGS
FT                   LEALELRDENKDRFMGKGVEKAVSLINEKISIALKNKNARNQSDIDHIMIDLDGTINKS
FT                   KLGANAILSVSLAVAKAAAASKRMPLYAHIAEINETPGVFSMPLPMINIINGGKHANNN
FT                   IDIQEFMIQPISAKTVKESIRIGCEIFHALGELLKEKGMSTTVGDEGGYAPNLKSNEEA
FT                   LNIIQDAIQKTKYKLGQDIRLAIDCAASELYNKNEKKYNLKGENISFSSKEFTHYLEKL
FT                   SQKYPIVSIEDGQDESDWEGFLYQTHVLGNKIQLVGDDLFVTNKNILKKGIKKGIANSI
FT                   LIKLNQIGTLTETLEAIKTAKQANYGVIISHRSGETEDASIADLSVGTSSGQIKTGSMS
FT                   RSDRTSKYNQLIRIEENLGTKYAPFHGLREIKSAF"
FT   CDS_pept        complement(454513..455517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpD"
FT                   /product="lipoprotein nlpD precursor"
FT                   /note="BU418"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13116"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13116"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57493"
FT                   /protein_id="BAB13116.1"
FT                   /translation="MQLKIFLFKLLFLIFFSFSFNNFAFGFFFNNRYDSNFFIDKKYTK
FT                   DFIFFKKNECFSFLKYKKNFFLNKKIIIGNNHFIGFFQKNRFKIFYIVKSKDTMYSIAK
FT                   NSGYNYHELSKFNSIKKPYKIIIGQKIWMGDFLIDKNNNDCSILNLEKNSIKQHNSCEV
FT                   VFKNLLNIEKFLKDNIKTKKICFFCIKKIKKNNNSLKLKFFNFSNNWSWPVKNKNTKYF
FT                   YIDKLGNKRIEIIGFKGQPVFSTAAGEVVFVTNLFKKYGLLIIIKHDQNYLSIYAFNNS
FT                   VLVKEKDRVYKNQQIATMGLSSDTNLARLYFEIRYLGESINPLSILPKINTNI"
FT   CDS_pept        complement(455608..456093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygbB"
FT                   /product="hypothetical protein"
FT                   /note="BU419"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13117"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13117"
FT                   /db_xref="GOA:P57494"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57494"
FT                   /protein_id="BAB13117.1"
FT                   /translation="MRIGYGFDLHAFGSTKPLIIGGVLIPCEKGLIAHSNGDLLIHSLI
FT                   DALLGATAMGDIGSFFPSNNYIYKNIDSRILLKKIWNKIILLNYDICNIDITIIAEYPK
FT                   MLPYIFFMRSNLSLDLNTEIDNISIKSTTSKKIGCIGRKEAIACHSIVMLIKNKKCI"
FT   CDS_pept        complement(456109..456822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygbP"
FT                   /product="hypothetical protein"
FT                   /note="BU420"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13118"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13118"
FT                   /db_xref="GOA:P57495"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57495"
FT                   /protein_id="BAB13118.1"
FT                   /translation="MILVNLFEPKIIAIVPAAGIGSRMKIDVPKQYIKIQNRTILEHTL
FT                   TTLLLHPNIVQIIVSLNKKDNYFHKLSISSNFRIISVVGGEKRINSVLSGLIVVKNVDW
FT                   VIVHDAVRPCLSYKDLEKLISIIKKNPVGAILARPVSDTIKYSNLKQKKAVYTVYRKNL
FT                   WHALTPQLFQVELLKNCLKKIIKDQISVTDEASALEYCGYNPLLVLGSCRNIKITWPED
FT                   LVLANFYLKNHIIDK"
FT   CDS_pept        complement(456905..457120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygbQ"
FT                   /product="hypothetical protein"
FT                   /note="BU421"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13119"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13119"
FT                   /db_xref="GOA:P57496"
FT                   /db_xref="InterPro:IPR023081"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57496"
FT                   /protein_id="BAB13119.1"
FT                   /translation="MKILKIFLLSLLFWLQYSLWFGKNGVLDFIKIYRRVTIEKKNNEY
FT                   LDMRNNQIILEIENFNNHINKDKKKT"
FT   CDS_pept        complement(457178..457798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /product="adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /note="BU422"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13120"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13120"
FT                   /db_xref="GOA:P57497"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57497"
FT                   /protein_id="BAB13120.1"
FT                   /translation="MNNNFQNNIFWQKHSITRLKREKKNGHKSIVLWFTGLSGSGKSTI
FT                   ANFLEEILFKNGINSYLLDGDNIRSGLCSDLSFSLADRNENIRRIGEVVKMMLHAGLII
FT                   LVSVISPYRNQREMVRQMLGKKNFLEVFIDTPIEICESRDPKKLYKQARTGQISDFTGI
FT                   QCTYETPNTPDVLLKGTDSLKNNSKKLIKILYNHNIISFINID"
FT   CDS_pept        complement(457799..459220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysN"
FT                   /product="sulfate adenylate transferase subunit 1"
FT                   /EC_number="2.7.7.4"
FT                   /note="BU423"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13121"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13121"
FT                   /db_xref="GOA:P57498"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57498"
FT                   /protein_id="BAB13121.1"
FT                   /translation="MNINMKDNFKKWLDLQQKKTLLKFLTCGSVDDGKSTLIGRLLHDT
FT                   KQIYDDQLFFLKSDSKRHGTQGNEIDLALVVDGLQSEREQGITIDVAYRYFSTNKRKFI
FT                   IADTPGHEQYTRNMATGASTCDLSILLVDARKGLSEQTYRHSFISTLLGIKYLIVAINK
FT                   MDLVNYKQEIFENIKKDFLIFSKKLANDLNIIFIPMSALLGENIVFKTKLMPWYQGVTL
FT                   LSFLETIKIKNSISSEELRFPVQYINRPNSDFRGYSGILLSGRMHVGQTIKILPENINS
FT                   RVSRIVTFDKELKKAEIGESITVVLKDEIDINRGDFFVNIDSILQPSQEAIIDIVWMTD
FT                   NILLAGESYNVKLSGKKIRVYIKEILFKLDVNTLKKVKSHSLVLNSIGRVKIYFSKPVI
FT                   FDNYSENRMTGNMIFIDLLTNITVGAGMIVNSLDKKGKIPSNKQKDFESDFYDLIIRHF
FT                   PHWNIPKILMKKVYK"
FT   CDS_pept        complement(459239..460147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /product="sulfate adenylate transferase subunit 2"
FT                   /EC_number="2.7.7.4"
FT                   /note="BU424"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13122"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13122"
FT                   /db_xref="GOA:P57499"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57499"
FT                   /protein_id="BAB13122.1"
FT                   /translation="MFKKNTTHLRQLESESIYIMREVMSDFQNPVMLYSIGKDSSVMLH
FT                   LAKKSFYPGTIPFPLLHIDTGWKFKEMYIFRDHIASTSNIELIVHSHSKGKLLGLNPFE
FT                   NGGSKYTDIMKTEGLKEAINKYNFDAAFGGARRDEEKSRSKERIYSFRDSLHQWDPKKQ
FT                   RPELWWNYNGQINKGENIRVFPLSNWTELDIWQYIFLEKIEIVPLYFAAKRPVLERNGV
FT                   LTVIDDSRMKIKSNEVIKEKMVRFRTLGCWPLTNAIESEARNVEDIIKETLIVKTSERT
FT                   GRAIDYDQKSSMEFKKRQGYF"
FT   CDS_pept        complement(460157..461578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysG"
FT                   /product="siroheme synthase / precorrin-2 oxidase /
FT                   ferrochelatase"
FT                   /note="BU425"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13123"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13123"
FT                   /db_xref="GOA:P57500"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57500"
FT                   /protein_id="BAB13123.1"
FT                   /translation="MNYLPIFIDLKSKNVLVIGAGEVGLNKIRILLRAKAKVNVIAKEL
FT                   CSEVKLLLRDQKINWLSKNFDLIYLNKIFLVVSATNDIKLNQYIFKKCNERCVLVNIVD
FT                   DKLKCSFIFPSIIDRSPLIVAISSGGTAPVLLRLLREKIEAILPNKLGDVAKIAGKWRL
FT                   AIKKHFSNFLERRKFWEKLFHSIFVEHILNGNKEQAINVLKKNMNQNISLTGEIILVGA
FT                   GPGDSGLLTLRGLQVLQQADVVLYDYLVSEDILDLIRRDAKRICVGKRVGLKNITQNEI
FT                   IKLLIFFAQKGKKVVRLKGGDPFIFGRGSEEIEAAKDAGIHFQVVPGITSAIGIAAYTG
FT                   IPLTHRKYSQGVIFITGHKCIDGFLNNWSILSDPSYTLVVYMGTLKAVYIAQKLITFGR
FT                   SKLTPIAIIVQGTTIHQKVIVGCLGEIEKIIPFAATPSLLIIGDVVHLHKKLAWFQSEN
FT                   ILKKIKNKFSTLTFI"
FT   CDS_pept        complement(461917..462651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="BU426"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13124"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13124"
FT                   /db_xref="GOA:P57501"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011800"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57501"
FT                   /protein_id="BAB13124.1"
FT                   /translation="MSKFYIENINLLNSEKKNNILSELNLLLSNYSAEERISWALSHLP
FT                   HTQIMSSSFGIQSTVLLHLIIKKKPDIPVILIDTGYLFPETYNFIDFLTNKFHLNLKVF
FT                   RSTISSAWQEARYGKLWEKGIEGIDFYNNINKVQPMNFALNELSVQTWFAGLRHDQSKS
FT                   RNLLPYLSIKKGIFKILPILDWSKDKIKDYLKENNLDTHPLYNNGYSSVGDTHTTKKHM
FT                   PGMLEEETRFFGLKRECGLHEN"
FT   CDS_pept        complement(462667..464376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysI"
FT                   /product="sulfite reductase (NADPH) hemoprotein
FT                   beta-component"
FT                   /EC_number="1.8.1.2"
FT                   /note="BU427"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13125"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13125"
FT                   /db_xref="GOA:P57502"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57502"
FT                   /protein_id="BAB13125.1"
FT                   /translation="MNKKFKKIVTEKKLTDAERIKENSNYLRGTITDDLKNEITNGFTG
FT                   DNFSLIRFHGMYQQDDRDLRIERNEQKLEPRYAMMLRCRLPGGVIKAKKWLKIDYFASK
FT                   YTLYGTIRLTNRQTFQFHGILKKNLKDVHKMLHSIGLDSLATANDVNRNVLCTSNPMES
FT                   LIHQEAYEWARKISNFLLPHTKAYAEIWLDQKKIVTTEKEPILGKTYLPRKFKTTVVIP
FT                   PYNDVDLYANDMNFVAITKNEKIIGFNILIGGGLSFIHGNKNTWPFLATEIGYISVENT
FT                   LSIAKAIVTTQRDWGNRTDRANAKTRYTINNFGLNEFKKEIEKRANVNLKPVREYSFIS
FT                   RGDRFGWIKDINNNWSLTLFIQNGRIYDDNDKLFKSGLLKIANIHDGNFRITSNQNIII
FT                   SEVSEKNKNKIEKIALSSGLINKSTNLRKNSMACVSFPTCPLAMAEAERMLSFFITQLE
FT                   NIMLKYGVEDEVIILRVSGCPNGCGRSLLAEIGLIGKSIGRYNLYIGGNRIGNRIPKIY
FT                   KENITEQEILIHLKYLIKTWSNERKNKEDFGDFIVRKEFVKEVINPVYDFWS"
FT   CDS_pept        complement(464376..466181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysJ"
FT                   /product="sulfite reductase (NADPH) flavoprotein
FT                   alpha-component"
FT                   /EC_number="1.8.1.2"
FT                   /note="BU428"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13126"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13126"
FT                   /db_xref="GOA:P57503"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010199"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR029758"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57503"
FT                   /protein_id="BAB13126.1"
FT                   /translation="MKNQNKFDPVFPLSSEQLNNLKELERTCTNIQSAWLSGYFWKIAN
FT                   QTSNITSFQTNESEKNDPVITIISASQTGNAKLLSKRLYEYFNKNNKISRLIDAMDYKF
FT                   KKIKDEKILILIISTQGEGEPPEEALSFYKFIMSKNAPNLNNLYYSVFGLGDTSYNLFC
FT                   QAGKDFDKRFKELGGNSLLDRFDADIEYEDNYNKWSQDLLQSINSKEKIYKSSVSYIDQ
FT                   ENTLILSKNHYTKKNPAEGIILTNQKITGRNSKKDVHHIEIDISNLNIKYSPGDALGVW
FT                   YKNDSNLVKNILELLSINISETITIKNDVITIFDALQNHFELTNNTKNIIKSYANFSKN
FT                   KFLKDIISNDSDLENYTINTPLIKMIHDHPLKLSSQQLIGLLRPLTPRLYSISSSQEEI
FT                   DNEIHITVGVVKKLISGHVYLGGASGYLSQSLKSDDIIKIFIQTNDNFRLPINKNTPII
FT                   MISSGTGIAPFRAFMQQRDNDNADGKNWLFFGNPNFTEDFLYQVEWQKYIKKGLITNMN
FT                   LAWSQDQKNKIYVQDRIRENSQEIWSWIEEGAQIYVCGNASKMAKDVEKALLDIISHNA
FT                   HLNLEESQEFLNNLRLNKRYKRDVY"
FT   CDS_pept        complement(466372..468780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /product="DNA mismatch repair protein mutS"
FT                   /note="BU429"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13127"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13127"
FT                   /db_xref="GOA:P57504"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57504"
FT                   /protein_id="BAB13127.1"
FT                   /translation="MKKKNIKNSMNNHTPMIKQYLSLKSQYPDMLLFYQMGDFYELFYE
FT                   DAERISELLKITLTKKGYSNHKIIPMAGVPCHKSEYYLSKLVKLGESIAICDQQKETDC
FT                   KKKLISRKVVRIITPGTVTDEVLLEENEDNFIAAIWKENNQFGYSVLDLSLGFFGVSKI
FT                   FSSCDLLSEIERTNPKEILYPENFSDVFLIESRKCIRKRSLLEFDLETSYKLLNLQYNT
FT                   CSLDGFGIEKNNFVIRAAGCLLQYVKSMNMTLLPNIRQLKYNYMEDSIFMNFSTRKSLE
FT                   ITQNISGEKKNTLSAILNKTVTSMGSRMLNRWLNSPLKNFKIVRNRHESVEALQFFYKE
FT                   LQFILRQVNDLERIYSRLALRTASPHDFVRMRSTLEILPNLHLILKKIKSKHIKKIRLS
FT                   IGYFEEVLCLLKKAISLKPSKCIRDGGVIAELYNIELDELRSIKINSKEYIKNFEQKEK
FT                   KKLMIESFKIKFNKIIGYYIQISKRHTHLIPKYYVIIQTLKNTERYSVPLLKEYEEKVL
FT                   NSEMRSLLLEKKLYAEIFNIIEPFLEKLQNSALALSELDVLVNLSERAISLNYTRPIMS
FT                   EKYGISLLESRHPVVECFLKTPFIKNSVFLSRTQRMIIITGPNMGGKSTYMRQIALIVI
FT                   MAGIGSFVPARYALIGSIDKIFTRIGSADDLSNGYSTFMMEMMEISNILHNATSNSLVL
FT                   IDELGRGTSTNEGLSLAWSCSRYLININKSMTLLSTHFVELTKLEEKEKFVKNFHFSAI
FT                   KSDLHIAFLYKIKNGISKKSYGISVASLSGLPDSVLEDAEKKLIEIENT"
FT   CDS_pept        468937..469575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /product="thiol:disulfide interchange protein dsbA
FT                   precursor"
FT                   /note="BU430"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13128"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13128"
FT                   /db_xref="GOA:P57505"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57505"
FT                   /protein_id="BAB13128.1"
FT                   /translation="MKKILIILCILILSCNVFSCEFKNGREYTEKHKVISNIPSIIEFF
FT                   SFFCPYCYEFEKTYDTQYLIEKKIKKNINIQKYHVSFLGGKLGYVLTKSWIIAQQMGIE
FT                   KKIVLPIFKGIQETYTINNLDDIKKIFKEKAGVSESKFNSFWNSLTIKILISKQEEDIR
FT                   KYNLKNIPTMLINEKYVIDYSKIEEIFKDSFAEKYTKLIQFLINKKEKI"
FT   CDS_pept        469696..470556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="BU431"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13129"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13129"
FT                   /db_xref="GOA:P57506"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR038969"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57506"
FT                   /protein_id="BAB13129.1"
FT                   /translation="MNHIKNNPVIIIDGSLYLYASYYAFCNLENTSGKPCGAIYGMLKI
FT                   IDNIFKKYKNLKKIIIIFDSSRKTFRNKLFKEYKKNRSSMPDLLVMQIQPLFEILKKIG
FT                   IKTLTIPGIEADDVIGSLSYQLEKQGEKILILSHDKDMLQLVTENINIFHKKNNCIITS
FT                   EIIQEKYGIKPKEFIDFLALMGDATDNIPGVPKIGIKTALFLINKFSNIENIYNNIEKI
FT                   KSLPLRNAKNISIQLKNNKERALLSYKLARIKLDIPIDIKLKDIILKKYCSKNTFQIFK
FT                   NYFSS"
FT   CDS_pept        complement(470619..471236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yihA"
FT                   /product="hypothetical GTP-binding protein"
FT                   /note="BU432"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13130"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13130"
FT                   /db_xref="GOA:P57507"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57507"
FT                   /protein_id="BAB13130.1"
FT                   /translation="MNSLDYNKTNFLKSYSKITDIDIQNGIEIAFIGYSNTGKSSAINA
FT                   LTNQKKLARFSKTPGRTQLINFFEVVSGFRIVDLPGYGYSQAPLLVRSKWQKKVYDYLE
FT                   KREQIKLFVLLMDIRYPLKKLDQKIISIAVQKKISILVLLTKCDKIKINHQKNQADMVF
FT                   KKLNVLLDSFEIILFSSYKKIGIEKLKLSLNSSYKKHFILNR"
FT   CDS_pept        471487..473310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /product="GTP-binding protein TypA/BipA"
FT                   /note="BU433"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13131"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13131"
FT                   /db_xref="GOA:P57508"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57508"
FT                   /protein_id="BAB13131.1"
FT                   /translation="MHHSIRNIAIIAHVDHGKTTLLDKLLQQSGTFEEHEEKTERIMDS
FT                   NDLEKERGITILSKNTSIKWNNYKINIVDTPGHADFGGEVERVMSMVDSVLLVVDALDG
FT                   PMPQTRFVTKKAFKYGLNPIVVINKIDRIHSRPDWVVDQVFDLFVNLNASDEQLDFPII
FT                   YTSAVLGTSGTDYLNMQNNMIPLYESIIKYAPAPNVNSDQKFQMQISQLDYNSYLGVIG
FT                   VGRVKQGSIKTNDKVTIIDRFGKHRSGKVNKVLNYFGLKRMEINQGYAGDIIAITGLNK
FT                   LKISDTICHPDNLQPLPALSIDEPTVNMFFSVNTSPFSGKEGKYITSRQILERLKKETM
FT                   HNVALQIKETKDPNIFSVSGRGELHLSILIENMRREGFELEVSRPKIIFREINGIQKEP
FT                   FENVTLDIEEKNQGSVMQFIGIRKGELKNMIPDSKGRVRLEYILSSRALIGFRSEFMSI
FT                   TSGTGLCYSSFSHYDNLQNSNIGQRKNGVLISNSTGMAVGFSLFNLQERGKLFIGHGAQ
FT                   VYEGQIIGLHNRSNDLTVNCLTGKKLTNMRASGTDEAIVLTTAIHFTLEEAIGFINDDE
FT                   LVEVTPHSIRIRKFYLKENERKRANRNKKSI"
FT   CDS_pept        complement(473433..474056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="BU434"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13132"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13132"
FT                   /db_xref="GOA:P57509"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57509"
FT                   /protein_id="BAB13132.1"
FT                   /translation="MSEGILFIISAPSGTGKSSLIQGLLKSKTLYNTRVSISHTTRIIR
FT                   PGELHGKHYYFISKKEFEIMIKQEYFLEYAKVFSNYYGTSRKYIEKMLFSGIDVFLDID
FT                   WQGAKQIKCKMPKSKSIFLLPPSKDTLYKRLRERGQDSDSVIANRMEKAVDEMQHYSEY
FT                   DYLIINDDFKQAVNDLITIITAEHLCLFHQKNKHNLLISNLLKC"
FT   CDS_pept        complement(474156..475115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygfZ"
FT                   /product="hypothetical protein"
FT                   /note="BU435"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13133"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13133"
FT                   /db_xref="GOA:P57510"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR023758"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57510"
FT                   /protein_id="BAB13133.1"
FT                   /translation="MPSFISIQNIIYPSNELSLTMILLEEWSLTYVEGIDSKKYLQGQL
FT                   TIDINLLLKTHHTLCAHCNFNGRVWSTMHLFHYEKGYAYIQRKSVSQIQIKEICKYSIF
FT                   SKIKIRELNSICLIGFAGCNVRSFLSSLFVKIPNQSCPVIHEDNKTILWYEKPSERFLL
FT                   VLPFLDFLTLKRKINQNIFLNNSKQWLLLDIEAGLPVIDKICSNKFTPQAINLHNLKAI
FT                   SFKKGCYYGQETIARIFFKKTNKYFLCFLVSTGSIFPKIGSFIETKVDSEWFKVGVLLS
FT                   IVHVKCEEIYIQVVLRKSVNINNLFRIHGFENIFLIKN"
FT   CDS_pept        475334..476383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /product="peptide chain release factor 2"
FT                   /note="BU436"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13134"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13134"
FT                   /db_xref="GOA:P57511"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57511"
FT                   /protein_id="BAB13134.1"
FT                   /translation="MYKILRGIFDYNKKKSRVLEIDLELSSPKTWTEQISIKKLNKEKY
FT                   LLNSIIQNINEIEENIKEVVIFLELAIETQDNLVFKESLLEIQKIEQEIKKLEFYRMFS
FT                   KKNDHYDCYIDIQSGSGGTDAQDWSKMLLRMYLRWADKKGFHTEIIDESIGEIVGIKSS
FT                   TIKVSGEYAFGWFRTETGIHRLIRKSPFDSGKRRHTSFSSIFIYPDINEKIDININYSD
FT                   LRIDVYRASGAGGQHVNRTESAVRITHLPTNIVTQCQNNRSQHKNKEQAMKQMQSKLYE
FT                   IQMRKKQEEKQKIEQNKSDITWGNQIRSYILDNSKIKDLRTGVEKNHVQSVLDGDLDDF
FT                   IEQSLIMGL"
FT   CDS_pept        476393..477913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="BU437"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13135"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13135"
FT                   /db_xref="GOA:P57512"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57512"
FT                   /protein_id="BAB13135.1"
FT                   /translation="MSEIEKRNHGDCNILYKEIKKREQKLVNMKKEGFSFPNSFKKNTT
FT                   SRKIYQKYQTKNRNELISLNIEVSIAGRMVQRRIMGKASFFTLQDIEGKIQIYINEKKI
FT                   SSDFYRFHFKKWDIGDILGVIGTLFKTKTGELSIYCKNVTILNKSLKPLPDKFHGLSNQ
FT                   EIRYRKRYLDLISNNKLYSIFKNRSNIITAIRNFMIENDFLEVETPMLQNIPGGANARP
FT                   FITYHNEIDSQMYLRIAPELYLKKLIIGGFERIFELNRNFRNEGVSARHNPEFTMMEAY
FT                   IAYSNYEDMMELTENLFKSITKFLFQDNKIIFNNNNFDFSQPFRRLTMTDSILEFNSTI
FT                   TSSDLKDFYKIREFAKSIGIKVEKKWGCGQIETEIFEKTVEKKLIQPTFITQYPVEVSP
FT                   LARRNDINLNITDRFELFIGGYEIGNGFSELNDVEDQKTRFLNQIQKSNKEDNKNLFYD
FT                   KEYIEALKYGLPPTSGLGIGIDRLIMILTNQISIRDVILFPTLRPFKK"
FT   CDS_pept        477979..479226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="BU438"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13136"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13136"
FT                   /db_xref="GOA:P57513"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57513"
FT                   /protein_id="BAB13136.1"
FT                   /translation="MPKPLNNTENNLNTNRIKDLIKKYSPPFWVYDADIIYKKINLLRK
FT                   FDVIRFAQKSCSNINILRLMKNKNVKIDAVSLGEIERALLSGFKPSTNEIIFTADILDE
FT                   ETLLKVAKYKIPVNAGSLDMLKQLGKISPGHHVWLRINPRFGYGHSKKTNTGGENSKHG
FT                   IWHPEQAIPIIKKYKLKLIGLHMHIGSGVNYLHLKKVSQAMIKYAFQLNQKISSISVGG
FT                   GLPIPYKFNDQPIDIKKYFMLWDIARKKISKFLGEKIELEIEPGRFLVAESGILISKVW
FT                   ATKKMGNKNFVLVDVGFNDLMRPTMYGSYHHISVIYGDDRKMNEKETIDTVVAGPLCES
FT                   GDIFTQKEGGTVQTRKLPTIKVGDYLIFHDTGAYGAAMSSNYNTRPLIPEILLKNNDSI
FT                   VIRRRQTIEEILNLEK"
FT   CDS_pept        479292..480137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="BU439"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13137"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13137"
FT                   /db_xref="GOA:P57514"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57514"
FT                   /protein_id="BAB13137.1"
FT                   /translation="MYIFFPKLNPIIFTIGPVSARWYGFMYVISFLFAMWYGKKCSIKN
FT                   KKIWYEKKIETLLYSIFLGSCIGGRIGYIIFYNFSYYSQNMLSVFYIWEGGMSFHGGLI
FT                   GAIIVMSYFSFKYKKKILEISDFITPLIPFGLGAGRIGNFINSELWGRVSPNFSYAMIF
FT                   PNSQNQDLKEIKKYPELQLLLDQYGALPRHPTQLYEFFLEGILLFFIIYFFSKKDRPTG
FT                   SISGLFLIFYGLFRIFIEFFREPDPQIGLLKNIITMGQILSLPMIIAGLIIMYKSYYKK
FT                   "
FT   CDS_pept        480151..480945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="BU440"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13138"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13138"
FT                   /db_xref="GOA:P57515"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57515"
FT                   /protein_id="BAB13138.1"
FT                   /translation="MKQYIKLIKKIIRVGNQKKDRTGTGTLSIFGYNMKFDLKKGFPLL
FT                   TTKKCHIASIIYELLWFLKGDTNISYLNENKISIWNNWANESGDVGPIYGKQWRNWSTP
FT                   EGHEIDQIKNVLIQLKKNPDSRRMLVSSWNVGDIDKMRLPPCHVLFQFYVFNNTLSCQL
FT                   YQRSCDVFLGLPFNIASYSILIHMIAQQCDLKVGDFLWTGGDVHLYNNHIELAKKQILR
FT                   IPRTLPKLTILKKPQSLFQYCFEDFKIIGYHPYPAIKGEISI"
FT   CDS_pept        481012..482331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yleA"
FT                   /product="hypothetical protein"
FT                   /note="BU441"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13139"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13139"
FT                   /db_xref="GOA:P57516"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57516"
FT                   /protein_id="BAB13139.1"
FT                   /translation="MKYIYIKTWGCQMNEYDSSMIITLLEKNNQYSLTKSAENADILIL
FT                   NTCSIREKAQEKVFHQLGRWKKIKNNNPKVIIAVGGCVATQEGKEIFKRANYVDIIFGT
FT                   QTLHRLPKMIDEVEKKRKLSIDISFPKLEKFKYFLAPKKKGYTADISIMEGCNKYCSFC
FT                   VVPYTRGNEISRPCDDVLFEISLLAKQGIKEINLLGQNVNAYQGPTFNGKVCYFSELIR
FT                   LVAEIDGIERIRFTTSNPLEFTDDIIEVYKDTPKLVSFLHLPVQSGSNKILNLMKRSYT
FT                   TEDYTSIIKKLTIARPDIQISSDFIVGFPGESEIDFEKTIEFIKNINFDMSFSFIYSAR
FT                   PGTPASNMNDDLDLKEKKRRLYILQERINIQTMLWSRKMFGSIQSVLVEGVSDKNIMDL
FT                   YGRTENNRVVTFQGSSKMIGQFVNVKIKKVHTHSLKGELF"
FT   CDS_pept        482486..482821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeY"
FT                   /product="hypothetical protein"
FT                   /note="BU442"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13140"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13140"
FT                   /db_xref="GOA:P57517"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57517"
FT                   /protein_id="BAB13140.1"
FT                   /translation="MVDEWEIKKLNFNYRKKNKPTNILSFPFNKFIKINYKLLGDLVLC
FT                   KNIIEKESLKYNKSLESHWAHITIHGTLHLLGYDHQNNKEADIMERLENKIMLSLNYKK
FT                   PHILKSF"
FT   CDS_pept        482902..483777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeX"
FT                   /product="hypothetical protein"
FT                   /note="BU443"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13141"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13141"
FT                   /db_xref="GOA:P57518"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57518"
FT                   /protein_id="BAB13141.1"
FT                   /translation="MSDNHLQNSDKINRKGFFSILLNQIFHDEPKNREELLVLIRDSEQ
FT                   NELIDQDTCDMLEGVMHIAKKRIKEIMIPRTQMITLKLHHNLNECLDVIIESAHSRFPV
FT                   MSNDNNYVEGFLIAKDLLPFMKQSANIFCIKNILRPAVVVPESKHVDRMLKEFRSKRNH
FT                   MAIVIDEFGAVSGLVTIEDILELIVGEIEDEYDDEETLNIRKIQKSTFSIRALTEIKEF
FT                   NETFNTNFSDEEVDTIGGLVMKEFGHLPSRGESINIDGYSFKISIADSRKVIQIHVTIP
FT                   ENKTPVLIEA"
FT   CDS_pept        483881..486460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="BU444"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13142"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13142"
FT                   /db_xref="GOA:P57519"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57519"
FT                   /protein_id="BAB13142.1"
FT                   /translation="MEKEYSPKKIENYVQEFWKKNKTFEVKEDPKKEKYYCLPMLPYPS
FT                   GKLHMGHVRNYTISDVISRYQRMLGKNVLQPMGWDAFGLPAEEAAIRNNTDPFSWTQKN
FT                   IKYMKKQLQSLGFSYDWSREITTCHPEYYHWEQWFFTKLYEKKLVYKKNSLVNWCSYDK
FT                   TVLANEQVIDGCCWRCQNKIRIKQIPQWFIKIRNYAESLYQDLKKLTHWPENVKNMQRN
FT                   WIGRIKGFEITLNVFNTCQKLKVFTQRLDLLMGVTYISISSCHKLSINLSKKNELIKKF
FT                   IKKYRYISQEEQYKVKYTGINTNLFVVHPITKKTIPIWISNATHIEYGTNAVLSIPGHN
FT                   ENDWNFAVKNNLKIKYVIFNPDHQEPKLYTSFLDIKGTLFNSQEFNGLNLKDGTEKIKK
FT                   ILYKKKILKEKINYKLQDWCISRQRYWGTPIPMAKFKNGKMIPIPENQLPVVLPKIRKN
FT                   TNLLQQAINFNSKWAEIFIHGKHAIREIDTFDTFMESSWYYARYTCPNFNTGMIDSIAS
FT                   KYWLPVDQYIGGIEHAIMHLMYFRFYHKLLRDFKLVDFDEPVKNLLCQGMVLSEAFYKI
FT                   DSNSQRKWFNSSSVLIKRNTKGEIIESHTQKGEKLIYAGMIKMSKSKNNGIEPELIIQR
FT                   YGADTIRLFIMFSAPVESDLEWKESGLKGIYRFLKKLWMLIFNYIDIKNTHKKINFDFL
FT                   NHQQSELRYQLHKTIAKVSDDIGRRQTFNTAISEIMKLVNQLSKAPIKEEQDKSIMRES
FT                   LICIIKMLYPFTPHFCFFVWNYFNNHSSIDNEKWPIFQKDILSKKYSTIVAQINGKKRC
FT                   ATKISDSLTKEEIFLYIQNQPIIKKYLEDVDIKKIIYIPKKIINFVT"
FT   CDS_pept        486500..487495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /product="DNA polymerase III delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="BU445"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13143"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13143"
FT                   /db_xref="GOA:P57520"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032780"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57520"
FT                   /protein_id="BAB13143.1"
FT                   /translation="MKNIYPNELKKSLMQKLHYFYIFLGEDFFLLEKNQDMILNFAYKK
FT                   GFLEKIIIDVEKNQDWKKIILFYKTNNLFFKKTTLVINFLIKKLNVILIQNLNKMFSLL
FT                   HPDILIILKFNHLSRFIQKNKSLKEFKNYNIVSCFTPYNLNFINWIKYEIQEKKINIEE
FT                   KAFFLLCKYYEGNTLFIYKILDMLFIIWPDTCITEKKIKKIIIEFFDVSPSYWINSIFQ
FT                   GKTEKSFYILNIFFKKKYNPLILVRSLQKDLLQLIHMKREKKISIYVMLEKYNIFVTRR
FT                   KFFIKAFNKINNDSLLKAIQILVKIEVNIKKKYNNYVWNQLQELILILCN"
FT   CDS_pept        487518..488162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeN"
FT                   /product="hypothetical protein"
FT                   /note="BU446"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13144"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13144"
FT                   /db_xref="GOA:P57521"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57521"
FT                   /protein_id="BAB13144.1"
FT                   /translation="MKKLCAIFGGNFDPIHYGHINLAEKLAKDISIKKIILLPNNYPPH
FT                   RNKTQTSISDKIKMIKLAIHNNPLFEISYLETKKNNIFYTIDTLKKIRKKISHLEPLCF
FT                   IIGEDNLQTFYLWKNWREILLYSHLLIYPRKHKKQKNDELEKWIHSNTVYDCNLLHKQP
FT                   CGLIFFSHAPCINISSSRIRKNYFYGKNSHSLLPSIVNNYILLKKLYYTNQ"
FT   CDS_pept        488223..488453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhhP"
FT                   /product="hypothetical protein"
FT                   /note="BU447"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13145"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13145"
FT                   /db_xref="GOA:P57522"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57522"
FT                   /protein_id="BAB13145.1"
FT                   /translation="MKKNIILNLIGLRCPEPIMIIRKTIRDMKDNEKILILSDDPATKR
FT                   DIPNFCYFMEHKLLKNEIKVKPYRYLLKKGL"
FT   CDS_pept        complement(488600..489715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="BU448"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13146"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13146"
FT                   /db_xref="GOA:P57523"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57523"
FT                   /protein_id="BAB13146.1"
FT                   /translation="MIKIVGLVGWRGMVGSVLLKRMQEENDFSRIKPVFFSTSQFGQDG
FT                   PIINNISYNILENAYNIDVLKEMDIIITCQGGSYTKEIYPTLRKNGWKGYWIDAASNLR
FT                   MKNDSVIILDPVNYNVIEDSINKGIRTFVGGNCTISLMLMSLGGLFQTELVEWIAVSTY
FT                   QAASGAGARHMIELLNQMGILYKSVETDLLKGSHSILSIEDKVTKISRSVNFPVKNFSV
FT                   PLAASLIPWIDTEMSNGQSREEWKGQAETNKILGTKDTILIDGTCVRIGSLRCHSQSFV
FT                   IKLKKDVSLEDIEEIIRNHNKWVDVIPNSIQDTLLKLTPSSVTGTLNIPIGRLRKLNMG
FT                   KKYLSAFTVGDQLLWGAAEPLRRMLNILINI"
FT   CDS_pept        490053..490601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhgN"
FT                   /product="hypothetical protein"
FT                   /note="BU449"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13147"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13147"
FT                   /db_xref="GOA:P57524"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57524"
FT                   /protein_id="BAB13147.1"
FT                   /translation="MDPLGNLPIFMTILKHLDVKRRRIVVIREMIIALIVMLLFLFVGE
FT                   KILIILNLKTETVSISGGVILFLIAIKMIFPSEDNNNEISSSEEPFLVPLAIPLVAGPS
FT                   LLATLMLLSHQYLHHMFYLVGSLLISWFFTVIILLSSSLFLKLFGSKGVNALERLMGLV
FT                   LIMLSTQMFLDGIRAWFKN"
FT   CDS_pept        490715..491887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="BU450"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13148"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13148"
FT                   /db_xref="GOA:P57525"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57525"
FT                   /protein_id="BAB13148.1"
FT                   /translation="MTIRKMTELNITEKRILIRSDLNVPIENGIIQSDARILAALPTIE
FT                   LALQKKAKVIIMSHLGRPKEGYYTKKYSLFPIFEYFKKKFNNTKIYFSNNFLDGIKLNP
FT                   GEIALLENTRFNKGELNNDEQLSKKYSDLCDIFVMDAFGSAHRMQSSTYGIGKFVKIAC
FT                   AGLLLISEIDALKKALKKPKRPMVAIVGGSKVSTKFNVLNKLSKIADTIIVGGGIANTF
FT                   LAIDYKIGKSLYEPDFVFEAKKLRDKYNIIVPIDSRVGKNFCKNEQAIIKSPDNIKEDE
FT                   EIMDFGDESIKKIISIITQSQTIMWNGPVGVFEFPNFRKGTEMIAKTIANSNAFSIAGG
FT                   GDTLSVIDMFNIKNNISYISTGGGAFLEFIEGKKLPAIQMLEENFKNKSK"
FT   CDS_pept        491903..492979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="BU451"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13149"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13149"
FT                   /db_xref="GOA:P57526"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57526"
FT                   /protein_id="BAB13149.1"
FT                   /translation="MNILNVIRPGVMNGDEARIVFELAKKKQFAIPAVNCIGTDSINAV
FT                   LETAARVKSPIIIQFSHGGASFIAGYKKKLSENQEQAIQGAVSGAQHVHLMAKHYEIPV
FT                   ILHTDHCPKETLSWIDGLLEVGQNYYFNNNRPLFTSHMIDLSKESLEENISTCKKYFKR
FT                   IKNINMMLEIELGCTGGEEDGIDNTKIDKKLLYTQPQDVNYAYEELNTISKNFSIAASF
FT                   GNIHGVYQPGNIDLRPIILKNSQEFVSSKHNLEKNPLNLVFHGGSGSNLKEIKESIQYG
FT                   VVKMNIDTDIQWAAWKGVLDFYKQNKEFLQHQLGNTTNKHKPNKKYYDPRTWIRKSQES
FT                   ISIRLEQSFKELNSFNIL"
FT   CDS_pept        493043..493960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggB"
FT                   /product="hypothetical protein"
FT                   /note="BU452"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13150"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13150"
FT                   /db_xref="GOA:P57527"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57527"
FT                   /protein_id="BAB13150.1"
FT                   /translation="MLFIKIEIIAKTLLIINKKYTEIKMDELNVVNNINHAGTWLIRNQ
FT                   ELLLRYTINLTSAIIILVVGMFISKIISNGANQVLITRNIDATIAGFLSALMRYIIITF
FT                   TFIAALGRIGVQTTSVIAILGAAGMAIGLALQGSLSNFAAGVLLVTLRPLKTEEYVDLG
FT                   SVSGTVLNIHIFYTTLRTLDGKIVVVPNNKIISGNIINYSREPARRNEFIISVSYNSDI
FT                   DLVIKILRSVIEKEERVIKDKDIIVGLSELAPSSLNFIVRCWSKNHDLNTVYWDLMAKF
FT                   KKELDKNNINIPFPQLDVHVYKKK"
FT   CDS_pept        494019..497231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recC"
FT                   /product="exodeoxyribonuclease V 125 kD polypeptide"
FT                   /EC_number="3.1.11.5"
FT                   /note="BU453"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13151"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13151"
FT                   /db_xref="GOA:P57528"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57528"
FT                   /protein_id="BAB13151.1"
FT                   /translation="MFTIYKSNSLNTLLLKAYHIIEEKPFSNIFEKEIFIYDNKVLFQY
FT                   LNIFIAEKKGISANFKFYHPNDFIWKLFKIILSKKELKNIFTHSMIIWEIIKILDNKKF
FT                   FENCSKKKDMIKKFKFSFLMASIFKKYILYRPEWINQWEIEKNISIFDKNEQWQIKLWM
FT                   EIIHNTKKINQSSDHFANLFYNIQKIIKEKKIKKKYLPKRFFIISSFSMNPSYIKIFQN
FT                   ISIYTDIYFLYITPFKKNIFNFIQDNKIFTDIKIEKKNILNDSLITLWGQYEEIYYFYI
FT                   LKSKKNKVINCFKKNKNKSLLSQIKNNFFNDSEFTRKKRFLEISDHSISINICFNKKNE
FT                   IEVLYEKLLIFLNENSSIKPGDIVVTSFSLDTYISSINLIFQSIDNKKTIPFFIAKKSS
FT                   KTTEIMLWSFKKILNLSNSRFENEEILELLDVPEIAEKFNFSEEEIKILYHWIEETNIR
FT                   WGINEKHKNYLLFPKNKQNTWFYGIEKLLLSYAMNDTEKIWNGVLSCSFINGSRSELIG
FT                   KLISFIKILEKWQKKLSKLQYLTYWRSLYSDLVSDFFQNNTKIEKSIQIIQKKWIEIID
FT                   DSLSSNYLKKISINILKKIFFYKYYDNNHEIFLPGVVNFCYPDSVCYIPFKVICMIGTD
FT                   HTSIPKTNYLDNFNLLKKYPLIGDINLYQKYSYLFVQSLSCAEKYFYISYIGYSVKDES
FT                   KVHPSILVDQLLNYITLNFCFIGDQNLSYKENSKKITKYLCKKHKKQFFYETKNIESFI
FT                   QDDIKNDFKHTEKNISHKNLLKKNTDNEINLKDLINFWKHPIRYFYNSHLKIKIRQKKQ
FT                   KINTTETFLVNPLNSFKIKNKLLDYIIHNKNITKLYQHYLLSGKLPYHFFGEIFWIKNI
FT                   KEMKLIANKVMQYRIEKEEKKINLNIEKYQIYGVLSEIQSTGLLRWKTSSIRYSDRIAL
FT                   WLEHLIYSILGGCGKSKIIGYKSQIWSFSSLNSHRAHSYLLEYIKGYIKGMKEPLFLTK
FT                   SGASWLDQVYDERNNCIKNDYYTKIKAYKKLLYTWKGDNYTEGEQEDYYLKKTITISNK
FT                   KNIKKICESAEKWLIPILKNKG"
FT   CDS_pept        497248..500772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recB"
FT                   /product="exodeoxyribonuclease V 135 kD polypeptide"
FT                   /EC_number="3.1.11.5"
FT                   /note="BU454"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13152"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13152"
FT                   /db_xref="GOA:P57529"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57529"
FT                   /protein_id="BAB13152.1"
FT                   /translation="MKIDSLKEKLNIFKIPLNGIKLIEASAGTGKTFTIVLLYLRLLLG
FT                   IGEKKIYKKKLLVHEILVVTFTNKAKEELYIRIKDGIQNMYLTCINKTTSDSSFQFFFK
FT                   EIHDIKEAIYVLKRAQNDMNSSSIYTIHSFCQHILQLHTFHFNDIFEEKIIENEDNLYL
FT                   QATQDFWRRFFYTLPEDIIKIIYQDYKSPDHLLKTIKPFFYIKSINFPTKILNNKKLIM
FT                   YHEENIKKIIFFKEMWLIYHKIIQKTINDLEINKKIYSKFNLIKWINKITEWAKSETKD
FT                   YTIPSILKYFTKKNIEKNTINNTCSKYIIFEESEKILKKKFSLKNVIIIYAVKKIHQFL
FT                   LKEKKKKSLIGFNDLLSILLKTIKKEKFLKDLIIKKYPAAFIDEFQDTDIQQYKIFNLL
FT                   YKKNKTTVLFLIGDPKQAIYSFRGADIFSYLYAKSKIKKYYYLDTNWRSSINICKSINF
FT                   LFSQNINPFIFKNIPYIPVVPSSKNLKMNFTINDVAQTPISFFLQEEKEVSIDDYQVWI
FT                   SKQCANEISFWLTCAKTGKAKITTKNGEKILTANDIAILVRNRKEADLIQDELEKLNII
FT                   SIYSSNKNSVFQTLDAQELLWILESILEPENEILLQQSMASHILKKLSLVVENKTISNK
FT                   NSYFIIEKLYEYHDIWEKIGVFQMIKIMILEYQKNSFCTEINENHIKNLNFLHIGELLQ
FT                   EQFQFFHKKISLIRWFQKKISTKTQPEYNESIKCFDESPSIKIITIHKSKGLEYPIVWI
FT                   PFSIDFKKSTLAIYHDQKSLKTFFDENYSNKFLKIADEERLAEDIRFLYVALTRSILHC
FT                   SIGLACLIKKIIKNRNNSDIHQSGLGFTIQGGKTMNYEGLLEKLKKLSINNFIEVKNNT
FT                   DNFSFSRKPQTISLICKNKFLNKKNIRNTWSITSFSQLNKINKLSKHHQKEVALKELCI
FT                   KNQEKKNQSLLTIHNFPKGKKTGLMIHYILKNLHVLKNKNSNWFSCILEKYNIHIKWTS
FT                   VLIYWIKNIINTPLNDEKIILSRIDEKSSIRELEFFFPIKNMLYSTELNKIIQSINPTS
FT                   ITSPQLSFNPVKGMLTGFVDLVFIWKKKYYILDYKSNWLGKNNNFYSSIHINKEIVKKR
FT                   YHLQYQIYTIAIHKYLQKKLKNYNYKDDFGGVFYFFLRAIDCPKKNNGIFYTMPNYSLI
FT                   KKTMTLIS"
FT   CDS_pept        500778..502586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /product="exodeoxyribonuclease V 67 kD polypeptide"
FT                   /EC_number="3.1.11.5"
FT                   /note="BU455"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13153"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13153"
FT                   /db_xref="GOA:P57530"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR041851"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57530"
FT                   /protein_id="BAB13153.1"
FT                   /translation="MLILLKKAVKLKIIRPIDFYFSQFIAQKNNIVMLVAACVSYESSR
FT                   GYISLPIKYFEKHYFFSSSNEVFIKKILTLLEKKINWPVELLKHASIGNGGTSTPLVLH
FT                   KKKIYLYKMWKSESNIFNYLYTKNKKNKINQKKCSKILENLFPQKNMSFQKIAVALTLI
FT                   NNITFIIGGPGTGKTTTILKIIIALIKSSKKSIKIQLSAPTGKATTHLNEILKNNIFDL
FT                   YFSEKEKCSLPSTATTIHQLLGIQKISQKSFFNKSNCLDLDVLIIDEISMVDILMMEKI
FT                   LSSISKNTKLIFIGDHNQLGPIESGSILRKICYYANDGYSFKSMISIEKLTQYKLCKKI
FT                   NKKTTNFISDNICVLNKNYRFNKNSGIYTLSNAIFKKKTRIIESLFDNSIKNIFFYETN
FT                   SSEQYKKMIKNICLNYEDFWEKIYKKATMKEIIESFQNYQVLCILHDGLFGVNIINKKL
FT                   EENMYKKNIIKYFYIDGEEWYIGKPIMIINNNRALNVSNGNIGITNINKNGILQVSFLK
FT                   ENNTINNIPVKILRNYKTAWAITVHKSQGSEFMNTALILPNFNSHILNKDTLYTGITRS
FT                   RKILSIFSDKKIFLNTIFKNTNKILF"
FT   CDS_pept        complement(502625..503953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argA"
FT                   /product="amino-acid acetyltransferase"
FT                   /EC_number="2.3.1.1"
FT                   /note="BU456"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13154"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13154"
FT                   /db_xref="GOA:O66143"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:O66143"
FT                   /protein_id="BAB13154.1"
FT                   /translation="MKERNTELVQGFRHSVPYINAHRGKTFVIMLGGEAIKYGNFYSII
FT                   NDIGLLHSLGIRLVVVYGACPQINTSLKEKNIKIIYHKSIRITDLASLEQVKQAAGKLQ
FT                   LDITARLSMSLTNTPLQGANISVVSGNFIISQPLGVDDGVDYCHSGRVRRIDKNAINCQ
FT                   LNNGAIVLIGPVAVSVTGESFNLTSEEIATQVSIELKAEKMIGFCGNQGVINDEGKIIS
FT                   ELLSNDIKNIIKKLEKKGDYISSTVRFLKGSIKACKSGVNRSHLISYHKSGALLQELFS
FT                   RDGIGTQMVMESAEKIRGASINDIGGILELIRPLEHKGILVRRSREQLEIEVDKFTIIE
FT                   HDNLTIACAALYPFFKEKIGEMACLAVHPDYRNSSRGDALLKKIKMNAKDMHLKRIFVL
FT                   TTQSIHWFQERGFILVDIEVLPESKKKMYNYQRGSKILMIDVI"
FT   tRNA            complement(504133..504209)
FT                   /product="tRNA-Met (CAT)"
FT   CDS_pept        504321..505400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltA"
FT                   /product="membrane-bound lytic murein transglycosylase A
FT                   precursor"
FT                   /note="BU458"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13155"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13155"
FT                   /db_xref="GOA:P57531"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57531"
FT                   /protein_id="BAB13155.1"
FT                   /translation="MQKKIIKTIIFFSLFFLFEKSYAYININQGQQYEKKLIQNLTKIK
FT                   QINIKKKIINAESFYIQVEKIKKFSPSLYLKNESTYKTILKWLKKNSNINELNEFGINL
FT                   FQMKGIDNYGNVKITGYYTPIVQARKIKKNNFKYPIYSMPYHLKKNEPLPKRKDIYNGV
FT                   LDKKYILAYSNSLIDNFIMEIQGSAFIDYGNKKKLIFFSYAGKNGWPYKSIGQILINRG
FT                   DIEKKNMSMQAINKWFTKHTNKEIQDLFEKNESFVFFKETKKKQVYGASAVPLIAQTSV
FT                   AADNSIIKKGSVILLKIPILDQNGVFLNKYEMRLVIALDVGGAIKGHHFDIYEGIGTKA
FT                   SILSGYYNHYGYAWILNKK"
FT   CDS_pept        505439..505921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="BU459"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13156"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13156"
FT                   /db_xref="GOA:Q9ZNM0"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZNM0"
FT                   /protein_id="BAB13156.1"
FT                   /translation="MNIIQSGITAENSSIAIIIARFNEFINKNLLLGALDTLKRIGQVH
FT                   EENILKIYVPGTYEIPTIASYIAKSGKYDAIIAIGTIIKGQTDHFKYIANDTSSSLSRI
FT                   SAQYFLPITLGILTTKNIEQSIERSGTKMGNKGSDAALAALEMINVMKKLKKVIYY"
FT   CDS_pept        505951..506922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /product="thiamin-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="BU460"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13157"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13157"
FT                   /db_xref="GOA:P57532"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57532"
FT                   /protein_id="BAB13157.1"
FT                   /translation="MKYTEFEIISKYFKRNQKKDVNEIKGIGDDSALIKIPKNNILAIS
FT                   TDTLVEGTHFLKNISPEDLGYKTVAVNLSDLAAMGAEPKWTTLSITMPESNNIWLKKFS
FT                   SSFFKILNKYNVRLIGGDTNRGSLSITLSMYGLLKKQIALLRSNANIGDLIYVTGTLGE
FT                   SAAGLFLLKKNIFIKNVNIRNYLIKKHLNPIPRVSEGMALRKIANAAIDLSDGLIADLD
FT                   HILNDSQCGANINLNKIPISKVLIDNFQSQNYLNWALNVGEDYELCFTISKKNIDKLKI
FT                   IKKKFLVNFTCIGYITPIEQGFNLFDNQKKIIFKKKGFNHFD"
FT   CDS_pept        506978..507403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD1"
FT                   /product="riboflavin deaminase"
FT                   /EC_number="3.5.4.26"
FT                   /note="BU461"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13158"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13158"
FT                   /db_xref="GOA:P57533"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57533"
FT                   /protein_id="BAB13158.1"
FT                   /translation="MKRAIELSKLGEFTTAPNPNVGCVIVKNNIIVGEGWHEQAGKNHA
FT                   EINALIMAGEKAQGGTAYVTLEPCNHFGKTPPCCNALIKSGINRVVISNIDPNPKISGN
FT                   GILYLKKHGICVKTGLLSKESKQYNKGFFKRMKTGFP"
FT   CDS_pept        507446..508069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD2"
FT                   /product="riboflavin reductase"
FT                   /EC_number="1.1.1.193"
FT                   /note="BU462"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13159"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13159"
FT                   /db_xref="GOA:P57534"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57534"
FT                   /protein_id="BAB13159.1"
FT                   /translation="MRNGDSKWITSKQARQDVQKFRAKSSVILSSSSTILSDNPLLNVR
FT                   YKELDKKTLSIFPNKIFQHPIRVIIDSKNRVQPSHNIIKTKGKIWLIRLKSDRKIWPKN
FT                   TTQIIEKDHNKKINIFSLLKFLGQSEINNVWIEAGSTLSGFLLNSYLIDELIIYMAPKI
FT                   LGHEAKPLCMIYEKLKISNSLQFKFKNICQIGPDIRLILSPKKI"
FT   CDS_pept        508106..508537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /product="N utilization substance protein B"
FT                   /note="BU463"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13160"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13160"
FT                   /db_xref="GOA:P57535"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57535"
FT                   /protein_id="BAB13160.1"
FT                   /translation="MKPSFRRKARACALQVLYSWEISHNNIKESAIYFLKEKNKKNIDI
FT                   VYFYELIIGITYDCKNIDNLMKPYLFRSLKELGHIERAILRISFYELHKRNDIPYKVSI
FT                   NEGIELAKLFGSEDSHKFINGVLDKAVFKMGYNKKVVIA"
FT   CDS_pept        complement(508592..510418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /product="dxs protein"
FT                   /note="BU464"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13161"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13161"
FT                   /db_xref="GOA:P57536"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57536"
FT                   /protein_id="BAB13161.1"
FT                   /translation="MNFNFNKYPILSFANSVENLRLLSVEQLPQLCFELREYLLDVVSI
FT                   SKGHFASGLGVVEITVALHYVYNTPFDNLLWDTGHQAYPHKILTGRGEKINSIRKKNGL
FT                   HSFPCREESEYDSLSVGHSSTSISAGLGMSIAAEKEGRNRKTICIIGDGAMTAGMAFEA
FT                   INHAGEIQSNLLVILNDNQMSISRNVGALNKHLKILRSVQNTQKNRKKIRLLNKKLFFK
FT                   DKRIQNHSISFNSIFSNLGCKYLGPFDGHNIFSIINTLKKIKNKKGTYLLHLVTKKGKG
FT                   YLPAELNPIKWHTISSRDSSVSKSLSYSDVFGTWLCEIAAFDKKLIAITPAMCEGSGMV
FT                   KFSRLFPNQYFDVAIAEQHAVTFAAGLAISGYKPVVSIYSTFFQRAYDQLIHDIALQKL
FT                   SVLFAVDRAGIVGNDGQTHQGVFDLAYLRCIPGIVIMTPSNENECRQMLYTGYMHNKGP
FT                   SVVRYPKGYGVGELLMPMNRIPIGKSLIKRRGKKIAILNFGILLHNAYCAAEKLDATLV
FT                   DMRFVKPLDKSMILKLSSQNKFFITLEEGVISGGAGSAVNEFIMVNKIFLPVLNIGLPD
FT                   TFIPQGTQEEIRHVYKLDSEGIYKQIFYWLRQ"
FT   CDS_pept        complement(510476..511324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /product="geranyltranstransferase"
FT                   /EC_number="2.5.1.10"
FT                   /note="BU465"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13162"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13162"
FT                   /db_xref="GOA:P57537"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57537"
FT                   /protein_id="BAB13162.1"
FT                   /translation="MHFFHLYERYKHRINQKLFYTLNQLPFQKSSLLKAMKYSVFSGSK
FT                   RLRSSLIYSTGDVFKVNITTLDVISTAIEFIHSYSLIHDDLPCMDNDNFRRGKISCHVK
FT                   YGESTSLLAGDALQSLAFNILSNSFMPNVSNLKRIKMISELSYSIGSSGMCMGQNLDLE
FT                   AEKKDVNLSELEIINLYKTSFLMRSAVRLVYFSSNNFSKSILSILDLFSISIGLAFQIQ
FT                   DDILDFKKDSVKTDNKKIIKKHTYPLIIGLDESRKKIKQLHKKSFLALNSLKKKISIPT
FT                   Y"
FT   CDS_pept        complement(511376..512548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajR"
FT                   /product="hypothetical protein"
FT                   /note="BU466"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13163"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13163"
FT                   /db_xref="GOA:P57538"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57538"
FT                   /protein_id="BAB13163.1"
FT                   /translation="MNFLELQVTLSFCVIFLLRMLGMFMILPILSKYGMLLDGGNKFLI
FT                   GLSMGIYGISQVIFQIPFGILSDKFNRKKIILLGLFMFFIGNIISASIHSIWGLIIGRF
FT                   FQGSGAISGVCMAFLSDLIREENRVKSIAAIGVSFAISFLIAVVSGPIIVHYFGFFSIF
FT                   WISAFLSIVCMIIVCFFVPFSKKNILKQNKTLHSYKKVLNFVLNKVFFRFYLGVFFLHF
FT                   LLMIKFTMIPNQFEISGFSLDNHWKVYLGTILISFFVLFLFIFYCKYKYILENIIEICI
FT                   LFILFSEIIFLSAQKNLLFLIISLQIFFISFNFLEVFLSSHLSRQLSNNYRGSIMSIYS
FT                   TSQFLGIFFGGVFSGWLYSFLNFSQIFYFELFIILLWLIFSFFLRNRFYL"
FT   CDS_pept        512622..512966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccK"
FT                   /product="hypothetical protein"
FT                   /note="BU467"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13164"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13164"
FT                   /db_xref="GOA:P57539"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57539"
FT                   /protein_id="BAB13164.1"
FT                   /translation="MNTDNKILYTYENLEKDSEGYLKKTKDWNIKLAEEIAKRENITLS
FT                   SDHWKVIIFVRKFYFKFNITPSMRMLIKSIQKEIGKSKMNSIYLFKLFPKGPAKQASKI
FT                   AGIPKPVKCL"
FT   CDS_pept        complement(512987..513844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /product="protohaeme IX farnesyltransferase"
FT                   /note="BU468"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13165"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13165"
FT                   /db_xref="GOA:P57540"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57540"
FT                   /protein_id="BAB13165.1"
FT                   /translation="MFKNYIEITKPGIIIGNSTLITGGFLFASRHAAFNYVLFIYTILG
FT                   ASLVIASACVFNNLIDIDIDKKMKRTSNRVLSKKLLPVFSVFNFAIFLGVLGLSILGCL
FT                   VNFISMSLAVFGFFIYVVLYTMFYKRRSFYSTFIGSFSGSTPSVIGYTAVSNTIDICSI
FT                   LLFVIVIFWQMSHFYSISIMRIKDYREAKIPVFSVVKGVAITKKHIFFYVLNFSFFSSL
FT                   FTFLGYLSYNFLLLSSIVNFYWSFLSYSNIKKNNDKKNARKLFYFSIIVIVFFNFLISI
FT                   DVFF"
FT   CDS_pept        complement(513872..514189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /note="BU469"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13166"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13166"
FT                   /db_xref="GOA:P57541"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57541"
FT                   /protein_id="BAB13166.1"
FT                   /translation="MSSFLNFNMNKEMKSYLLGFLFSSLLTTLPFLLAIEKFFCSEVNY
FT                   IIFLLCAISQIIIHFVYFLHLSFDPEERWNLITLLFVIIIIFIVVFGSIWIMFNLNHNT
FT                   M"
FT   CDS_pept        complement(514189..514806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /note="BU470"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13167"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13167"
FT                   /db_xref="GOA:P57542"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57542"
FT                   /protein_id="BAB13167.1"
FT                   /translation="MIENKFNNTILNSNSSTHDKISETKKLFGLWIYLMSDCIMFAVLF
FT                   AVYAIVSSNISINLISNKIFNLSSILLETFLLLLSSLSCGFVVIAMNQKRIKMIYSFLT
FT                   ITFIFGLIFLLMEVHEFYELIIENFGPDKNAFFSIFFTLVATHGVHIFFGLILILSILY
FT                   QIKKLGLTNSIRTRILCFSVFWHFLDIIWICVFTFVYLNGAI"
FT   CDS_pept        complement(514803..516791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /product="cytochrome o ubiquinol oxidase subunit I"
FT                   /note="BU471"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13168"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13168"
FT                   /db_xref="GOA:P57543"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57543"
FT                   /protein_id="BAB13168.1"
FT                   /translation="MFGKLTFDAIPYHEPIIMITYIAIILIALCIASTITYYKKWKYLW
FT                   YEWFTTVDHKKISIMYGILAFVMLFRGFVDAILMRTQQVVASAGFKGFLPPHHYDQIFT
FT                   AHGVIMIFFVAMPLVIGLMNLVIPLQIGARDVAFPFLNNLSFWLNVSSAVLLTLSLGIG
FT                   EFAQTGWLAYPPLSGIKYSSGVGVDYWIWSLQISGVGTTLTGINFLVTILKMRAPGMSF
FT                   FKMPVFTWTSLCTNILIVISFPVLTVTLVLLTLDRYFNFHFFTNDLGGNAMMYVNLIWI
FT                   WGHPEVYILVLPVFGVFSEVVATFSKKRLFGYVSLVWATLSITILSFIVWLHHFFTMGA
FT                   GADVNTFFGITTMIIAIPTGVKIFNWLFTIYQGRVHMHSSILWTLGFLVTFSIGGMTGV
FT                   LLSVPPADFVLHNSLFLVAHFHNVIIGGVVFGCFAGINYWFPKLFGFVLNEIWGKRAFW
FT                   FWIIGFFLAFIPLYFLGLMGMTRRLSQNIDSEFHMLLCIAAIGACFIGIGIICQVIQFF
FT                   ISIKERRHNLDLTGDPWDGRTLEWSTSSPAPLYNFAIIPKVEDRDDFWRNKEGQHYNKL
FT                   INSINYHDIHMPKNTGLGFMISIFSLFFGFSAVWHITWLCILSFLAIIISLFINSLNED
FT                   TEYTISAEEIKKIEHQYWKNIQKAGLK"
FT   CDS_pept        complement(516796..517686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /product="cytochrome o ubiquinol oxidase subunit II"
FT                   /note="BU472"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13169"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13169"
FT                   /db_xref="GOA:P57544"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57544"
FT                   /protein_id="BAB13169.1"
FT                   /translation="MKTLSLILIFFFLNGCNNPLLNSHGTIATEEYSLILISFIMMLFI
FT                   IIPVIFMTIYFSLKYRSTNVNQIYKPNWCDSKKIEIVVWTIPIIIVSFLAFLSWSYTHK
FT                   LDPKKSIVSLNNPIKIDAVALDWKWLFIYPDYNIATINEIMFPVNRPIVFRITSNSVMN
FT                   AFFIPSLGSQIYAMPGMTTKLNLIANDVGKYKGISSNYSGHGFSNMKFTAISVLKNSTF
FT                   LDWVKKVQASSIKLNTMKTFDIISIPNENYSIEYFSSVKKNLFNKIKNQYSIKHFILDE
FT                   NLSHEIVKKNFNMEK"
FT   CDS_pept        517985..518299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bolA"
FT                   /product="bolA protein"
FT                   /note="BU473"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13170"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13170"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57545"
FT                   /protein_id="BAB13170.1"
FT                   /translation="MTLEKIKKYLISKINIKFIEIYDDSQFHHYSKKGLTHLRIIIISD
FT                   DFINQTLINRHRIIFSMLSKMIEKKIYSLTLNTYTLNEWKDKKLKKTSNVKCVKKNNIL
FT                   "
FT   CDS_pept        518435..519763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /product="trigger factor"
FT                   /note="BU474"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13171"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13171"
FT                   /db_xref="GOA:P57546"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57546"
FT                   /protein_id="BAB13171.1"
FT                   /translation="MNFFMEKNKDAGHRVTIKIPKTTVNNSLLQEFIKIRKTTKINGFR
FT                   KGKTPIRVIQEKYGSAIYYDIFKKLMQKFFHEFIKTEKIKIIGSPKFYIHQDEDKKKEY
FT                   FEYSVIYELYPQFQIKDIKQIKVNKINVEITEEDIKKNIETNKNKKNIWNPVNKAVKSY
FT                   DRVTINYCIYEKNKKIKKFDKDNISFIVSKNTLIPQLNYKIINHFVNDIIFFKIKFHAF
FT                   HPEKELQNKDITFKIKIIKIEKKQELESEKSNKKNITEKKTIQTDYQTIKNNLHSQINI
FT                   ITDKYLENQIIQKIVEKNILLLPPLLFQKEIKNLYKQYTKQYQEENSNILEKKYHMSLD
FT                   SEVKKRLYFQIIIEQIILNNKLFADENNIQKLIKKISSNYKNPMEIIKLYNKNKNLKNT
FT                   MKNIELERQAMLLLKKSIKIEKQNWNFERFLNYNWASHEELML"
FT   CDS_pept        519898..520524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /product="ATP-dependent clp protease proteolytic subunit"
FT                   /EC_number="3.4.21.92"
FT                   /note="BU475"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13172"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13172"
FT                   /db_xref="GOA:P57547"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57547"
FT                   /protein_id="BAB13172.1"
FT                   /translation="MLYDQIKNNKTSSYATFIPMVVEQHSRGERSYDIYSRLLKERIIF
FT                   ITGAIEDNMANNIVAQILFLEAENPEKDIFLYINSPGGIITSGMSIYDTMQFVKPEIST
FT                   ICLGQACSMAALLLTSGAKGKRFCLPNSKVMIHQPLGGYQGQASDIAIHAREIMEMKKK
FT                   LNKLMSFHTGQSIKKINKDTERDCFLSANQSIKYGLIDFILSQRQ"
FT   CDS_pept        520623..521912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /product="ATP-dependent clp protease ATP-binding subunit
FT                   clpX"
FT                   /note="BU476"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13173"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13173"
FT                   /db_xref="GOA:P57548"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57548"
FT                   /protein_id="BAB13173.1"
FT                   /translation="MTDKSKDNSKSLLYCSFCGKNQKEVQKLIAGPKVYICDECIRLCN
FT                   DIITEETIKQNNITDTENKINYLPKPHEIKKHLDNYVIGQNYTKKVLSVAVYNHYKRLY
FT                   NFNKKTDSVELGKSNILLIGPTGSGKTLLAQTLAKLLDVPFTITDATTLTEAGYVGEDV
FT                   ENVIQKLLQKCKYNVKKAELGIVYIDEIDKIARKSDNPSITRDVSGEGVQQALLKLIEG
FT                   TLASIPPQGGRKHPQQEFLQVNTSNILFICAGAFSELSKIVSKRLDAGTEIGFKANIKE
FT                   KKQKKSEDFLLKQVEPEDLIKFGLIPEFIGRLPIITILNKLTEDALVNILCKPKNALIK
FT                   QYQTLFELENVKLEFNAESIQLIAKKAMNKNTGARGLRSIIEGILLNIMYELPSMVNIE
FT                   KILINESVVNSNSLPKIIYGKNKSKKASGE"
FT   CDS_pept        522104..524437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="BU477"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13174"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13174"
FT                   /db_xref="GOA:P57549"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57549"
FT                   /protein_id="BAB13174.1"
FT                   /translation="MNSERSERITIPVLPLRDVVIYPHMVIPLFVGRQKSIKCIETSMS
FT                   NDKKIMLIAQKEASKDEPTPKDLFDIGTISAILQMLKLPDGTVKVLIEGLQRAHIKNLT
FT                   NNGEHFIAEVELISSSNLLDKNQEVLIRTTMNQFESYIKLNKKIPLEILNVLNNIKNSE
FT                   KLADTIAAHMPLKLNDKQSVLEIRNINDRLEFLMAIMESEIDLLQVEKRIRHRVKKQME
FT                   KSQREYYLNEQIKAIQKELGDMDEIPDENKILKRKIKSSKMPKEAREKTELELQKLKMM
FT                   SPMSAEATVVRSYIDWMIQVPWYLKTKIKKDLQQAKKILDIDHFGLETVKDRILEYLAV
FT                   QSRKNKIKGPILCLIGPPGVGKTSLGKSIARSTGRKYVRIALGGIRDEAEIRGHRRTYI
FT                   GSMPGKLIQKMAKAKVKNPLFLLDEIDKMSRDIRVDPASALLEVLDSEQNMNFNDHYLE
FT                   VDYDLSDVMFVATSNSMNIPAPLLDRMEIIRLSGYTEDEKLNIAKRYLYPKQIERNGLE
FT                   ENEIKITDSAIISIIHYYTREAGVRSLEREISKICRKAVKNLILDKSLKHIEINSKNLK
FT                   KFLGIKRFDYGKIHGTNQIGQVIGLAWTEVGGELLTIETTCVSGKGKLTYTGSLGEVMQ
FT                   ESIQAALTVVRSQADRLGIKKDFHEKHDIHVHVPEGATPKDGPSAGAAMCTAIVSSLTN
FT                   NPVKSNVAMTGEITLHGKILPIGGLKEKLLAAHRGGIKTVLIPYENKRNLEEIPKNIIE
FT                   GLNIHPIKKIEEVLKLSLEKIPYV"
FT   CDS_pept        524579..526450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiD"
FT                   /product="peptidyl-prolyl cis-trans isomerase D"
FT                   /EC_number="5.2.1.8"
FT                   /note="BU478"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13175"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13175"
FT                   /db_xref="GOA:P57550"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57550"
FT                   /protein_id="BAB13175.1"
FT                   /translation="MTKYSQARLNSIIVKFILGVIILSLILSTISIYINRDFEKYIATV
FT                   NGEKISFNLFKKMYFIEREKQKKILGKNFFKFSHNENFTKETYNYVLSQLINNVLLEQY
FT                   AKNMNYLEVNDNTIKKIIYNSPIFQKNNKFSKERYLNYLTSINSTNHEYINIIKKKINT
FT                   ENLIHTISKSNFILKKEEKNIIKLLSQKRIIKKAIVKIDPSIYKKNITNQEAQIYFKKN
FT                   QDNFYIPEKFKINFVELKTDNFKIHCENKEIYDWYIRNITQYSTKEKRRYSIIQVKNKQ
FT                   QAISILSRLHNTPEDFSKIAQEQSTDPISSKKDGDIGWISIDLIPDEIKHANLNKKNQI
FT                   SDVIPFHNEFLIVKLNETQIGTQKKIYEVFDSIKKQIKQKKSLDLYNELKNKISNNLKN
FT                   DPGKIERILKENNILIQETDWFDKKSIPKVLNIPILKQFIFNKKLFQKDTTVKPQFHFI
FT                   VLKKNQSFLIKIKKFKNKEIQHFENVKKNIIKKLRFIKAIKETKKKSEEIIYDLTQGRK
FT                   KLFKQSNLYFTDPEIISRYDLSAITSIVFSLPHPQKGKKIYTLYNDKNKNFIIISLEKV
FT                   YNTNFSEKEKNVILEYLSRHNTEIIFNSILKDLREKSIIKYENIVNK"
FT   CDS_pept        527423..529192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdl"
FT                   /product="multidrug resistance-like ATP-binding protein
FT                   mdl"
FT                   /note="BU479"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13176"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13176"
FT                   /db_xref="GOA:P57551"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57551"
FT                   /protein_id="BAB13176.1"
FT                   /translation="MKLFNQLRWFFVREWKRYLGAILLLIIIATLQLLPPKIVGVLIDL
FT                   IIKKNMHGVQILPWILIIFLVAVIVYILRYLWRILLFGASYQLATELRVKFYTYLSQQS
FT                   QIFFLKNRTGDLIARATNDVDRVVFAAGEGVLTLVDSLVMGFSVLIVMSTQISFLLTII
FT                   SLIPMPIMAILIKKYGKELHETFRHAQISFSLLNNQTQEILTSIRMIRAFGLEKNQSNK
FT                   FNIITRNTGKKNMEVAKIDARFDPVIYLSVAFSNLLAIIGGGWLVWNNQISIGQLTSFI
FT                   MYLGLMIWPMLALAWMFNIVERGSAAWDRIHSIINKKLYIEDGKNNIPPYPGILNINIK
FT                   KFYYPNNQKPSLKDIRILIKPGNTLGICGPTGSGKSTLLMLIQRQFNFKKEEIHYHSLS
FT                   LLEIKIDDWRRRIAVVNQTSFLFSDTISNNISLGKPNASQKEIEEVAKLADVHKDIIDL
FT                   PERYETQVGERGVMLSGGQKQRVCIARALLLNAEILILDDALSAVDAQTENNILKNINE
FT                   WKKKKHSLIITTHRLSALINSDEIIVIKSGSIIQRGNHLKLIQEKNWYKSMYYYQQSEI
FT                   ELEDNEKTGEKNL"
FT   CDS_pept        529164..530936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlB"
FT                   /product="mdlB"
FT                   /note="BU480"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13177"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13177"
FT                   /db_xref="GOA:P57552"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57552"
FT                   /protein_id="BAB13177.1"
FT                   /translation="MKKQVKKIYNMNHLIAFWPILKRLLIYVKPHKKKLILAFIFLLSG
FT                   STSEVLGPILISYFINNILSKHQLHLLIILTIITLFIILQILSVFLNYFQSILFNKIAV
FT                   ESINKLRQDVMYAALQQPISEFDSQPIGQMISKVTNDTEAVKELYDTVGPTLFRSIILI
FT                   FIILFAMFTLEWHMALVALFILPLVITIMLVYQYYSTPLLRKVRYYLAEINNKFNETIN
FT                   GMNVIQQFCQQRRFQEKIKKSSDLHYMSRMKILRLDGFLLRPLLSLLSSMILCNFMFLF
FT                   SFFPVGAFEVGVLYAFITYLGRLNEPLIAITIQQSVLQQSIVAGERIFSLIDSPKQKYG
FT                   KNKDLLKSGKINIQNVSFYHKNCNKNILENINIKISSKSFVAFVGHTGSGKSTLANLIM
FT                   GYYPLKNGKIYLDDKSIDSISHSVLRRNVLMVQQDPIVLSDTFFYNITLGRKIPEEKVW
FT                   NILDTVHLSDLVKSMPKGIYSLLGEEGNNLSVGQKQLLAIARVLVAYPKVLILDEATAN
FT                   IDSGTEQLIQKTLLSIRKNCTLIIIAHRLSTIIEADSIIVLKKGKIVEFGTHEQLLTKK
FT                   SCYYKMYKFQSCKF"
FT   CDS_pept        531231..532316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /product="DNA polymerase III subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="BU481"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13178"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13178"
FT                   /db_xref="GOA:P57553"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57553"
FT                   /protein_id="BAB13178.1"
FT                   /translation="MNYQILARKWRPQYFRDIIGQKHIVTAISNGLSLGRIHHAWLLSG
FT                   TRGIGKTTIARLLAKSLNCQNGITSDPCRQCIICKEIEKGLCLDVIEIDGASRTKVEEM
FT                   REILDSIYYSPIKSRFKVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFVLATTDVDRIP
FT                   KTIISRCLYFKLQIISEEKIFKFLKYILIKESIDTDEYSLKKIAYHAHGSIRDALNLLE
FT                   HAINLGNGHVNIKNVTDMLGLLPEKYSFLLTDAVLKKDSKKTMLLLNKISSIGVEWEEI
FT                   LIEMLRFLYHISTSQSFPLVWEKIFTEKYKNQIQKIAQNNKKTNIQLCYQILLNGRKEL
FT                   KFAPSQKIGVEMSLLRVISAI"
FT   CDS_pept        532636..532965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /product="hypothetical protein"
FT                   /note="BU482"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13179"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13179"
FT                   /db_xref="GOA:P57554"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57554"
FT                   /protein_id="BAB13179.1"
FT                   /translation="MFTKGGLGNLMKQAQQMQEKMAKIQEEIAQMEVTGEAGAGLVKVT
FT                   INGAHNCRRVEVDPSLLQDDKDMLEDLAAAAFNDATRRISEVQKKKMSAISTGMQLPNG
FT                   FNMPV"
FT   CDS_pept        533111..534985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /product="heat shock protein htpG"
FT                   /note="BU483"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13180"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13180"
FT                   /db_xref="GOA:P57555"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57555"
FT                   /protein_id="BAB13180.1"
FT                   /translation="MKTQKKEVYNFQSETKKLLHLMIHSLYSNKEIFLRELISNSSDAI
FT                   DKLRFESISSPELYENDSDVKIQISINKAQRTLIISDNGIGMTKEDTIENLGTIAKSGT
FT                   KSFLQSLEQKQNKKNELIGEFGVGFYSSFIVSEKVSVRTRFAGLESNKGILWESSGEGE
FT                   YNITNIVKKTRGTEITLFLKKEEEEFLETWRIKNIISKYSDHITIPIHIQDYDKKNKTY
FT                   FWEQINKAKALWTLNKSSITEEEYKDFYKHLTNDQNDPLIWSHNHVEGNQEYISLLYIP
FT                   EKAAWDIWNRDNKHGLKLYVKRVYIMDNSQAFLPNYLRFIKGLIDSSDLPLNISREILQ
FT                   DNSITEKLRKSLIKKSLSMLEKLAQKNNEKYQIFWNQFGLVLKEGPAEDHENLNKIANL
FT                   LRFTSMKSNNSEQKMSLKEYISNMNEQQEKIYYITADSYSSANNSPHLELFKKNNIDVL
FT                   LLSDRIDEWMMNYLSEFEGKKFQSISKEDISLNKLTKEKKIKNKDVSTEMIEFLKKVKN
FT                   ILGNQVKDVRLTHRLTETPCVLLSDSTEMTTQMAKLFSAAGQSVPELKYIFEINPDHIL
FT                   IKKICTINNENELHQWIKLLLDQALLAEKGNLENPHKFISRMNKLLIK"
FT   CDS_pept        535058..535705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="BU484"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13181"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13181"
FT                   /db_xref="GOA:P57556"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57556"
FT                   /protein_id="BAB13181.1"
FT                   /translation="MRIILLGAPGTGKGTQGKFITEKYKIPQISTGDMLRESVVLKNKI
FT                   GMIIKNIIEEGKLVSDEIVCHLIKNRIKKHDCINGFILDGFPRTIQQALYLSKKNIKID
FT                   YVLEFIIPHEYILERISGRRIHIQSGRIYHVKFKPPKIKDKDDLTGQTLITRKDDTKEG
FT                   IKKRLEEYKKVHDPLVQYYIHEKKRGNIKFFQIDAMLSFSSIRKKLETILKK"
FT   tRNA            complement(535708..535781)
FT                   /product="tRNA-Arg (TCT)"
FT   CDS_pept        535936..536793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /product="methylenetetrahydrofolate dehydrogenase /
FT                   methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /note="BU486"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13182"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13182"
FT                   /db_xref="GOA:P57557"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57557"
FT                   /protein_id="BAB13182.1"
FT                   /translation="MPAIIIDGNKIAKKIELKILKKVKQRKKNGERIPGLAMILVGNHI
FT                   PSQIYVNKKKISCKNVGFFSECWNLPSNINEKEILNIISKLNENKNIDGILIQLPLPPQ
FT                   INHMKILSSIVPDKDVDGFHPYNTGSLCQRTPKLRACTPKGIITMLKYNKIKTHGLHAV
FT                   MVGASNIVGRPMSLELLLAGCTTTVTHRFTKNLKDHVQNADLLIVAVGKANFLKGSWIK
FT                   TGSIVIDVGINRLKNGKVVGDVEFKTAYLRASYITPVPGGVGPMTVATLLQNTLEACEN
FT                   HDDI"
FT   CDS_pept        complement(536790..538184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="BU487"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13183"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13183"
FT                   /db_xref="GOA:P57558"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57558"
FT                   /protein_id="BAB13183.1"
FT                   /translation="MLKIFNTLTSTKEIFTPIKKNRVNLYVCGVTVYDFCHIGHGRTFV
FT                   VFDMIVRYLRFSGFQVKYVRNITDIDDKIISKSTKEKKKINTFTASMIKEMHKDFDLLG
FT                   ISVPDEEPRVTDYIDNIIRIITTLIKKKHAYIHKNGDVIFSIDSDPNYGTLSRQSLTSL
FT                   ESGSRIPLNNMKKNPLDFILWKSSNKEEYSWDSPWGKGRPGWHIECSAITNVFFNNSID
FT                   IHGGGSDLLFPHHENERSQSICFNNKSMINFWMHTGMVILNNKKMSKSLGNVYFLRNIL
FT                   KDCDAEVLRYFFLSTHYRHPIYYCEKNLDQAYTSLKYLYTALYDTNPFFNNEEGLNFEL
FT                   EFYNAMNDDFNTPAVFSIFFKIARKINFLKNKDILKTNKFAFRLKYLANNLGFLFQDPK
FT                   EFLQKKTTLNLLTLKEIQLLIEKRNIARQSKLWQEADNIRKKLMSLDIILEDLPDKTIW
FT                   RKNKKS"
FT   CDS_pept        538445..538708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeD"
FT                   /product="hypothetical protein"
FT                   /note="BU488"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13184"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13184"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57559"
FT                   /protein_id="BAB13184.1"
FT                   /translation="MKTKLREMLRFPCFFTYKIIGLAQPELIDQIIKVIQIQIPGDYTP
FT                   QVKSSNRGNYLSVSITICAKNFEQIECLYHEISKINIVRMVL"
FT   CDS_pept        complement(538815..539024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspE"
FT                   /product="cold shock-like protein cspE"
FT                   /note="BU489"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13185"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13185"
FT                   /db_xref="GOA:P63237"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63237"
FT                   /protein_id="BAB13185.1"
FT                   /translation="MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQSNGFKTLA
FT                   EGQSVEFEITEGAKGPSAANVISL"
FT   rRNA            complement(539312..539426)
FT                   /gene="rrf"
FT                   /product="5S rRNA"
FT                   /note="BU490"
FT   rRNA            complement(539539..542451)
FT                   /gene="rrl"
FT                   /product="23S rRNA"
FT                   /note="BU491"
FT   tRNA            complement(542613..542685)
FT                   /product="tRNA-Glu (TTC)"
FT   CDS_pept        complement(542838..543659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="BU493"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13186"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13186"
FT                   /db_xref="GOA:Q44607"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44607"
FT                   /protein_id="BAB13186.1"
FT                   /translation="MFKCKNFNYAVFGNPINHSKSPEIHSLFSKQTGISHFYKSCNVPL
FT                   NSLYAVLQDFFKKDGRGANITAPFKQEAYFFCNKLTKRAEVAQSVNTLKKIDNCNILGD
FT                   NTDGIGLLSDLIRLNFIKKNYSILIIGAGGAARGVLFPLLSYGCSICIFNRTVLNAEKL
FT                   VLQFHKYGNINVFNTNSLHVKSFDLIINATSHFIQDKDNFIPFSCVSSKTCFYDMNYQT
FT                   DNTFFFDWSRKTGSNFFSNGIGMLVFQAAHSFFLWHNVLPEIDYIIDLLNK"
FT   CDS_pept        complement(543652..544179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrdC"
FT                   /product="hypothetical protein"
FT                   /note="BU494"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13187"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13187"
FT                   /db_xref="GOA:P57561"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57561"
FT                   /protein_id="BAB13187.1"
FT                   /translation="MLHNDDVIAYPTESMFGLGCDPNSKKAVKKLLNLKNRSIEKGLIL
FT                   VASDFDQIKMYVNENILSNKQKKKIFFHWPGPFTFLLPAKPNTPYWLTGKFNTVAVRVS
FT                   AHFEIIKLCNAFGQAVVSTSANISNMTPCFTSEEVFKCFGKDFPLLNGKIGNEKNPSKI
FT                   INIINGKLIRYV"
FT   CDS_pept        complement(544277..544750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smg"
FT                   /product="smg protein"
FT                   /note="BU495"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13188"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13188"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57562"
FT                   /protein_id="BAB13188.1"
FT                   /translation="MFDILIYLFENYIHNESRISIDYDSLTNDLSDIGFQRRDIYNALS
FT                   WLKNLSCYKKNIIPSINPLSNKITIRIYTQEESLKLNVDCRGFILFLEQLEILTLDTRE
FT                   VIIERIMELDINELNLEDLKWIVLIVLFNVPGCESAYHKLENLLFNFKEDIIH"
FT   CDS_pept        544994..545515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /product="polypeptide deformylase"
FT                   /EC_number="3.5.1.31"
FT                   /note="BU496"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13189"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13189"
FT                   /db_xref="GOA:P57563"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57563"
FT                   /protein_id="BAB13189.1"
FT                   /translation="MSLLKILYYPDIRLRILAKPVKEINKKIQKIANDMIDTMYQEEGI
FT                   GLAATQVNIPLQIIVVNTMEQKKNNLVLINPKIIKKEGDISIEEGCLSIPEYQASIPRS
FT                   NYIQVQAVNLDGEKIEIEAKSILSICIQHEIDHLKGKLFIDYLSKFKRERIQKKFEKIN
FT                   KKNKKFSIKE"
FT   CDS_pept        545523..546467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="BU497"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13190"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13190"
FT                   /db_xref="GOA:P57564"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57564"
FT                   /protein_id="BAB13190.1"
FT                   /translation="MKKLKIVFAGTEYFSAEHLHALITSSHDVISVITQPDRYSGRGQK
FT                   ITFSPVKILSLNNGIPIFQPENLNDTDFQNKLLKLNADIMTVVSYGKIIPKKILNMFSK
FT                   GCINVHASLLPRWRGATPIQSSILHGDKKTGISIIQMNDEIDSGNIMHSITCSISSKDT
FT                   TKTLSLKLIKIGIEALLEVLEKIILNTVIYKKQNEKNVILSKKIYKKDALLDWNLSAEK
FT                   LERLIRAFNPWPICYFLSQNKNIKVWQSEVIPITQNNRSVGEIISYNKNGIQINTSHQI
FT                   LNIKKLQFPGKKIIDVKNVIISKKKLFKIGTIL"
FT   CDS_pept        complement(546594..546986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /product="50S ribosomal protein L17"
FT                   /note="BU498"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13191"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13191"
FT                   /db_xref="GOA:P57565"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57565"
FT                   /protein_id="BAB13191.1"
FT                   /translation="MRHRKSGRQLNRSSTHLNSMLKNMACSLFTHEVIKTTLSKAKELR
FT                   RIVEPIITLSKIDTVSRRRLVFSRIRDNAIVAKLFKKLGPCFFSRLGGYTRILKCGFRS
FT                   GDKAPMAYIELVDRVKNNKKNEILKK"
FT   CDS_pept        complement(547031..548020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="BU499"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13192"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13192"
FT                   /db_xref="GOA:P57566"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57566"
FT                   /protein_id="BAB13192.1"
FT                   /translation="MQNSIMDFLRPRLVDIEQISATHTKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSTKEGVQEDVLEILLNLKALAVKVYGKDETLLTLHK
FT                   SGIGSITAADIIHDGDVEIIKPQHVICHLTDENASIKMRIKVQRGRGYIPASSRVHLEE
FT                   DSRPIGCLLVDACYSPINRISYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAAT
FT                   ILAEQLEAFVDLRDIREPEFKEEKPEFEPILLRPVDDLELTVRSANCLKAEAIHYIGDL
FT                   VQRTEVELLKTPNLGKKSLTEIKDVLASRSLSLGMRLENWPPSSILDE"
FT   CDS_pept        complement(548049..548669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /product="30S ribosomal protein S4"
FT                   /note="BU500"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13193"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13193"
FT                   /db_xref="GOA:P57567"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57567"
FT                   /protein_id="BAB13193.1"
FT                   /translation="MAKYLGPKLKLSRREGTDLFLKSGLRSIESKCKLEQPPGQHGIRK
FT                   PRLSDYAIQLREKQKVRRLYGVLERQFKIYYKLAASLKGNTGANLLQLLESRLDNVVYR
FT                   MGFGCTRSESRQLINHKSIMVNNKVVNIASYQVSPNDQISIRNKSKNQSRIKAALELVE
FT                   QREKPIWLEVNSTKMEGIFKRFPERSDLSAEINEYLIVELYSK"
FT   CDS_pept        complement(548695..549090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /product="30S ribosomal protein S11"
FT                   /note="BU501"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13194"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13194"
FT                   /db_xref="GOA:P57568"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57568"
FT                   /protein_id="BAB13194.1"
FT                   /translation="MVKNSTSIRTRKRVKKQILDGIAHIHASFNNTIVTITDRQGNALG
FT                   WATSGGSGFRGSRKSTPFAAQVAAERCAEIVKDYGIKNLEVMVKGPGPGRESTIRALNA
FT                   AGFRITNITDVTPIPHNGCRPPKKRRV"
FT   CDS_pept        complement(549108..549464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /product="30S ribosomal protein S13"
FT                   /note="BU502"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13195"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13195"
FT                   /db_xref="GOA:P57569"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57569"
FT                   /protein_id="BAB13195.1"
FT                   /translation="MARIAGINIPENKHTLIALTAIYGIGKKRSKFICSIANIPEHSKI
FT                   VDLNEEQIDLLRTHVAKYVIEGDLRRERTLNIKRLIDLSCYRGLRHRRSLPVHGQRTKT
FT                   NARTCKGPRKPIKK"
FT   CDS_pept        complement(549558..549674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /product="50S ribosomal protein L36"
FT                   /note="BU503"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13196"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13196"
FT                   /db_xref="GOA:P57570"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57570"
FT                   /protein_id="BAB13196.1"
FT                   /translation="MKVQASVKVLCRSCKIIKRNNVVRVICSNDPKHKQRQG"
FT   CDS_pept        complement(549700..551013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /product="preprotein translocase secY subunit"
FT                   /note="BU504"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13197"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13197"
FT                   /db_xref="GOA:P57571"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57571"
FT                   /protein_id="BAB13197.1"
FT                   /translation="MVKKLGLNFKNTKTSVSELKQRIVFLIVAIIVFRIGSFIPIPGID
FT                   TTILSKILNNQNGTIVDMFNMFSGGALSRASIFALGIMPYISASIIIQLLTLVYPTLSE
FT                   IKKEGESGRHRINQYTRYATLILALVQSIGIAMTLPNIAGIRSIIINTDFYFYLIAIIS
FT                   LVTSTMFLMWLGELITEYGIGNGISIIIFIGIIAGLPSAIGNTIEKTRQGDLHILLFLF
FT                   ILLLIFSVIFLVVFMERGQRKIVVHYAQRQQGRRIYETPSTHLPLKINMAGVIPAIFAS
FT                   SIVLFPATIISWCKVNHEWLTKILFYLQPNQFLYLILYISAIVFFCFFYTGLVFNPRET
FT                   ADNLKKSGAFISGIRPGEQTAKYINKIMLRLTLVGSLYITFICLIPEFMRSAMNVPFYF
FT                   GGTSLLIVVVVIIDFITQIQTLIMSNQYESMLKKANLN"
FT   CDS_pept        complement(551024..551458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /product="50S ribosomal protein L15"
FT                   /note="BU505"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13198"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13198"
FT                   /db_xref="GOA:P57572"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57572"
FT                   /protein_id="BAB13198.1"
FT                   /translation="MRLNTLSPANGARHSRKRLGRGIGSGFGKTSGRGHKGQKSRSGSS
FT                   IRRGFEGGQMPLYRRLPKFGFNSRKKNITTEVRLSDLSNLSTNIIDLNVLKQENIIKKN
FT                   IKYAKIILSGKLTVPLIIRGLLVSKGARSEIENTGGKVEG"
FT   CDS_pept        complement(551463..551642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /product="50S ribosomal protein L30"
FT                   /note="BU506"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13199"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13199"
FT                   /db_xref="GOA:P57573"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57573"
FT                   /protein_id="BAB13199.1"
FT                   /translation="MKNIKITQIKSAIGRLPKHKKTLIGLGLRYIGHTVIREDTPSIQG
FT                   MVKKISYILKIQEE"
FT   CDS_pept        complement(551652..552155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /product="30S ribosomal protein S5"
FT                   /note="BU507"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13200"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13200"
FT                   /db_xref="GOA:P57574"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57574"
FT                   /protein_id="BAB13200.1"
FT                   /translation="MANIEKKNHNDLQEKLITVNRVSKTVKGGRIFSFTALTVVGNGDG
FT                   KVGFGYGKAREVPAAIQKAMEQARRNMITIPLVNKTLQHSLKGSHTGSNVFMKPASDGT
FT                   GIIAGGAMRAVLEVAGIHNVLAKTYGSTNPINVVRATMNGLVNMKSPEMIAAKRNKRIK
FT                   DILG"
FT   CDS_pept        complement(552171..552539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /product="50S ribosomal protein L18"
FT                   /note="BU508"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13201"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13201"
FT                   /db_xref="GOA:P57575"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="PDB:1OQ8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57575"
FT                   /protein_id="BAB13201.1"
FT                   /translation="MIFSNKNKIISRIRRSMKTRCKIKKLGAIRLVVHRTSRHMYAQII
FT                   SSKEAKVLVFASTLERKINCSLKYTGNKEAAAKIGKIIAERALSKGISHVSFDRSGFKY
FT                   HGRVQVLAESAREVGLKF"
FT   CDS_pept        complement(552541..553113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /product="50S ribosomal protein L6"
FT                   /note="BU509"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13202"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13202"
FT                   /db_xref="GOA:P57576"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57576"
FT                   /protein_id="BAB13202.1"
FT                   /translation="MKLFVMWLNGGSMSRVAKCPIVIPSGVNVQLDLQDISIKGKYGHL
FT                   SRTIHQSVKIEFLNNQIIFSPRLGFSNGWAQAGTSRALVNSMIIGVSEKFSKKLQLSGV
FT                   GYRVSITKDNIINMSLGYSHIITYHLPKGINAENLSPTEIIIQGIDKQLVGQIAANLRS
FT                   YRTPEPYKGKGIRYSNEVVRIKEAKKK"
FT   CDS_pept        complement(553088..553480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /product="30S ribosomal protein S8"
FT                   /note="BU510"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13203"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13203"
FT                   /db_xref="GOA:P57577"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57577"
FT                   /protein_id="BAB13203.1"
FT                   /translation="MSMQDPVADMLTRIRNGQLANKYSVKMPSSKLKKSIIQLLKEEGY
FT                   IKDYNVTGDTKLELEVFLKYFQGKSVVDMIQRISRPSLRIYKNKNNLPKVMSGLGIAVI
FT                   STSKGVMTDRMARQEGLGGEVICYVA"
FT   CDS_pept        complement(553509..553814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /product="30S ribosomal protein S14"
FT                   /note="BU511"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13204"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13204"
FT                   /db_xref="GOA:P57578"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57578"
FT                   /protein_id="BAB13204.1"
FT                   /translation="MAKQSMKAREVKRVKLANKFYTQRHELKNIISNMSISEEERWNAV
FT                   LKLQSFPRDSSPSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMKGEIPGLKKASW"
FT   CDS_pept        complement(553832..554371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /product="50S ribosomal protein L5"
FT                   /note="BU512"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13205"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13205"
FT                   /db_xref="GOA:P57579"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57579"
FT                   /protein_id="BAB13205.1"
FT                   /translation="MATLYDYYKSKVITQLMHELNYSSVMQVPKIDKITLNMGVGGAAS
FT                   DKKILDNAILDLTAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGQKKWHFFERLI
FT                   IIAVPRIRDFRGLSSHSFDGQGNYSLGIREQIIFPEIDYDKIDRVRGLDITITTTAKSN
FT                   HEARLLLSAFNFPFRK"
FT   CDS_pept        complement(554386..554700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /product="50S ribosomal protein L24"
FT                   /note="BU513"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13206"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13206"
FT                   /db_xref="GOA:P57580"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57580"
FT                   /protein_id="BAB13206.1"
FT                   /translation="MALKLRRNDSVVILTGKDKGKTGIIKNILSLNQVIVKGLNLIKKH
FT                   QKPVPSQNKSGGIIEKEAPIHISNIAILNPESNKADRIGFRFEEGRKVRFFKSTGKTIQ
FT                   "
FT   CDS_pept        complement(554726..555094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /product="50S ribosomal protein L14"
FT                   /note="BU514"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13207"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13207"
FT                   /db_xref="GOA:P57581"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57581"
FT                   /protein_id="BAB13207.1"
FT                   /translation="MIQEQTILHVADNSGARSAMCIKVLGGSRRRYAAIGDVIKITIKE
FT                   AIPRGKVKKGEVLKAVVVRTKKGVRRSDGSVIRFDTNACVVLNNNEQPIGTRIFGPVTR
FT                   ELRTEKFMKIISLAPEVL"
FT   CDS_pept        complement(555209..555460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /product="30S ribosomal protein S17"
FT                   /note="BU515"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13208"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13208"
FT                   /db_xref="GOA:P57582"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57582"
FT                   /protein_id="BAB13208.1"
FT                   /translation="MEKIRTLQGRVISNKMQKSAVVAIERFVKHIIYGKFIKRTTKLHI
FT                   HDEKNECTVGDLIEIRESRPISKTKSWVLVRIIEKTVF"
FT   CDS_pept        complement(555460..555657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /product="50S ribosomal protein L29"
FT                   /note="BU516"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13209"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13209"
FT                   /db_xref="GOA:P57583"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57583"
FT                   /protein_id="BAB13209.1"
FT                   /translation="MKALVEFRKKNKKDLYTELLQLLREQFNLRMQSVSGKLKQPHLLR
FT                   KVRRNIAQVKTLLDSKEEIK"
FT   CDS_pept        complement(555657..556067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /product="50S ribosomal protein L16"
FT                   /note="BU517"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13210"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13210"
FT                   /db_xref="GOA:P57584"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57584"
FT                   /protein_id="BAB13210.1"
FT                   /translation="MLQPKRTKFRKMHKGRNRGLASGTDINFGTFGLQAIDRGRLTARQ
FT                   IESARRAITRCIKRQGKMWIRIFPDKPITQKPLEVRMGKGKGNVEYWVALVQPGKILYE
FT                   LEGVTEEESRAAFKLAAAKLPIKTTFVNKMVM"
FT   CDS_pept        complement(556088..556789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /product="30S ribosomal protein S3"
FT                   /note="BU518"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13211"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13211"
FT                   /db_xref="GOA:P57585"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57585"
FT                   /protein_id="BAB13211.1"
FT                   /translation="MGQKVHPNGMRLGIIKKWNSVWFANTKDFADHLDSDYKVRQFLMK
FT                   TLEKASISRIIIERPAKSIRVTIYTARPGIVIGKKGEDVEKLRISIAKITGVPVQINIS
FT                   EVRKPELDAKLVSDSITSQLERRVMFRRAMKRSVQNAMRQGAKGIKVEVSGRLGGAEIA
FT                   RREWYREGRVPLHTLRANIDYSISEAHTTYGVIGVKVWIFKGEILGGMETVERLDKPSV
FT                   QTKKQYRKNRK"
FT   CDS_pept        complement(556808..557140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /product="50S ribosomal protein L22"
FT                   /note="BU519"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13212"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13212"
FT                   /db_xref="GOA:P57586"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57586"
FT                   /protein_id="BAB13212.1"
FT                   /translation="METLAQHRQARSSAQKVRLIVDLIRGKKVPQALNILTYTNKKAAF
FT                   LVKKVVESAVANAEHNDGADIDKLRIKKIFVNEGSTMKRMMPRAKGRADRILKRTSHIT
FT                   VIVSDR"
FT   CDS_pept        complement(557176..557454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /product="30S ribosomal protein S19"
FT                   /note="BU520"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13213"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13213"
FT                   /db_xref="GOA:P57587"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57587"
FT                   /protein_id="BAB13213.1"
FT                   /translation="MPRSLKKGPFIDISLLKKVEKSVKINDKKPIKTWSRRSTIFPNMV
FT                   GLTISIHNGRSHIPVFVTEEMVGHKLGEFSLTRTYRGHTADKKVKKR"
FT   CDS_pept        complement(557474..558295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /product="50S ribosomal protein L2"
FT                   /note="BU521"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13214"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13214"
FT                   /db_xref="GOA:P57588"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57588"
FT                   /protein_id="BAB13214.1"
FT                   /translation="MAVVKCKPTSPGRRHVIKVVNNELYKGKPYSLLLRKKSKSGGRNN
FT                   NGRITTRHIGGGHKRAYRIVDFKRNKDDIGATVERFEYDPNRSSNIALILYKDGERKYI
FT                   LAPKGIKIGDTIISGLRAPIKTGNTLPLKNIPVGTFVHNVELKPGKGGQIARSAGSYVQ
FT                   LVAFDEEYATLRLRSGEMRKTQSNCRATIGEVGNSEHMLKVLGKAGASRWIGIRPTVRG
FT                   TAMNPVDHPHGGGEGRNFGKHPVTPWGIQTKGKKTRKNKRTDKFILRHRRK"
FT   CDS_pept        complement(558310..558612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /product="50S ribosomal protein L23"
FT                   /note="BU522"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13215"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13215"
FT                   /db_xref="GOA:P57589"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57589"
FT                   /protein_id="BAB13215.1"
FT                   /translation="MISEERLLKILLSPHVSEKTSISMEKFNTVVLKVLNNATKYEIKY
FT                   AVKKIFDVDVDSIKTLKVKGKKKRQSNRIIQRSHWKKAYIKVKKGCNLDFIGNTE"
FT   CDS_pept        complement(558609..559214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /product="50S ribosomal protein L4"
FT                   /note="BU523"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13216"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13216"
FT                   /db_xref="GOA:P57590"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57590"
FT                   /protein_id="BAB13216.1"
FT                   /translation="MELVVKDVQNVLSVSEIIFARDFNEALIHQVVIAYSASTRQGTRA
FT                   QKSRAEVSGSGRKPWRQKGTGRARAGSFRSPIWRSGGVTFAAKPQEHSQKVNKKMYRGA
FT                   LKSIFSELIRQKRLIVFENFSLDAPKTKLLVQKLKDINLKNVLIVTNKIDNNLFLASRN
FT                   LYSVDVKDVHSIDPVSLIAFDHVVITVEAVKRIEEILS"
FT   CDS_pept        complement(559232..559861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /product="50S ribosomal protein L3"
FT                   /note="BU524"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13217"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13217"
FT                   /db_xref="GOA:P57591"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57591"
FT                   /protein_id="BAB13217.1"
FT                   /translation="MIGLVGKKIGMTRIFTEEGTSIPVTVIELKENRITQVKNINTDLY
FT                   CAIQVTTGIKKSNRLNKPQSGHFLKSGVTPGRGLWEFRTDKNNNFKIGQSITINIFNNV
FT                   KKVDITGISKGKGFSGTVKRWNFHTQDATHGNSLSHRVPGSIGQNQTPGRVFKGKKMAG
FT                   QLGNTRVTVQSLNIVRIDEHRNLLLVKGAVPGATGSDLIVKPAIKV"
FT   CDS_pept        complement(559892..560203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /product="30S ribosomal protein S10"
FT                   /note="BU525"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13218"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13218"
FT                   /db_xref="GOA:P57592"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57592"
FT                   /protein_id="BAB13218.1"
FT                   /translation="MQNQRIRIRLKAFDHRLIDQSTTEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTILVSPHVNKDARDQYEIRTHKRLIDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   CDS_pept        complement(560535..561806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufB"
FT                   /product="elongation factor EF-Tu"
FT                   /note="BU526"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13219"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13219"
FT                   /db_xref="GOA:O31297"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31297"
FT                   /protein_id="BAB13219.1"
FT                   /translation="MKEEKSRSLILYCIQYSYLKTDILYKEKKMSKEKFQRLKPHINVG
FT                   TIGHVDHGKTTLTAAITTVLSKKFGGSARAFDQIDNAPEEKARGITINTSHVEYDTEFR
FT                   HYAHVDCPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVF
FT                   LNKCDMVDDEELLELVEMEVRDLLTQYDFPGDDTPIIRGSALKALEGDPEWESKIIDLS
FT                   KFLDSYIPEPKRAVDQPFLLPIEDVFSISGRGTVVTGRVEKGIIKVGEEVEIVGIKKTT
FT                   KTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEIERGQVLAKPGSIHPHTTFESEVYV
FT                   LSKEEGGRHTPFFKGYRPQFYFRTTDVTGSIELPEGIEMVMPGDNIKMTVTLINPIAMA
FT                   DGLRFAIREGGRTVGAGVVSKVLL"
FT   CDS_pept        complement(561787..563895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /product="elongation factor G"
FT                   /note="BU527"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13220"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13220"
FT                   /db_xref="GOA:P57593"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57593"
FT                   /protein_id="BAB13220.1"
FT                   /translation="MSRTTPISRYRNIGISAHIDAGKTTTTERILFYTGINHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWSGMAKQFKPHRINIIDTPGHVDFTIEVERSMR
FT                   VLDGAVMVYCAVGGVQPQSETVWRQANKYNVPRIAFVNKMDRMGANFLKVVKQIKIRLG
FT                   ANPVPLQLAIGAEDTFVGVVDLIKMKAVHWKDSDQGVTFVYNDIPPEMIELSKKWNQNL
FT                   IESAVESNEDLLEKYLNGDRLSESEIKSALRKRALNNEIVLITCGSAFKNKGVQALLDA
FT                   IIEFLPAPNDIQDIKGILNDVEQTPAIRNSDDKAPFSALAFKIASDPFVGNLTFFRVYS
FT                   GVVKSGDTVFNSAKSQRERFGRIVQMHANKREEIKEVYAGDIAAAIGLKDVTTGDTLCD
FT                   LNDPIILERMEFPEPVISISVEPKTKVDQEKMGLALGRLAKEDPSFRVRTDQESNQTII
FT                   SGMGELHLEIIIDRMKREFSVDANVGKPQVAYRETILNKVEDIEGKHIKQSGGRGQYGH
FT                   VVIELFPLQPGGEGYLFVNDIKGGVIPSEYISAIDKGIQEQLKCGPLAGYPVVDIGVRL
FT                   YFGSYHDVDSSELAFKLAASAAFKKGFKQAKPILLEPIMKVEVETPDDYMGDVIGDLNR
FT                   RRGIIEGMKDLSISKIINACVPLSEMFGYATDLRSQTQGRASYSMEFLKYIEAPFNISK
FT                   DIIERREK"
FT   CDS_pept        complement(564010..564480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /product="30S ribosomal protein S7"
FT                   /note="BU528"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13221"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13221"
FT                   /db_xref="GOA:P57594"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57594"
FT                   /protein_id="BAB13221.1"
FT                   /translation="MPRRRIIGTRKILPDPKFSSELLAKFINILMIDGKKSIAEVIVYT
FT                   ALKNLSKRTDKKELEAFEIALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWI
FT                   VESARKRVDKSMSLRLSNELYDALENKGTAVKKREEVHRMAEANKAFAHYRW"
FT   CDS_pept        complement(564522..564896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /product="30S ribosomal protein S12"
FT                   /note="BU529"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13222"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13222"
FT                   /db_xref="GOA:P57595"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57595"
FT                   /protein_id="BAB13222.1"
FT                   /translation="MATVNQLVRKPRVRKVIKSNVPALGKSPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGFEVTAYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHIVRGSLDC
FT                   AGVKERKQGRSKYGVKKPKK"
FT   CDS_pept        complement(565030..565302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yheL"
FT                   /product="hypothetical protein"
FT                   /note="BU530"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13223"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13223"
FT                   /db_xref="GOA:P57596"
FT                   /db_xref="InterPro:IPR007215"
FT                   /db_xref="InterPro:IPR023526"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57596"
FT                   /protein_id="BAB13223.1"
FT                   /translation="MKSPFETNVSLVISMLKKSDDFLALQDGVLIALKDNIFLKSIIMS
FT                   PVKLYLIKEDVYARGIRKNISREFILINYIHFVSLTLKHKKQMTW"
FT   CDS_pept        complement(565329..565688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yheM"
FT                   /product="hypothetical protein"
FT                   /note="BU531"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13224"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13224"
FT                   /db_xref="GOA:P57597"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017462"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR037450"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57597"
FT                   /protein_id="BAB13224.1"
FT                   /translation="MKMVAFVFSHAPHGISLGREGLDAIFSISSIFKKISVFFIGDGVL
FT                   QLIKNQQPEHILARNYTSSFSILSLYNIKDLYCCKASLLERGLNNNNNFILNIDVLDSY
FT                   NLRLKLDNYDAIINF"
FT   CDS_pept        complement(565707..566093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yheN"
FT                   /product="hypothetical protein"
FT                   /note="BU532"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13225"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13225"
FT                   /db_xref="GOA:P57598"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017463"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57598"
FT                   /protein_id="BAB13225.1"
FT                   /translation="MNYTILVTGPPYGTQNSSTAFLFCQSLLKTKHILHSVFFYCDGVL
FT                   NANNMTTPAIDEFNLINAWQGLNKKHQVKLYVCNSAALRRGVIEDEKLFNMNVKKGNLA
FT                   LSFQLSGLIELAKSIKICDRIIQF"
FT   CDS_pept        complement(566176..566901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpA"
FT                   /product="fkbp-type peptidyl-prolyl cis-trans isomerase
FT                   fkpA precursor"
FT                   /EC_number="5.2.1.8"
FT                   /note="BU533"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13226"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13226"
FT                   /db_xref="GOA:P57599"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57599"
FT                   /protein_id="BAB13226.1"
FT                   /translation="MILYVPKSFSISAPISDIHLQSVLETKNTFHNNNEKLGYILGLSF
FT                   GNYVNQTFEKQKKIGIELDRNSLLKGIQDAISGNLKLSHQDISSGLKELEKKLKHATKI
FT                   QLKKNAKENFIQGELYMKNFSKLKGVKKTSSGLLYLLERAGEGEALKDETKITVHYKGT
FT                   LINGLEFDNSYKRGRPVSLRLKDVILGWKEGLKYIKKGGKIKLVIPPNLAYGTEEVNGI
FT                   PANSTLIFDIELLDVVNGV"
FT   CDS_pept        complement(567364..568590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /product="acetylornithine aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="BU534"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13227"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13227"
FT                   /db_xref="GOA:P57600"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57600"
FT                   /protein_id="BAB13227.1"
FT                   /translation="MISKKTLITRDNFDKLILPIYNPIPFIPIKGKGSRIWDQKGKEYI
FT                   DFSGGIAVTSLGHCHPILNKTLKNQSKMLWHLSNIFTNEPALRLAKKLLSSSFASRIFF
FT                   ANSGAEANEAAFKLARYYSSKIYNFKKNKIISFYNSFHGRTFFTVSVGGQSKYSNNFGP
FT                   KPAGIVHASFNDINSVKNLIDHDTCAVVVELIQGEGGVIPANLTFVQALKELCKQYNVL
FT                   LIFDEIQTGIGRTGKLFYYEYYAITPDILTIAKSLGGGFPISAMLTTNEVASVIAPGIH
FT                   GTTYGGNPLACAVAESVIDIINTKKVLSGVEKKSKKIISELNIINKRFKLFTEIRGRGL
FT                   LIGIVLKPNVSRNIHKILNFSLSEGVIFLTAGNNVIRLAPSLIIKELDIIEGMKRFYRA
FT                   LEKYLSRKE"
FT   CDS_pept        568906..570072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhfC"
FT                   /product="hypothetical protein"
FT                   /note="BU535"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13228"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13228"
FT                   /db_xref="GOA:P57601"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023528"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57601"
FT                   /protein_id="BAB13228.1"
FT                   /translation="MTNINRIGLTWISFLSYAFTGALVVVTGMIMGNISNYFHLSISQM
FT                   SNIFTFLNAGILVSIFINSWLIEIISLKKQLIFSFILTIIAVIGIVLCNSIFLFSINMF
FT                   ILGLVSGITMSIGTFIITHLYSGSKRGSLLLLTDSFFSMSGMIFPIVTAYLLEKKIIWY
FT                   WSYICIGAIYLLIFLLTINSSFEKFKTNTKNSKETKEKWNFNVFLLSISALLYILGQLG
FT                   FISWVPQYATEIMNIDIKKTGSLVSGFWMSYMLGMWFFSFIIKFFNLYRMFIFLTSMST
FT                   ILMYCFIKSENFLNQQYIIISLGFFSSAIYTIIITLASLQTKHPSPKLINLILLFGTIG
FT                   TFLTFIITSPIVEAKGLYVTLISSNILYGIVFFLSILIYFNKKYERVI"
FT   CDS_pept        complement(570134..571141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="BU536"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13229"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13229"
FT                   /db_xref="GOA:P57602"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57602"
FT                   /protein_id="BAB13229.1"
FT                   /translation="MILSKPILLSAVQPSGNLTIGNYIGTMRHWSKMQNNYECLYCIAD
FT                   LHALTIQKNKIHLNKSILDTISFYLSCGVDPQKSIIFIQSHVYQHSQLNWILNCFSQFS
FT                   ELLRMTQFKIKSNCSKKINAALFNYPILMAADILLYQTNFVPVGQDQKQHVELTRNIAH
FT                   RFNSLYGHVFTLPKPLITQHGSKIMSLLEPSKKMSKSDINKKNVIFLLDDIKTVISKIQ
FT                   NAYTDSETPSKIYYDIEKKPGISNLLEILSAITNKDIDILLKELEGMLYSEFKNIVADH
FT                   LSKFLYKLQKSYNDYRNDEVYLKKIAYEGAMKSQLKSNKTLTKVYDKLGLIPLF"
FT   CDS_pept        complement(571164..571850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="BU537"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13230"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13230"
FT                   /db_xref="GOA:P57603"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57603"
FT                   /protein_id="BAB13230.1"
FT                   /translation="MNKFFLAPSILSADFARLGEDIKKVIDAGSDLIHFDVMDNHYVPN
FT                   LSMGPMILESLRNYNITAPIDVHLMVKPVDNLIPQFAKAGATFITFHPEATLHIERTLN
FT                   LIKENGCKAGLAFNPATPLNFLDYILEKLDLILLMSVNPGFGNQSFLPSTFNKLREVRK
FT                   IIDANFSDILLEVDGGVKLDNIADIACAGANVFVMGSGLFKYSNYKLVIEKIRKKLEYA
FT                   HSRSIH"
FT   CDS_pept        complement(572734..573825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="BU538"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13231"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13231"
FT                   /db_xref="GOA:P57604"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57604"
FT                   /protein_id="BAB13231.1"
FT                   /translation="MKIVERLQVVLGERSYPISIGAGIIQEDDIFWPLKPGDQAMLVTN
FT                   KTLANLLKDKVFYHLRKSGIKIDQVILSDGEQYKTLNEMELIISALLEKKHARDTTLIA
FT                   LGGGVIGDLAGFAASVYQRGVRFIQIPTTLLSQVDASVGGKTAVNHLLGKNMIGSFWQP
FT                   SSVIIDIDCLKTLPYNELVSGMAEVIKYAIVFDKTFFCWLEENIESILSLNHTAMSYCI
FT                   KKCCELKSQLIALDERENNLRALLNLGHTYGHAIEVHAGYGNWLHGEAISVGMVMAART
FT                   SELLGHLKTIDFKRILVLLKRTGLPIKGPKNMSAASYLPYMMRDKKVISGEMRLVLPLS
FT                   IGKAEIYSNIDKNIILTAIKHSQ"
FT   CDS_pept        complement(573843..574364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /product="shikimate kinase I"
FT                   /EC_number="2.7.1.71"
FT                   /note="BU539"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13232"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13232"
FT                   /db_xref="GOA:P57605"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57605"
FT                   /protein_id="BAB13232.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRQLSQQLNMEFFDSDQEIEKRTGA
FT                   DISWVFDVEGESGFRLREQRVIDELTTKQGIVLATGGGSVKFRETRNFLSSRGIVVYLE
FT                   TTIEKQLARTKRDKKRPLLQNADSNRMILENLAYERNPFYEEIADIKVKTDDQSAKSVA
FT                   FNIIRLLEEI"
FT   tRNA            574863..574947
FT                   /product="tRNA-Ser (GGA)"
FT   CDS_pept        complement(574967..575671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /product="purine nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="BU541"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13233"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13233"
FT                   /db_xref="GOA:P57606"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57606"
FT                   /protein_id="BAB13233.1"
FT                   /translation="MSTPHINSKKDDFSDIVLMPGDPVRAKYIAEKYLSNFVQVNDTRL
FT                   MLAYTGFYKNRKISIMSHGIGIPSASLYTRELIIEFNVKKIIRIGTCGAVRDDIKLRDI
FT                   VISMGASTDSKVNRIRFNDHDFAAIADFDMIYNIVSISKKMKIKVSIGNFFTTDSFYND
FT                   DKKMLNILKKYNIIGVDMETAGIYGVASELKVQALSICTVSDHITNKEFLSSKERESSF
FT                   NDMIELALESVL"
FT   CDS_pept        complement(575715..576938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="BU542"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13234"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13234"
FT                   /db_xref="GOA:P57607"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57607"
FT                   /protein_id="BAB13234.1"
FT                   /translation="MKRVFLIVLDSFGIGSSPDADKFNDVGSNTFGHIVEKCFLGEANV
FT                   GRKGVLCIPNLVKLGIINAAKESTGQYPLGFNYSSNVIASYGFASEISSGKDTTSGHWE
FT                   IAGVPVLDDWYYFKEKQNSFPESLLEKIIIRSELTGFIGNCHASGTDIISRLGEEHIQT
FT                   KKPIVYTSSDSVFQIACHEEFFGLSNLYKLCKTVRFILDRYNYKVARVIARPFIGNDKL
FT                   QFQRTGNRRDFSIKPFATTVIKKLIDEKQGQVIAIGKVSDIYGGIGISKNIKSTGLYEL
FT                   CSTTIHEMKKALNNTIVFTNLVDFDSNWGHRRDVSGYAKGLELFDSRLSEIISLVQKND
FT                   LLILTADHGCDPTWIGTDHTRENVPVLIYSPGIKKNFLGHRKTFADIGQTIAKYFLLTD
FT                   MSYGQNML"
FT   CDS_pept        complement(576996..578576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /product="peptide chain release factor 3"
FT                   /note="BU543"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13235"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13235"
FT                   /db_xref="GOA:P57608"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57608"
FT                   /protein_id="BAB13235.1"
FT                   /translation="MFDSNHEQELSKRRTFAIISHPDAGKTTITEKMLFFGKVIRVPGT
FT                   IKGRGSGKYAKSDWMNIEKERGISITTSVMQFTYKNILMNLLDTPGHQDFSEDTYRILT
FT                   AVDCCLVVIDAAKGIEERTRKLMDVARIHNTPIITFINKLDRDSRDPIEILDEIEKELK
FT                   LHCIPISWPISCGKNFRGVYHIYDKIIHLYKSKFRKNFLTLDSFLDGSLNEYLGADLSI
FT                   HIRQELELIMNVYSKFNKEKFLKGITTPIFFGSALGNFGIDHLLDSLIKWAPSPLYRQS
FT                   NKRIIKPQERKFTGFIFKIQANMDLKHRDRIAFMRIVSGQYTKGMKLTHVRIKKNIIIS
FT                   DAFSFLAGERISINKAYPGDVIGLHNHGTIKIGDTFTQGEEIKFIGIPSFAPEIFRLIY
FT                   LKNPLKQKQLKKGLVQLSEEGTVQVFRPILNNDLILGAIGILQFDVVIERLRIEYNIDA
FT                   VYKKVNIVLARWINYGNHHSLYNLKKSYSSYLAYDISNSLIYLAPSSANLNIVMSQNSD
FT                   ISFNATREQ"
FT   CDS_pept        complement(579687..580265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhgI"
FT                   /product="hypothetical protein"
FT                   /note="BU544"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13236"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13236"
FT                   /db_xref="GOA:P57609"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57609"
FT                   /protein_id="BAB13236.1"
FT                   /translation="MINISKKAQEHFTSLLSNEPENTQIRVFIVNPGTPNAECGVAFCP
FT                   ENEIELSDIQLKYDGFFVYVNKDTISYLKNSVIDLVTDKIGSQLTLKAPYAKNNFSKKV
FT                   SSSLEEKVKCFLNLEINPQLSMHGGRVELIKIDKNGIAAIQFSGGCNGCSMIGSTLKET
FT                   VEKKLLSSFSEIKKVYDETHHLHGQHSFY"
FT   CDS_pept        complement(580878..581393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /product="single-strand binding protein"
FT                   /note="BU545"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13237"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13237"
FT                   /db_xref="GOA:P57610"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57610"
FT                   /protein_id="BAB13237.1"
FT                   /translation="MASRGVNKVILIGHLGQDPEVRYMPNGNAVVNMTLATSENWKDKN
FT                   TGENKEKTEWHRIVLFGKLAEIAGEYLRKGSQVYIEGSLQTRKWQDQNGLERYTTEIIV
FT                   NIGGTMQMLGNRNSNLQAMTVNDKNSTGIKIKKTDAVEFDKKIETHESNKDLTHSPSEI
FT                   DFDDEIPF"
FT   CDS_pept        582081..583460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /product="replicative DNA helicase"
FT                   /note="BU546"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13238"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13238"
FT                   /db_xref="GOA:P57611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57611"
FT                   /protein_id="BAB13238.1"
FT                   /translation="MAKDKLYLNQINRLKIPPHSLEAEQSVLGGLMLDNEQWDSVSEHV
FT                   VADDFFSKPHRLIFQEMQKLLDLGYPIDLITLSESLEQKGKLESVGRFSYLAELSKNTP
FT                   STANITAYADIVRERAIVREMILVANKIANAGYDTQGRKSEELLDYAESSVFKIAEKRF
FT                   KKDSGPKNVEQILDETVASIEKLFLSPHDGVTGINTGYQDLNKKTSGLQRSELIIIAAR
FT                   PSMGKTTFAMNLCENAAMLYDKPVLIFSLEMPGEQIMMRMLASLSRVNQARIRTGQLNN
FT                   EDWARISGTINILLKKKNIYIDDSSALTPSEVRSRARRIYRENNGLTLIMVDYLQLMRV
FT                   PSLSENRTLEIAEISRTLKALAKELQVPVIALSQLNRSLEQRSDKRPVNSDLRESGSLE
FT                   QDADLIMFIYRDEIYNENSDLKGIAEIIIGKQRNGPIGTVRLTFNGHWSRFDNYSGQKY
FT                   D"
FT   CDS_pept        583707..584669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="BU547"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13239"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13239"
FT                   /db_xref="GOA:P57612"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57612"
FT                   /protein_id="BAB13239.1"
FT                   /translation="MSKKISLKIGILMDSIESINIKKDSSFAILLEAQKRNHIIHYMEM
FT                   NDLYLRKEQAFARTRLIKLIKNTQKWYQFIKQQSISLSELDVILMRKDPPFNTEFIYST
FT                   YILERAEETGVLIINKPKSLRDCNEKIFTSWFPDLITDTLVTRNIFQIRQFWEKYQDII
FT                   IKPLDAMGGANIFRIKKNDPNFSVIVENMTNYERKYCMVQNYLPEIKLGDKRILIINGK
FT                   PIPWCVARIARIGETRANLAAGGEGKIQSLSETDWKIANYLSPTLKKRGLILVGLDVIG
FT                   DKLTEINVTSPTCICEIESQKNISITGMLLDYIEKKVCL"
FT   CDS_pept        584680..585087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqgF"
FT                   /product="hypothetical protein"
FT                   /note="BU548"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13240"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13240"
FT                   /db_xref="GOA:P57613"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57613"
FT                   /protein_id="BAB13240.1"
FT                   /translation="MIVIAFDFGIKKIGVAVGENITKKGRPLSVLNAQNGCPNWQLVKN
FT                   LIQYWQPQFIVVGLPLNINGTKQKITNKSEKFANLLKYKFNIVVKMHDERLTTVEAKSI
FT                   IFKKNGFKGLKEEKIHSCAAVIILESWFNQY"
FT   CDS_pept        585205..585807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggS"
FT                   /product="hypothetical protein"
FT                   /note="BU549"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13241"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13241"
FT                   /db_xref="GOA:P57614"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57614"
FT                   /protein_id="BAB13241.1"
FT                   /translation="MKKITIIAVSKNRNINNIEEAIRSGINNFGENYLQESLIKIENLK
FT                   KYKNITWHFIGKIQSNKTKKIAQNFSWCQTVDREKIAVLLNKFRPKNLPPINVLIQINN
FT                   LKELQNNRYIDQYQELAQLILSMPNLNLRGIMAVPSIKTNVIENNLQYEKIKTIFNRFK
FT                   RQYSSVDTLSLGTSVDIKESLLATSNMVRIGRNIFNI"
FT   CDS_pept        585850..586980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggW"
FT                   /product="hypothetical protein"
FT                   /note="BU550"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13242"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13242"
FT                   /db_xref="GOA:P57615"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57615"
FT                   /protein_id="BAB13242.1"
FT                   /translation="MFTLPPISLYIHIPWCLKKCGYCDFYSYVSKEIIPENKYIEHLLR
FT                   DFERDLSLINNRNINTIFIGGGTPSLLKNTSIKNLLNGIKKRKIISKNIEISIEANPKT
FT                   LEYQNFIQYKNSGINRFSLGIQTFNSKMLKKIERTYNSKDAMNAIIESKKISDNINLDL
FT                   MYGLPGQSLEEALSDLQIAIQCNPSHISWYQLTIEPNTVFYAKKIQTPHQDVVFNMLIE
FT                   GDKLLKKAGYKKYEISSYSKFNYQCQHNLNYWNFGDYIGIGCGSHGKITQKNGEIIRTI
FT                   KNKNINDFLSGKYINSVYQVSKRDKIFEYFMNVFRLYKPIFKKHFRENTNIEESFIEKN
FT                   IQIAIQEGFLINQSDCWHTTKKGKNFLNSLLEIFLK"
FT   CDS_pept        complement(586987..587706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggH"
FT                   /product="hypothetical protein"
FT                   /note="BU551"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13243"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13243"
FT                   /db_xref="GOA:P57616"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57616"
FT                   /protein_id="BAB13243.1"
FT                   /translation="MKNNIITPRYNLEGVFLRQIHSFVCRKGRTTTSQLSAIKKYWSLI
FT                   GVDFQLNALNFSSIFKHRAPIILEIGFGSGESLVKTAMNFPEKNFLGIEVYKSGIGSCL
FT                   HYASSYQIQNLRIIYYDATEVMYNMIPDDTLSKVQIFFPDPWHKKRHHKRRLLKNIFLK
FT                   IITKKLIIDGILHIATDSESYAFYILDEIKDIKNYKNLSEKNNFVKRPVSRIITKFEKK
FT                   GLLQGKKIFDLMFQLKK"
FT   CDS_pept        587804..588856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /note="BU552"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13244"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13244"
FT                   /db_xref="GOA:P57617"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57617"
FT                   /protein_id="BAB13244.1"
FT                   /translation="MTKYIFSQLVLNWYHKNGRKDLPWQINKTLYTVWISEIMLQQTTV
FT                   KSAIPYFKKFILNFPNIKSLNDSKLDDVLYLWSGLGYYNRAKNIYKSAQIIKKKYKGIF
FT                   PDQFSNIIQLPGIGRSTAGAILSLSLNFFYPILDGNVKRILVRYYGISGLLKDKKIEKK
FT                   LWNIIESITPIHNTGKFNQGMMDIGASICISIKPKCTICPLKKECIAQIEKKWEKYPLK
FT                   NIKKTLPQKISWFIIIKHENNFWLKKNTEQEIWKELFCFPKFKNKEEALIWLKEKKINI
FT                   NTCENMISFFHKFSHFILHINPILIRLPYISEFFKENHKKIWYNLKNPQHIGLPRPVQK
FT                   ILENFKKNIF"
FT   CDS_pept        588828..589109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggX"
FT                   /product="hypothetical protein"
FT                   /note="BU553"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13245"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13245"
FT                   /db_xref="GOA:P57618"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57618"
FT                   /protein_id="BAB13245.1"
FT                   /translation="MKILKKIFFKKRSIKIMNRIIFCTFFKKKSEGQDFQSYPGKLGKK
FT                   IYDQISKKAWEKWIEKQTILINEENLNMFNLEHRKKIEKYMKLFLFKK"
FT   CDS_pept        589203..589991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="BU554"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13246"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13246"
FT                   /db_xref="GOA:P57619"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57619"
FT                   /protein_id="BAB13246.1"
FT                   /translation="MLIFDSGVGGLSILKNIKKILPNIHYIYMLDNESFPYGNKTEFFI
FT                   IQRSIKIIHTIKKIYPINVVVIACNTISTVALSILRKKFDIPIFGIFPHIKAAEKITKN
FT                   KIIGLIATKATINSSYTQKIIYEYSCSNTIKIIGTNKLAVIAEKKIRGVAVSQKKLKNI
FT                   FRPWINLPTCPDTIILGCTHFSLLEKEIKNILYKTRSVYFIDSIKKVIFQIESYLKTSN
FT                   VNQKIKKNIFLYSKNNNNLKKLLSFLKQYKFTVIKHINLN"
FT   CDS_pept        complement(590182..591423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcB"
FT                   /product="exodeoxyribonuclease I"
FT                   /EC_number="3.1.11.1"
FT                   /note="BU555"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13247"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13247"
FT                   /db_xref="GOA:P57620"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR013620"
FT                   /db_xref="InterPro:IPR034747"
FT                   /db_xref="InterPro:IPR034748"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038649"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57620"
FT                   /protein_id="BAB13247.1"
FT                   /translation="MIQFQKKTPNFLFYDYETFGIHTALDKPAQFACIRTDINLNIIDD
FT                   PQYFYCFPSDDYLPDPGSVLITHITPQYTEKNGTNEYNFSQKIYDILMQSNTCVVGYNN
FT                   INFDDEITRNIFYRNFFDPYEWSWKNGNSRWDILNLLRACYALRPTGINWPKNELGLTS
FT                   FKLSDLTKTNNIVHLNAHNAVSDVYATIEIAKLVKKKQPRLFDFFFKIRKKNELYKLID
FT                   LRNFQPIIYISAYFGAIYHNMSCILPIAWHENNSNILIAIDLFKDIKTLINMCKKICFD
FT                   SIFIKNLLDSGVVLLHLNRCPILAPIQVIRKEDYNRLNFHRFSLNKKIELIKKNMFFIQ
FT                   NIKIIFSKNNNTNQFFNVDLEIYNGFFNSKDKKKIQIIRNTDPVFLKHIFCNFHDSRLK
FT                   NLFFRYRARNFFIH"
FT   CDS_pept        591503..591811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeeX"
FT                   /product="hypothetical protein"
FT                   /note="BU556"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13248"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13248"
FT                   /db_xref="InterPro:IPR007458"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57621"
FT                   /protein_id="BAB13248.1"
FT                   /translation="MSDTKKSFKNVLEFVHKFRRKNKIKREISDIEKKIRDNQKRILLL
FT                   DNLIQYITLDMNYEEIKKIIFMMKSDYEDRIDDYIVKNAELSKEKRNLSKELKFIIK"
FT   tRNA            complement(591818..591890)
FT                   /product="tRNA-Asn (GTT)"
FT   tRNA            592025..592097
FT                   /product="tRNA-Met (CAT)"
FT   CDS_pept        592193..592834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="BU559"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13249"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13249"
FT                   /db_xref="GOA:P57622"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57622"
FT                   /protein_id="BAB13249.1"
FT                   /translation="MDWKKEFIDFSFKKKVLKFGVFQLKSGRISPYFFNSGLLSTGIDI
FT                   IKIGLFYARSIIDSKNKFDVLFGPAYKGIPIAVATSIALKNHYNLNVPYSFNRKEYKEH
FT                   GEKGDLIGSTIYKKRVIILDDVITSGTAIHHSIKIIEKQEASISSIFVLLDRKEKGIRK
FT                   LSTINHFRNQKSYKIISIITIDDLIEYVLEDKKLKEHIPQLIKYREKYGI"
FT   CDS_pept        complement(592846..593310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="BU560"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13250"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13250"
FT                   /db_xref="GOA:P57623"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57623"
FT                   /protein_id="BAB13250.1"
FT                   /translation="MSNIEIKILDSRMKNNFSLPSYATLGSSGLDLRACLDETVKLKAH
FT                   KTILIPTGIAIYIANPNITALILPRSGLGHKKGIVLGNLVGLIDSDYQGQLMISLWNRS
FT                   DQDFYVNPHDRVAQIIFVPIIRPCFLLVKNFNETSRSKKGFGHSGVSGVI"
FT   CDS_pept        complement(593354..594151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /product="cysQ protein"
FT                   /note="BU561"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13251"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13251"
FT                   /db_xref="GOA:P57624"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57624"
FT                   /protein_id="BAB13251.1"
FT                   /translation="MQKINFFDTINNIWRKMLDKICQLARSAGHCIMKLYNSQKFINVS
FT                   YKPDNTPITDVDYAANNIIKKGLSLISPQIPIISEEESYNFEICRNWNSYWLVDPLDGT
FT                   KEFLKKNGEFTVNISLIEYGVPILGVIYAPFFDVLYSAFYDNAWKEEKFGSKKKINVAQ
FT                   AEAPLLVISRSHPNETLKNYLEKIKCCKIKKMGSSLKFCLIAEGTAQIYPRFGDTHIWD
FT                   TAAGHAIVIAAGGKVQTWTGGNLNYSLSSRVSFINSGFYASAL"
FT   CDS_pept        complement(594138..594590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /product="50S ribosomal protein L9"
FT                   /note="BU562"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13252"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13252"
FT                   /db_xref="GOA:P57625"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57625"
FT                   /protein_id="BAB13252.1"
FT                   /translation="MEVILLSKIKKLGDSGAVINVKSGYARNFLIPKGKAILANKKNIE
FT                   SFEAQRIALEKEKINELLIAQSRAEKLKKINSITILSKVGKEGKIFGSVGVRNIIKEII
FT                   LLGIKINKKEIRLPNGLLRQVGEHIVVFQPHSKVSINFIVKIIAKN"
FT   CDS_pept        complement(594639..594866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /product="30S ribosomal protein S18"
FT                   /note="BU563"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13253"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13253"
FT                   /db_xref="GOA:P57626"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57626"
FT                   /protein_id="BAB13253.1"
FT                   /translation="MARYFRRRKFCRFTAEGVQEIDYKDIAVLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLSRAIKRARYLALLPYTDQHR"
FT   CDS_pept        complement(594992..595333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /product="30S ribosomal protein S6"
FT                   /note="BU564"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13254"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13254"
FT                   /db_xref="GOA:P57627"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57627"
FT                   /protein_id="BAB13254.1"
FT                   /translation="MRHYEIIFMVHPDQSDKIPLLIEKYKKIINDNNGIIHRLEDWGRR
FT                   QLSYSINKLQKAHYILMNIEVFPKTITLLETDFRFNNIILRNMIMSVKKAIVELSPILK
FT                   LKDDKKEKK"
FT   CDS_pept        complement(595499..597736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vacB"
FT                   /product="vacB protein"
FT                   /note="BU565"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13255"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13255"
FT                   /db_xref="GOA:P57628"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57628"
FT                   /protein_id="BAB13255.1"
FT                   /translation="MYNYIINNIHGEVNMVVDPYQKREAKRYKNPIPSREYISSCLRTS
FT                   QDLISQKNLEKKFGINNQESKKALRRRLRAMERDGQVIYTSNRCYVAPESLKIVKGKVI
FT                   GHRDGYGFLRTETLKEDLWLSSEQMKSCIHGDIILAHIVETHGKRRSSARFLKLLQPNN
FT                   ILIVGRYYIDDKIKFVIPDDTRFNFKIFIFSAIKDDISIGSIVSVKLKQHPIRNSRVQG
FT                   FIVEILGKEMGTNLAIEIALRTHLIPSLWSKEVKKQVYEISRKINQYDFKNRTDLRHFP
FT                   FFTIDDEDARDFDDAVFCKRKANPEEGWILWVAIADVSCYVQPNTPLDKAALERGTSVY
FT                   FPSLVIPMLPEKISTDLCSLKPNVERLCLICEMSLSKQGELISYKHYEGIICSHGRFTY
FT                   NEIFKIWNGDIFLRSKYKKFLKDIENLSCLQNIFNKDNISKKGIYFENIEPKFVLDSNL
FT                   RIKSIYQNIRNDAHKFIESCMILANVASARFVEKYKYPVLFRNHDRPKKDNVVSLRLFL
FT                   NELGFTLLGGDSPESVHYSNLLKNVSDRPEYEMIQTVLLRSMTQAVYSPDNRGHFGLSL
FT                   SSYVHFTSPIRRYPDLILHRVIKYLLFKDKNTSKSNYNFYSAHLYSTGEIKKIGAHCSI
FT                   TERRADEANRDVIDWLKCDFMYKKIGCILNGVISNVTTFGFFVRLNQFFIDGLVHINSL
FT                   NDDYYYFDSLGLKLIGKSTKNTYCLGDALKVKVISVNLNEKKIELSLYKSS"
FT   CDS_pept        complement(597824..599125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="BU566"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13256"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13256"
FT                   /db_xref="GOA:P57629"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57629"
FT                   /protein_id="BAB13256.1"
FT                   /translation="MNKNIVILGTQWGDEGKGKVVDCLTKDSSYVVRYQGGHNAGHTLV
FT                   VNDKKIILHLIPSGLLHKNVIGIIANGVVVSPFELIKEIKMLETHNIFVHKRLFISNSS
FT                   PLILQYHIEMDIAREKKLGISALGTTGRGIGPAYEDKIARRALRIGDLKNEKTLSIRLE
FT                   KIVNYYNHQLVSFYKHKPVDYKIILRDLLPTIDLIYDMIKDTTSILHTAIQSNKKIIFE
FT                   GAQGSFLDIDHGTYPYVTSSNSTIGGVITGTGVGSKSLDYILGVTKAYSTRVGYGPFPT
FT                   ELFDDVDKHFSKKGHEFGSTTGRKRRTGWLDAVALCRSVRINSLSGLCITKLDVLDGLH
FT                   EIKICTAYKNINTLEIISFPDIDEWKNIEPIYETYPGWNKKTLGIKKLIDLPYEARNYI
FT                   NRIEEITQIPVDIISTGPDRSDIIFVRDIFFIKK"
FT   CDS_pept        complement(599175..600107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /product="hflC protein"
FT                   /note="BU567"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13257"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13257"
FT                   /db_xref="GOA:P57630"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57630"
FT                   /protein_id="BAB13257.1"
FT                   /translation="MNKILIFASSVLFLILSSSFFIVKEGERGIVLQFGKVLRNNELKT
FT                   VVYNPGLHFKWPFLETVKMLDARIHTMDNQADRFVTKEKKDLIVDSYIKWRINDFSRYY
FT                   LATGGGDVFQAEVLLKRKFSDRLRSEIGRLNVKEIVTDSRGRLTTDVLNSLNKGSMNLE
FT                   KSSLINVNSMNALGIHVVDVRIKQINLPVEVSDAIYNRMRAEREAVARSQRSQGQEKAE
FT                   KLRASADYKVSIILSEARKEALIIKGQGEAEVTKLFAKNFNKEPDFYFFIRSLRAYENS
FT                   FKNNRNIMLIDSDSQFFRYIKNMINIKNL"
FT   CDS_pept        complement(600110..601330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /product="hflK protein"
FT                   /note="BU568"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13258"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13258"
FT                   /db_xref="GOA:P57631"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57631"
FT                   /protein_id="BAB13258.1"
FT                   /translation="MVWNKPNNNKPDFDPWGNKDSKSKNCSDNKHEKKTTVLDIKNFLY
FT                   NLKNIITKKTDSSNSSKKITYPFSIIIFISFFIWGVSGFYTITEAERGVVTSFGKFSHL
FT                   VQPGLNWRPVFFNEVKPVNVETVRELATSGIMLTADENVVRVEMNVQYKITNPADYLFS
FT                   VCYPDDSLRQATDSALRGVIGHSTMDRVLTEGRTLVRSDTQKEIENTIKPYKMGITILD
FT                   VNFQTARPPEEVKAAFDDAIAARENREQYVREAEAYSNEVKPKANGKAQRILEEAKSYS
FT                   SRIILQAQGEVARFSKILPEYRIAKKITLKRLYIESMERLLRKNKKIFIDTNNNPMFFF
FT                   SLDNFFSKIKIPNKNFKDHIKINKNHSPFNKKVKNTNYFPFLSPDNISEQRRINSIRSD
FT                   LKKIGRE"
FT   CDS_pept        complement(601487..602395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="BU569"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13259"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13259"
FT                   /db_xref="GOA:P57632"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57632"
FT                   /protein_id="BAB13259.1"
FT                   /translation="MGPTACGKSQLAICLRKYLSIELISVDSALIYRGMDIGTDKPSFS
FT                   DLYNHPHRLLNIKDPVENYSAAEFQKDVLREIDEIIKLGKIPCLVGGSMFYYNVLLHGL
FT                   SILPPSNIKLREYLIQKSYEKNYLYKKLKLIDPISASRIHKNDFQRLIRALEIFYLSGK
FT                   SLTELKKKNNYKLPYNIFQFAIIPPNKEWLNNKIELRIKKMLMLGFQKEVEILFLRGDL
FT                   HKNLPSIRCIGYRQMWEYLEYKNSYKDMFNKIIHATRKLAKHQLTWLKNWKNINKIEYH
FT                   STSTILAKKVLDVLEKNDFSV"
FT   CDS_pept        complement(602433..604187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /product="DNA mismatch repair protein mutL"
FT                   /note="BU570"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13260"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13260"
FT                   /db_xref="GOA:P57633"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57633"
FT                   /protein_id="BAB13260.1"
FT                   /translation="MPIRILPSDLSSQISAGEIIERPASVVKEIIENSIDAGSKNINII
FT                   VENSGFQSIILKDDGCGIDKKDLLLAVCHHATSKINSLSDLDKLTTFGFRGEALASIRA
FT                   VSRLTLISCTRFNDVAAKIYLEGFCSKNIILQPIAHPEGTTIIVDNLFYNIPVRLKFLK
FT                   NKKLEFSKICEVVKKIALSHFYINFSLKHNNKLITQYNSINNRKNKINRLKDIFDTLDT
FT                   SEFLEIKEKKYRMVLFGWISHPYNFKKIKNIQYCYVNNRYLYNNIFVNAVRAAYSKIEQ
FT                   KKNISFVLYLTIESFNIDINIHPTKNEIKFHNPDVVYTFIYEAVFSYLKKIKEKYYFNF
FT                   SCKKQTQLNKEKEFYFYDSDPTFLTLISSIFLKKKQICKNIKNKIKHNNFISKSTPLEK
FT                   YESSIGRLLIIIHKYYGLIYHDNNFLLLSFPVAKGIVRKQKLKNNIQKENIIEYFLSNI
FT                   KINLTSQEYLILFNKKEILSKFGFHLIFKKKYVILSSIPAFLKKCNFHIIISNFFAFLF
FT                   LKKQVFISDIVDWFYINVFIELKNWTYIRGIEVLLEIEYYCPLLLINPPSKLLQKININ
FT                   AALCILKI"
FT   CDS_pept        complement(604287..605444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /EC_number="1.1.1.17"
FT                   /note="BU571"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13261"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13261"
FT                   /db_xref="GOA:P57634"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57634"
FT                   /protein_id="BAB13261.1"
FT                   /translation="MKALQFGAGNIGRGFIGKTLSESGFSVIFSDVNQNIVDAINYNRE
FT                   YFVKIIGSNQNKTVNIKRVSAINSNDSNIKKIISSVDLITTAVGPTALEKIALIITQGI
FT                   IFKIKNQFTKPLNIIACENKIKSSSFLKQVVLKNLPIKYHDYLNKYIGFIDCSIDTIIP
FT                   AINNKDDLFLTVEEFKEWIVNINQFKGAVPKIVDMKFSNNLDAFIERKLFTLNTGHAIA
FT                   AYLGLIKNYKTIQDAISDKKIRVIVRSAMEESGSVLIKRYNFNKNDHLDYIEKIFLRFE
FT                   NPFLSDKLERIGRNPLQKLRREDRLIKPFLGAFEYNLPYSNLAKGIAAAFYYHNKNDLE
FT                   SIELSSSIKKQGLESTIIKICDLPVNSKEVYSIILEYNLIKKIIR"
FT   CDS_pept        complement(605486..607384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlA"
FT                   /product="pts system mannitol-specific IIABC component"
FT                   /EC_number="2.7.1.191"
FT                   /note="BU572"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13262"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13262"
FT                   /db_xref="GOA:P57635"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57635"
FT                   /protein_id="BAB13262.1"
FT                   /translation="MLTLIKLKIQNFGRFLSNMIMPNISIFIAWGMMNALFMPLGWQPN
FT                   KTLEQLISPMIFYLLPILIGYTGGSLISGSRGGLIGSITTIGVITSTNIPMLLGAMISG
FT                   PLGGWTIKYFDKKIENKVKNGFEMLVNNFSLAILGILLAIISFFTIGPFIEWVSYFLGT
FT                   LIQIILSYNLLPLTSIIIEPAKIFFLNNVINHGIFSPLGIQDALDKNHSIFFLIESNPG
FT                   PGLGLLIAWFFFGKGELSKSSGGAALIEFFGGIHEIYFPYVLIKPKLIIPLILGGMSGI
FT                   FILVLLHGGLISTASPGSILSILAMTPKGLYFSNIISVACSFLVSFISSSILLKYDFNT
FT                   IQKDSNYTVKQGKNSFNSKTSREDFNNFNFSKIKTIIVACDAGMGSSAMGASILRKKIK
FT                   NANLNHISVLNMAINALPQDADLIITHQNLTNRAKDNAPFSQHISLKNFLNNHFYDNLV
FT                   KKLVENMVFLYDNHTDSVNKYTQQKKDALFQLNEENIILNQYASNKEEAINIVGKHLVK
FT                   QGYVKFDYIDSMLEREKMASTWLGESIALPHGTIEAKDSVLKTGIIFCQFPKGVRFGED
FT                   VDDIAYLVIGIAAKNNEHIMVVSNITNALDKKDTIQRLSHTTSIKEALSLLTMEKI"
FT   CDS_pept        complement(607559..609208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="BU573"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13263"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13263"
FT                   /db_xref="GOA:P57636"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57636"
FT                   /protein_id="BAB13263.1"
FT                   /translation="MKNINFNNTQSYQDLKNHFRKIKNIHLRDLFASDLNRFKKFSIIF
FT                   ENEMLIDFSKNRITDETLIYLLNLAKETDVKSGIKLMFSGAKINKTENRSVLHIALRNR
FT                   TNRPIILNNCNIMLEVNALLEKMKNFSKMVIHGEWKGYTGKSISNVVNIGIGGSDLGPY
FT                   MVTEALRPYKNHLNMYYVSNIDGTHLTEVLKKINPENTIFLIASKTFTTDETITNAHSA
FT                   KKWFLHYSQDQSALDKHFFALSANIKNALNFGININNIFKFWDWVGGRFSLWSSAGLSI
FT                   MLSIGFDNFEKFLDGAHAMDNHFYHTNYKENIPILLALISIWYTNFFGSETEAIFPYDQ
FT                   YMHRFSAYFQQSNMESNGKSINRNGQRINYQTGPIIWGEPGTNGQHAFYQLIHQGTRLI
FT                   PCDFIAPVFSHNDLNNHHMKLISNFFAQTQALAFGQSRDSILHRLILSKKNQDDIKRIL
FT                   PFKICKGNQPTNSILIRKITPYNLGALIALYEHKIFVQGYILNIFSFDQWGVELGKELS
FT                   QNIYNYLNINVKNKSYDASTEGLINFYKSFMI"
FT   CDS_pept        609522..610076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /product="oligoribonuclease"
FT                   /note="BU574"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13264"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13264"
FT                   /db_xref="GOA:P57637"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57637"
FT                   /protein_id="BAB13264.1"
FT                   /translation="MKINKKNLIWIDLEMTGLNPKVHRIIEIATLITDTNLNIIAEGPV
FT                   IPIYQKKEHILVMDEWNKRIHENNGLIKRVEKSLYNEQKAEHETILFLKKWVPIQVSPM
FT                   CGNSIAQDRRFLFQYMPHLENYFHYRYIDVSTIKELAYRWNPSILDKFKKNHYHKALED
FT                   IRESVVELNFYKKNFLKFKKK"
FT   tRNA            610162..610237
FT                   /product="tRNA-Gly (GCC)"
FT   CDS_pept        610528..611241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiB"
FT                   /product="N-acetylmuramoyl-L-alanine amidase precursor"
FT                   /EC_number="3.5.1.28"
FT                   /note="BU576"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13265"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13265"
FT                   /db_xref="GOA:P57638"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57638"
FT                   /protein_id="BAB13265.1"
FT                   /translation="MSKKITILIDAGHGGYDPGAIGIRGLKEKNINIEIALKLEKLLNH
FT                   DKMFCTILTRHNDSYLSLKKRKQLLKKNQVNFLISIHADSSRKQNVSGASIWIVSKTRI
FT                   NREINNYLKNKSTLLFSKKIENIFKQNKNDFFLKKTILDLQSNNFQKIELDLSKEILKQ
FT                   LEKNTKLNKKYPNYASLGILSSINTPSILIETGFITNILEGKKLKTTNYQNKIANSIYL
FT                   GLKNYFTKSSYILKK"
FT   CDS_pept        complement(611349..611567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /product="50S ribosomal protein L31"
FT                   /note="BU577"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13266"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13266"
FT                   /db_xref="GOA:P57639"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57639"
FT                   /protein_id="BAB13266.1"
FT                   /translation="MKKKIHPRYSKITATCSCGNIIEIFSTINHNLNLDICAKCHPFYT
FT                   GKQRVIDTGGRVERFKKRFKFTKQELN"
FT   CDS_pept        612173..612685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /product="heat shock protein hslV"
FT                   /note="BU578"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13267"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13267"
FT                   /db_xref="GOA:P57115"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57115"
FT                   /protein_id="BAB13267.1"
FT                   /translation="MRLKNKVVIGGDGQATLGNTIMKSNVKKIRSLYHEKVIAGFAGGT
FT                   ADAFTLFEMFDKKLAMYQGQLQRAAIELAKDWRSDRMLRKLEALLAVADKKTSLIITGN
FT                   GDVIQPEDDLIAIGSGGSYAQSSARALIENTHLDANQIVRKSLNIAANICIYTNHNFTI
FT                   KELFSEK"
FT   CDS_pept        612698..614029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /product="heat shock protein hslU"
FT                   /note="BU579"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13268"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13268"
FT                   /db_xref="GOA:P57116"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57116"
FT                   /protein_id="BAB13268.1"
FT                   /translation="MSEMTPPQIVSELDKFIIGQEKAKRAVSIALRNRWRRMQLNSELR
FT                   YEVTPKNILMIGPTGVGKTEIARRLAKLADSPFIKVEATKFTEVGYVGKEVDSIIRDLT
FT                   DAAIKMIRIKNIKKNKVRVEEIVEEKILDVLVPTPKKNWTESEKNESLAKTIQTFRKKL
FT                   REGVLDEKEIEINILSTTMGVEIMAPPGMEELTNQLQSLFQNLGGHKKSSRRLKIKDAI
FT                   VLLTEEEAAKLINQEEIKKEAINAVEQNGIVFIDEIDKICRRGDSSGPDISREGVQRDL
FT                   LPLVEGCTVSTKHGMVKTDHILFIASGAFQTSTPSDLIPELQGRLPIKVELQALTIDDF
FT                   EKILTEPTASITAQYKALMETEGVYINFTKEGIRNIAEAAWKVNESIENIGARRLHTVL
FT                   EKLMEDISFNASDNKGNTIEINSNYVEEHLDQLTSNEDLGRFIL"
FT   CDS_pept        614236..614709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ibpA"
FT                   /product="16 kD heat shock protein A"
FT                   /note="BU580"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13269"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13269"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57640"
FT                   /protein_id="BAB13269.1"
FT                   /translation="MSYRSLSFIPNFNDHNVFSNRFNQIDKMFSTLTGEKPISDTPTYN
FT                   LCQINEIEYQLTLSIPGYQEKELDISVHNNQLSIQGKKENSDTQECNKWLHKGIVFNNF
FT                   SLNFNLDHKIKVKKAELSLGLLKLDFECNIPEEEKPKKISINVPNDTKKIDKK"
FT   CDS_pept        614786..615544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /product="ferredoxin-NADP reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="BU581"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13270"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13270"
FT                   /db_xref="GOA:P57641"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57641"
FT                   /protein_id="BAB13270.1"
FT                   /translation="MNPWINADVLMVKKWTKNLFSLILNAPIEPFFAGQFNKLALYNSN
FT                   PLNKNKIQRAYSYVNAPSEKNLEIYIVRVLNGQLSNLLYNLHSGDKIFIKKKSFGFFII
FT                   DEIPDCEILWMFATGTGIGPYCSILQEGKNINRFNHIILTHAVRYQNELTYLPLMKELR
FT                   QKYNGKLQIQTITSREKHKNSLNGRIPFLLRNKILEKHVGFSINPQTSHVMLCGNPFMV
FT                   KDTFLFLKNNRNMEKHLRRKKGHITMENYW"
FT   CDS_pept        complement(615562..616536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeA"
FT                   /product="hypothetical lysyl-tRNA synthetase homolog"
FT                   /EC_number="6.1.1.6"
FT                   /note="BU582"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13271"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13271"
FT                   /db_xref="GOA:P57642"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57642"
FT                   /protein_id="BAB13271.1"
FT                   /translation="MKKKIWKSSASIEDLIKRSNIISNIRLFFSKKNILEVETPILSRS
FT                   TVTDVHLTSFETNYISSDNIDELKLWLTTSPEYHMKRLLASESGSIYQICHSFRNKEIG
FT                   RYHNPEFTMLEWYQPFCSMKKFIKEIDIFLQIILKCNKSDKVSYQDLFIDFLKIDPLCT
FT                   NLLELHQISKKLKLDHLTHSENNLNKLIQLLFTLKIEPNIGKEKPLFVYHFPAEQASLA
FT                   AINLKDPRISERFEIFFKGIELGNGFYELIDVNEQKKRFIRDNKERRSMNLPTRKIDNF
FT                   FLSALSYGLPPCSGVAIGLDRLIMLILNKKSIHEVIAFPVDRC"
FT   CDS_pept        616608..617105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtB"
FT                   /product="lipopolysaccharide core biosynthesis protein
FT                   kdtB"
FT                   /note="BU583"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13272"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13272"
FT                   /db_xref="GOA:P57643"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57643"
FT                   /protein_id="BAB13272.1"
FT                   /translation="MNKTAIYPGTFDPITYGHLDIITRATKIFDSITIAISNNFTKKPI
FT                   FNLKERIELTRKVTLHLKNVKKILGFNDLLANLAKKEKANILIRGVRTIFDFDYEIKLA
FT                   AINKQIYPDLDSIFLLSSKEVSFISSSFVKEIAKYKGDIKPYLPKEAHSALLRKLNNDS
FT                   IK"
FT   CDS_pept        complement(617192..618295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yba3"
FT                   /product="hypothetical protein"
FT                   /note="BU584"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13273"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13273"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57644"
FT                   /protein_id="BAB13273.1"
FT                   /translation="MPEQHHSNFFDNEIELSSKKSLDFDFSEIAENIIKTITNTVITTY
FT                   QTFKTETINLFNGTTFKKIFFSSDENRAKIDSNSEATISLSEHIEQLKRVIESSKVYLR
FT                   AIIERIRYQGKIKIVNKLNNNPRHPEYQSSFPEITNPIPEPEDENDFYPFKRLDENFDL
FT                   EGRKSILKMDQNFRQRMNKNIQESYANDFIDESTWTVSDQLNSFNNIQSTIKHFQKKYE
FT                   FLKSSNDLDNDFMNDTNPFLFVVNNALISVNNRNKMLKDFKTIVPNVEFRQLISTYANQ
FT                   KFLRQSYLQLISEHPEIDQYQIKHSRNIYKINFLDDGSVKLVATNLSDLDVKNDNYIQK
FT                   YKSFGIRATIILPPNASPIMKYSYFMK"
FT   CDS_pept        complement(618288..618626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yba4"
FT                   /product="hypothetical protein"
FT                   /note="BU585"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13274"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13274"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57645"
FT                   /protein_id="BAB13274.1"
FT                   /translation="MLHNLLLNPNQSNKTHPNTIDIYTDAIKTMFETNKNQTVSKKNDQ
FT                   NTYDLEDENKLIDLENSYKKSLILLNILQKKIEQNILEKYNLEKNNNNITDNSDNEIIQ
FT                   NTLIKKNS"
FT   CDS_pept        618781..619521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhiQ"
FT                   /product="hypothetical protein"
FT                   /note="BU586"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13275"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13275"
FT                   /db_xref="GOA:P57646"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57646"
FT                   /protein_id="BAB13275.1"
FT                   /translation="MKIYLKFKSYNKRICKLLQLFKLEHDQNCSMGLLINHNSLELYNR
FT                   DNVNQKPIKVDFTSKKNHYRCHHFRRKNEVLYRVSGIKNSYFPTILDATAGLGNDAFIF
FT                   SFLGCKVIMIERHPIVAALLKDGLQRGYQDKKIGHWLQTRLHLIVNDSLKMLEIPILQP
FT                   DVIYLDPMYPFHHKKSLPKKDMQFFRQLIGHNYDSKKLLEVSRKLAKNRIIVKRPYYAK
FT                   PLSEDKVNHIVTTRNHRFDIYQPF"
FT   CDS_pept        complement(619604..621076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pitA"
FT                   /product="low-affinity inorganic phosphate transporter"
FT                   /note="BU587"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13276"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13276"
FT                   /db_xref="GOA:P57647"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57647"
FT                   /protein_id="BAB13276.1"
FT                   /translation="MLHLFSYSDLNHSLLVFLALFFVLFYEAINGFHDTANAVSTLIYT
FT                   RAMSAHVAVIMSGIFNFLGVLLGGLTVAYTIVHLLPNDLLLNATSKNALAMVFSMLLAA
FT                   IIWNLSTWYFCLPASSSHSLIGAIIGIGLTNAFVTDSSLVDAFNIPKMTSVFLSLVFSP
FT                   IIGLIIAGSLIFLLRYYLNNNKIFYRIHMTPLERKEKDGKKIPPFLIRMALILSSIGVS
FT                   YAHGANDGQKGIGLIMLVLIGIVPSSFLVNLNTNKYEINCTKHTLNHLEKYFLEKNIKK
FT                   SNIIKNKEEINNLVVRSQSYNSIKNIKNTKLLLKNISNYNDLSIKKRFQLRHYLLCISD
FT                   SIDKKVNSSDICSKDKRFLIHSKKVILKTIEYAPMWIILIVALSLSIGTMIGWKRIVVT
FT                   IGEKIGKKRMTYAQAMSAQITASFSIGIASYTGIPVSTTHILSSSVAGTMLIDGDGIQT
FT                   KTIKNIALAWILTLPVSMLLSSFLYWIALFLI"
FT   CDS_pept        complement(621227..622459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ynfM"
FT                   /product="hypothetical protein"
FT                   /note="BU588"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13277"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13277"
FT                   /db_xref="GOA:P57648"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57648"
FT                   /protein_id="BAB13277.1"
FT                   /translation="MTLLKNKKQLLEKQYIKKNTKKFNQVILALFSGGFATFSILYCVQ
FT                   SILPMFSKQFYLTPAESSLALSAATITMSLGMLFTGPLSDIIGRKSIMSTSLFIAAMLT
FT                   MICSMMTSWISIVLLRALTGLALSGVVAVAMTYISEEIHPNSLSFCMGLYISGNTIGGF
FT                   LGRLLSSILAEKFSWSISLMVIGLFSFISSCFFLYFLPPSKNFLSVSINFHKCLHRFYL
FT                   QLKNRVLFFLFIIGFILMGSFVTIFNYIGYRLMLEPFFLCQSSIGLLSTIYLTGVYSSP
FT                   KAGVLINKYNRNNILIVSLMLMIIGLFITQYNQLFIIILGLIIFSGGFFASHSTASSWV
FT                   GSYSNIAKIQATSLYLFFYYLGSSVFGTFGGFFWFHMQWLGISVFIITMLFFGVFLSFK
FT                   LKQKNFKNKYF"
FT   CDS_pept        complement(622493..623410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="BU589"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13278"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13278"
FT                   /db_xref="GOA:P57649"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57649"
FT                   /protein_id="BAB13278.1"
FT                   /translation="MLVFTNKYFQKKQSNYYFEEKMDSYYKNKKKINFSKMHGLKNDFM
FT                   VINCIKKNVFLTSHIIKKLSNRYTGIGFDQLLLVEKSNSLLTDFHYRIFNANGNEVEQC
FT                   GNGARCFGLFLLLKGLTNKKKILISTKKKPLTIEFLTENMIKVNMNEPDFKFYNLSSLQ
FT                   NVLDNNFSIKLMNENLICNLVSIGNPHCIIKVQSVKNAPVNIIGDSIEKNPIFPEGVNV
FT                   SFMEILNKKHIKLRVYERNVGETKACGSAACAAVAVGIAQKLLSDTVHVELLGGKLIII
FT                   WKGFGTPLYMVGPAKHVYDGYIYI"
FT   CDS_pept        623535..623885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /product="cyaY protein"
FT                   /note="BU590"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13279"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13279"
FT                   /db_xref="GOA:P57650"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57650"
FT                   /protein_id="BAB13279.1"
FT                   /translation="MKKKLNTKKENNNFYILVNDLFLKIEDNLNLYENEIDIDYEIQDY
FT                   VMTITFSNKTLIIINKQEPLQQIWLATMQNGYHFDYKNNQWICNRSNKNFWEIFENACS
FT                   IQSNKDLIFCKK"
FT   CDS_pept        624014..624958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="BU591"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13280"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13280"
FT                   /db_xref="GOA:P57651"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57651"
FT                   /protein_id="BAB13280.1"
FT                   /translation="MYNKTLRIATRKSPLALKQTKYVQKKILSLYPDLNIKLVPIVTHG
FT                   DNILNKSLSKIGGKGLFIKELELALLENKADIAIHSMKDLPVKITKELCLVSICKRGNA
FT                   LDSLVSNNYQSINQLPKGAIVGTSSLRRQCQLITYRPDLIISPLRGNIETRIAKLDQGK
FT                   YDAIILATEGLNRLRLKNRITQIIPAELSLPSCGQGAIGIQSRLHDKKVLFFLSRLNHI
FT                   NTFIEINAERAFCRKLESGCQIPIGSYAILKKNKIWLRGLVGSPNGKIILKGERIGCYN
FT                   TGEKMGYSLADELLKNGAKNILNNLHIKQSYCI"
FT   misc_feature    624955..625712
FT                   /gene="hemD"
FT                   /note="authentic frameshift; 35 pct identical to HEM4_ECOLI
FT                   SW:P09126"
FT   tRNA            complement(625716..625792)
FT                   /product="tRNA-Pro (TGG)"
FT   tRNA            complement(625829..625904)
FT                   /product="tRNA-His (GTG)"
FT   tRNA            complement(625934..626007)
FT                   /product="tRNA-Arg (CCG)"
FT   CDS_pept        complement(626196..627455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /product="transcription termination factor rho"
FT                   /note="BU596"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13281"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13281"
FT                   /db_xref="GOA:P57652"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57652"
FT                   /protein_id="BAB13281.1"
FT                   /translation="MNLTALKNMPVSELITLGEKMGLENLARMRKQDIIFAILKQHAKS
FT                   GEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPP
FT                   KEGERYFALLKVNEVNYDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLD
FT                   LASPIGRGQRGLIVAPPKAGKTILLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRL
FT                   VKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPAS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGN
FT                   MELPLSRKIAEKRVFPAIDYNRSGTRKEELLTLPDELQKMWILRKIIHPMSEIDAMEFL
FT                   LNKLAMTKTNDEFFDMMKRS"
FT   CDS_pept        complement(627585..627911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /product="thioredoxin"
FT                   /note="BU597"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13282"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13282"
FT                   /db_xref="GOA:P57653"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57653"
FT                   /protein_id="BAB13282.1"
FT                   /translation="MNKIIELTDQNFEEQVLNSKSFFLVDFWAQWCNPCKILAPILEEI
FT                   SKEYSNKVIVGKLNIEENPNTAPVYSIRSIPTLLLFNNSEVLATKVGAVSKLELKEFLD
FT                   ENIN"
FT   CDS_pept        complement(628113..630050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /note="BU598"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13283"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13283"
FT                   /db_xref="GOA:P57654"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57654"
FT                   /protein_id="BAB13283.1"
FT                   /translation="MSLNFSQKNAVELTNGPCLILAGAGSGKTKVIINKIIYLINHCQY
FT                   EPDNIAAVTFTNKAAYEMRIRLSKYLNIPEIKKIIISTFHSLGLEIIKKEIDALELNNN
FT                   FTLLDEKDQILLLKKICKKEIKNNIQLLKKLNFMISYWKNKFLTPLQVQLLAKSSQEKD
FT                   FAYVYEQYTNYLYKANILDFDDLICMPTLLLKNNKKIKIRWQKKISYLLVDEYQDTNNS
FT                   QYELIKMLANKNSDFTLVGDDDQSIYSWRGANPQNIFLLKKDFPNLKIIKMEHNYRSSG
FT                   RILKAANSLIANNIHYLEKKLFSQLKYGNLIKVLIGKNEENEAQKIVKKIISQYAKKKI
FT                   KYRDFAILYRGNYQSRILEKALIKENIPYNISEKSSFFSRPEIKDLLSYLRVVINRDDN
FT                   HAFMRIVNIPSRQIGKTTLKKLEEWANKKHVSLFQASNNIEIKKFLNENTIKKIKNFIS
FT                   KIEKFTAWSCLKPSNIIDDIVDDLEYEKWLSKFLKDPNKIKNSINNVHTLSQWFKNMIK
FT                   GDDFEKPMTLFQIVTRMTIRDILDDNIIKEQQDRVQLMTLHASKGLEFPAVFIIGMCEG
FT                   ILPNQKSIDNDNIEEERRLTYVGITRAKKQLFFTYCYKRTQYGQILDMLPSRFLFELPQ
FT                   EDLKWEKKIF"
FT   CDS_pept        complement(630120..631592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="BU599"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13284"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13284"
FT                   /db_xref="GOA:P57655"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57655"
FT                   /protein_id="BAB13284.1"
FT                   /translation="MNYFNTLNFTQKINQINKCRFMKKEEFNKKNDILKNKNIVIVGCG
FT                   AQGLNQGLNMRDAGLNISYALKKNSIANKNQSWINAIENNFKVDDYDALIPDADLVINL
FT                   TPDKQHHSVIKKLQKLMKKNAVLGYSHGFNIVEFGEKIRKDITVIMVAPKCPGTEVREE
FT                   YKRGFGVPTLIAVHHENDINKIGLEVAKAWAFSTGGHRAGVLESSFIAEVKSDLMGEQT
FT                   ILCGMLQTASLLCYEKLITEKCNPAYSAKLIQNGWETITESLKHGGITLMMDRLSNSSK
FT                   IRAYKLSKEIKKILSPLFQKHMDDIISGEFSNEMMKDWENQDLKLLNWRYKTKNTSFET
FT                   APVYNEKIPEQEYYDHGILMIAILKSGIELSFEKMIETGIKEESAYYESLHELPLIANT
FT                   IARKKLYEMNKVISDTAEYGSYLFSESAYPILKEFISTLNKSDLGCALSHQSVNNIELY
FT                   RINQKIQNHPIEIIGCTLRNYMKKMKAITVAK"
FT   CDS_pept        complement(631640..633493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="BU600"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13285"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13285"
FT                   /db_xref="GOA:P57656"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57656"
FT                   /protein_id="BAB13285.1"
FT                   /translation="MPKYRSFTTTQGRNMSGARSLWRATGMTEKDFTKPIIAVVNSFSQ
FT                   FVPGHIHLQEVGKLICGEIQKSGGVAKEFNTIAIDDGIAMGHSGMLYSLPSRELIADSI
FT                   EYVVNAHCADAMICISNCDKITPGMLMASLRLNIPSVFISGGPMEAGKIQKNNKTIKID
FT                   LVDAIINGGKSHISDDFIKDIEASACPTCGSCSGMFTANSMNCLTEAIGLALPGNGTLL
FT                   ATHIDRKNLFIKSAQIIVKITEDYYKKNNTNVLPRNIANKESFENAMMLDIAMGGSTNT
FT                   ILHLLAAAQEAKVDFKMSNINKLSKKIPHICKVAPSTSLYHVEDVHRAGGVMGILGELN
FT                   RFNLLHKNTRNILQLNLEETLDEYDIFSTNNPDVINMFQAGPGGIRTTKAYSQNFRWTR
FT                   LDYDRKNGCIRSCKHAYSQDGGLAILYGNLAKNGCIIKTAGIDAKNYIFSGVAKVYESQ
FT                   EEAASSILNGEIISGDIIVIRYEGPKGGPGMQEMLYPTTYLKSMNLDKTCALITDGRFS
FT                   GGTSGISIGHISPEAANKGIIALVKNGDIININIPERTIHLNITEKELSHRILQEESKG
FT                   PLSYKPHSRKRYISSALKAYAFFSTSADQGAVRDYKKISNI"
FT   tRNA            complement(633734..633807)
FT                   /product="tRNA-Trp (CCA)"
FT   CDS_pept        633980..635194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhO"
FT                   /product="hypothetical protein"
FT                   /note="BU602"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13286"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13286"
FT                   /db_xref="GOA:P57657"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57657"
FT                   /protein_id="BAB13286.1"
FT                   /translation="MKTPIYLDYAATTPVEFEVAKKMMNYLTIDGVFGNSASRSHKFGW
FT                   KAEEVVDIARNQISELIGADSREIVFTSGATESNNLAIKGIASFHQNKGKHIVTSKTEH
FT                   KSVLDTCRYLENKGFTVTYLTPKNNGIIDLNNLKKNIKKDTILVSIMHVNNEIGIIQDI
FT                   NSISQICRNHGVFFHVDATQSVGKIPIDLKKIPIDLMSFSAHKIYGPKGIGGLYVRRKP
FT                   RVRLLSLIHGGGHERGMRSGTLPVHQIVGMGESFVLAKRKIHDDFIHLTKLKNILWNGI
FT                   KNIEEVYLNSDLQQGAPHILNVSFNYVEGESLIMALKDLAISSGSACTSASLEPSYVLK
FT                   SLGIRDELAHSSIRFSIGRFTTEKEIIHAIKLVHKSIHRLRELSPLWEMFKSGVDLNSI
FT                   EWDHV"
FT   CDS_pept        635225..635608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscU"
FT                   /product="hypothetiacl protein iscU"
FT                   /note="BU603"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13287"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13287"
FT                   /db_xref="GOA:P57658"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57658"
FT                   /protein_id="BAB13287.1"
FT                   /translation="MAYSKKVMDHYENPRNVGSFSSTDLNVGSGLVGAPACGDVMKLQI
FT                   KVNEKGIIEDACFKTYGCGSAIASSSLVTEWVKGKSIEEAESIKNTTIVEELDLPPVKI
FT                   HCSILAEDAIKAAISDYKRKKIN"
FT   CDS_pept        635703..636227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscB"
FT                   /product="chaperone protein hscB"
FT                   /note="BU604"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13288"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13288"
FT                   /db_xref="GOA:P57659"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57659"
FT                   /protein_id="BAB13288.1"
FT                   /translation="MNYFTLFDLPRKFNIDKKLLSQNFYKLQLKFHPDLFINDSESKKK
FT                   IILEKSIQINKGYKTLKNFLNRAIYFLCLNGYEVKKETLLLKNNDFLIRYFSLYEQLDN
FT                   LKENNFNKKELNNLEQIIQKKIIYCKKKIELEFEKTRYKKVIKIISELLFFEKIKDVLK
FT                   KEYNIYLSQIN"
FT   CDS_pept        636239..638074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscA"
FT                   /product="heat shock protein hscA"
FT                   /note="BU605"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13289"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13289"
FT                   /db_xref="GOA:P57660"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="InterPro:IPR042039"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57660"
FT                   /protein_id="BAB13289.1"
FT                   /translation="MIFFKKKHDKKLLLGIDLGTTYSLAATVREKSVILLLDKKKRYLL
FT                   PSVVHYKKNKISVGWKALENITEDPTNTISSVKRLLGRSINFVKKKFPILPYLIEKDIH
FT                   EGIFFRTNFGNITPIDVSSHILKKLKKRAVLLFNQEIDASVITVPAYFNDFQKKETKKA
FT                   AVLSGINLIRLLNEPTAAAVAYGLQKLKKGIVLVYDLGGGTFDVSILNLNKGIFEVLAT
FT                   SGDSNLGGDDFDDALAKNIYKKSNLQNRCNDFFQTSLLQIAKSTKLKLTKYEKVEVHFF
FT                   DWKGYITREEFNLIIIDFIKKTLFICSDLLEEINLSVEQIKEVIMVGGSTRIPLVHTEV
FT                   SKFFKKDLLKSINPDQVVAIGAAMHVDMLFSSKNNTKNKVILLDVMPLSLGIEVMGGFV
FT                   EKIIFRNTSLPISKTKEFTTYKDNQTSILIHIVQGERELVKDCISLSRFVLRDIKPQKA
FT                   GLVRILVTFQVDTDGLIHVKILENYSSKEKKIIIDNNITLKNLNISQILKDSLKHSKDD
FT                   YYFRVKEEKKIECVRTLEILNKSLKKHLKLISKKELKKIKYTQEKLQKSIQEDDYFSMK
FT                   NNLQKLDEVSKNFFSLQLKNAIDCSSIKNILKENI"
FT   CDS_pept        638074..638409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx"
FT                   /product="ferredoxin 2fe-2s"
FT                   /note="BU606"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13290"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13290"
FT                   /db_xref="GOA:P57661"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR011536"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57661"
FT                   /protein_id="BAB13290.1"
FT                   /translation="MPKVLFLPHKILLPKSIECEAQTGETILTVALRNNIKLEHACEQS
FT                   CACSTCHCIIKKGFFSLSGWSEKEDDILDKAWGLQSESRLSCQAVIGKSDIEVEIPLYN
FT                   LNYTVEY"
FT   CDS_pept        complement(638406..639767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfgK"
FT                   /product="hypothetical GTP-binding protein"
FT                   /note="BU607"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13291"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13291"
FT                   /db_xref="GOA:P57662"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57662"
FT                   /protein_id="BAB13291.1"
FT                   /translation="MIPIIVLIGRTNVGKSTLFNVLTKTRDALVANYPGITRDRQYGYC
FT                   KLQSNKKIILIDTAGLDIKLNEIEKQAQAQTLIAIKEAHLILFLVNARDGLMPQEYEIS
FT                   KNIRKYQKKTILVINKIDGINEASKINEFYSLGFEKIQKISASHNQGINTLINRYLIPW
FT                   ISEKFKKKITENLYKDTELKKIAIKVAFIGRPNVGKSTLINGILKEERMITSNTPGTTL
FT                   DSISTPIKYNYENYTLIDTAGASKKKKKINDFQRFSIIKTLQTIEKSNVILLIIDASLQ
FT                   TCHQDLSLADFIIHSGKGIVVVVNKCDLFNSVELKKIKELIKSKLKFLYFSKIHFISAL
FT                   YKKGIFQLFKSIKESYEDSKRKISTSTLIKTMHIAIKKHQPPIIKGRRIKLKYAHLGSS
FT                   NPPKIIIHGNQVKYLSLPYKRYLINFFYKTLKIKGTPIQIQFKDNENPYVKNKN"
FT   CDS_pept        complement(639860..640441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfgM"
FT                   /product="hypothetical protein"
FT                   /note="BU608"
FT                   /db_xref="EnsemblGenomes-Gn:BAB13292"
FT                   /db_xref="EnsemblGenomes-Tr:BAB13292"
FT                   /db_xref="GOA:P57663"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR026039"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57663"
FT                   /protein_id="BAB13292.1"
FT                   /translation="MLNISKKNIIFFILFFLIISLILFNWKYFSLVNKENLESLKYEKI
FT                   IKKINKKKSKNLYEVENFIVQNTSIYGTLTALSLAKKYVECNNLDKALLQLNNSLKYTK
FT                   EENLKNLLKINIAKIQIQKNENNKAMNILETIQNHNWKNIIEHMKGDIFININNKKEAI
FT                   KSWKKSLFIEDSNASKEIINMKLNELKEQN"
XX
SQ   Sequence 640681 BP; 237522 A; 83822 C; 84757 G; 234580 T; 0 other;
     ttatccacag atttgttctt tactaataat aatagtaatt attatttttt atttttttta        60
     tttttttgaa tttaaacctt aaagaaaaga aaaagatctt ttttttaaga tattatgttt       120
     ttaagattaa catgtgttat cttgaataaa atattaatac tatttgaata tttttaaatt       180
     tttaaaaggt ttttatatgt ttaatttaag aaattttgat gtaatcgttg ttggagcagg       240
     acatgctggt actgaagcag ctatggcttc atcaagaatg ggttgtaaaa cattattgct       300
     cactcaaaaa atttcagatt taggtgcttt atcatgtaat ccagctattg gagggatagg       360
     aaaaagtcat ttagtaaaag aaatagatgc attaggtggt atgatggcta aagctattga       420
     ttactctggt attcagttta gaattctgaa ttctagcaaa ggtcctgctg taagatctac       480
     tagagctcaa gccgataaaa tcctgtatca tgagacagta aaaaaaatat taaaaaagca       540
     aaataatttg ttaattttag aagcagaagt taaggattta atttttaaaa attactctgt       600
     tgttggtgtg ttaacacaaa atgaaattaa tttctactct cgttcagttg tgttagcagc       660
     aggcactttt ttaggaggta aaatacatat agggttaaaa agttattctg ctggtagaat       720
     aggagataag tctgctatag atttatctgt tcgtttaaga gaattgtctt tgcgagttaa       780
     tagattaaaa acaggaacgc cgcctcgaat tgatatcaac actgttaatt ttaacaattt       840
     attaattcaa aatagcgata ctcctgttcc agttttttca tttatgggaa acgtttcaca       900
     tcatcctaaa cagataccat gttacctcac acatactaat gaaaaaacac atgaaataat       960
     acgtaaaaat ttagataaaa gtccaatata tacgggtttt ttaaaaggtt taggacctcg      1020
     atactgtcct tctattgaag ataaaattgt acgttttcca gatagaaaat cacatcaagt      1080
     atttttagaa cctgaaggat tatctagtat taaagtatat cctaatggta tttcgaccag      1140
     tcttccaata gaagttcaag aacaaatagt agcgtctata aaaggtttag aaaaatccaa      1200
     aattatcaga cctggatatg ccattgaata tgattttttt gatccaaaag acttaaattt      1260
     aactttagaa agcaaattaa ttaaagggtt attttttgcc gggcaaatta acggaactac      1320
     tggttatgaa gaagcggctt cacaaggatt gttggcagga ttaaatgcag cattaagttc      1380
     aaagaatact gaaggatggt ttcctagacg tgatcaagca tatttgggtg ttttaataga      1440
     tgatttaact actcaaggca cagaggaacc ataccgcatg tttacttcac gtgccgaata      1500
     tcgactttct ttaagagaag ataatgcaga tttacgttta actgaaattg gtcgtaaact      1560
     tggtttagta aatgattcaa gatggattcg ttataatcaa aaagtattga atattcaaac      1620
     agaaatgaat cgtttaaaaa aaaataaaat aagtcctata tcaccagatg ctgatatttt      1680
     aaaaaaatta tataatatta atttaattaa agaaataagt atgtctgaat tattaaaacg      1740
     accgcaaatt agatatcaag acttacaatc tctagaatct tttagaacag gaattgttga      1800
     tttggaagcg ataggacaga tagaaaatga gattaaatat gcaggttata ttaaacgaca      1860
     atcagaagag atcgagcgac atttaaaaaa tgaaaatact ttcttatcat ctatttatga      1920
     ttataacaaa ataagaggtt tatcttctga ggttgttaaa aaattaaatg attacaaacc      1980
     catttctatt ggtcaagcat cacgtatttc tggaattaca ccagctgcta tatcaatttt      2040
     attaattcat ctaaaaaaag aatcttataa acatactttg tagattacaa aatgattaat      2100
     tttttagttt tcaaatcatt ttttataatt tttaaaaatt aaaatttgat tttaatgtat      2160
     ttaaaataca taataattgt ttaaatttga ttttattgct aaatggtaac tgtttgctga      2220
     atgtattttt tttgttgtat aatctttttt aaaattataa aaatatgaga gaaacatatg      2280
     attttagaaa agatatctga tcctcaaaaa tatattagtc atcatttaag tcacttgcag      2340
     atagatttgc gttcttttaa aattattcaa ccaggtgcat tgtcttctga ttattggact      2400
     gtaaatgttg attcaatgtt tttttctctt gtactgggta gttttttttt aagtattttt      2460
     tatatggtag gaaaaaaaat tactcaaggt ataccaggta aattacaaac tgcaattgag      2520
     ttaatttttg aatttgtaaa tttaaatgta aaaagcatgt atcaaggtaa aaatgctctt      2580
     attgcacctt tatcattaac agtatttatt tgggtttttt taatgaatct aatggattta      2640
     gttccgattg atttctttcc atttatttct gaaaaagtgt ttgaattacc tgctatgcga      2700
     attgtacctt ctgctgatat taatattaca ctatcaatgt cacttggcgt gtttttttta      2760
     attttatttt atactgttaa aattaaagga tatgtaggct ttttaaaaga acttatttta      2820
     caacctttca accatcctgt attttctatt tttaatttta tattagaatt tgtgtcattg      2880
     gtctcgaaac ccatttcttt gggattgcga ttatttggaa acatgtacgc aggtgaaatg      2940
     atttttattt taattgcagg tttgctgcca tggtggacac aatgtttttt aaacgtaccg      3000
     tgggctattt ttcatatttt aataatttca ctacaggctt ttatttttat ggtattaact      3060
     attgtatatt tatcaatggc ctctcaatct cataaagatt aaaatctatt gtgatttttt      3120
     taaaaactgg agtttctaat ggaaaattta aatgttgaca tgctttatat agcagtagct      3180
     ataatggtgg gattagcatc aattggagct gcaatcggaa ttggaattct gggcggtaag      3240
     tttttagagg gagccgctag gcaacctgat ttagttccat tattaagaac acagtttttt      3300
     gttgtcatgg gattagttga tgcgattcca atgattgctg taggtttagg attatatatg      3360
     ctttttgcta tttcataatt tttttactat aattttttat aaaaaacata ttattttaga      3420
     ttattacata aaatctttac gtttttttag ataacgtaaa gattaatttt catattgata      3480
     taaaaggtgg attctcgtga atcttaatgc gacaattctt ggacaagcta tttcatttgt      3540
     tttatttgtc tggttttgta tgaaatatat ttggcctcct attattttag ctattgaaac      3600
     tagacagaaa gagattaaag aatcattaac taatgcaaaa aaagctcggg atgaattata      3660
     tattctcgaa aaaaaaatac atcaaaatat tattgatgcc aaacaaaaag catcgaatat      3720
     tttaaattca gcaaataaac aaaaagtgtc aattttagaa gatgcaagaa atcaggcgtt      3780
     agaagaaagt aaaaaaatta tcctgaatac tcaatcagaa attaatattg ctattacaca      3840
     tgcacgtaaa aatttacata aagaagtagt agatttatct atttctatgg cagaaaaaat      3900
     tatcaaaaaa aatatttcta aagatgataa tcaagagttg ttagatgaat tagttacttc      3960
     tttatcacag gtgaaaaatt aatgtcagta gcagatacta ttgctagacc ttatgctcaa      4020
     gcaatttttg aaattgccat tgagaataat acaattgaaa aatggaaaaa tatattaatt      4080
     tttattaaaa ctattgcttc gcataaaaaa tttaaaaatt ttttgtcagg ttctatttca      4140
     cctaaatatt tatcgttaat atttatcaca attggcacta atataattga tgaaaacgca      4200
     aaaaatttaa taaaattatt atctgaaaat caacgtttta atatattaaa taatatattc      4260
     gaacgatttg taaaattaga agcatgttat aaaaacatca taatagttca attgaaatca      4320
     gcattttctt taaaagaaaa tctcattaac aaaatacgaa aagtattaga acggttcttc      4380
     ttaaaaaaaa ctaaaattat atataaagta gatcctaata tacttaatgg tatgattgta      4440
     aaggtgaata atactatttt tgatttatct gctcaaaatc atcttaaaca attatctgat      4500
     tctttaaatt tttaagagaa taaaaatata tgagattaaa ttctacagaa atcagtaaat      4560
     taattaaaga aagaatagcg caatttgaag tttttaatca atcatacaat gaaggctcta      4620
     ttatttctgt aagtgatggt attataaaaa tcaatggtct ttctaacgta atgttaggtg      4680
     aaatgatttt attgcctaat aacgagtatg caattgcttt aaatatagaa agggatacag      4740
     ttggtgctgt agttatgggt ccctatattc atatttctga aggagctaaa gtacggtgta      4800
     cagggaaaat actggaagtg ccagtaggtg ataatttttt aggtcgagta gtaaatgcat      4860
     taggttttcc tattgatgga aaggattcca tacaaaatga tggttttttt ccagtagaag      4920
     ctgatgctcc tggagtaatt gaccgaaaat cagtcaacca gcctatacaa acaggttata      4980
     aagttatcga ttcaatgatt cctatcggac gaggtcaacg tgaattaatt attggtgata      5040
     gacaaacagg aaaaactgca ctagcaatag atacaattat taatcagaaa caatctggta      5100
     ttaaatgtat ttatgtcgct attggacaga aactttccac aattattaat gttgttaaaa      5160
     aattagaaga aaacaacgct ttatttaata caatcatagt agtagcttct gcttcagaag      5220
     ccgcatcctt acaatattta gcaccatatt ctggttgtgc tatggcagaa ttttttcgaa      5280
     ataaaggaga agattcttta attatttatg atgatctttc aaaacatgca gtagcttatc      5340
     gtcaaatttc tttattattg cgcagaccac caggaagaga agcatttcct ggagatatat      5400
     tttatctaca ttctcgttta ttagaaagag cctctcgagt ctctatggag tatgtacaga      5460
     aaataaccaa aaataaaatt actggaaaaa caggatccat tacagctttg cctattattg      5520
     aaacacaatc tggagatgtt tctgcttttg ttcctactaa tgttatttct attaccgatg      5580
     gtcaaatttt tttagaatca aatttattta attcgggcat tcgacctgct gtaaatcccg      5640
     gtatatctgt ttctcgtgta ggaagtgccg cacaaactac gattattaaa aaactctcgt      5700
     ctgggattcg tacggcatta gcacagtatc aagaacttgc tgcattttca caattttcat      5760
     ctgatttgga tgataccact agaaagcaat taaatcatgg tcaaaaaatt acagaattat      5820
     taaaacaaaa acaatattca cctatttcta tagccgaaca ggctcttata ctttttgttg      5880
     cagaaaataa ttttcttgat gatatttcta tagataaaat cactaaattt gaaaaagaaa      5940
     tattaattta tgctcataat tattattttg atttaatgga agaaattaat aaaacaggcg      6000
     attttaatat tgttataaaa gataaattta ttaaattaat taccgagttt aaaaaaaatc      6060
     aattttaaaa aaataactaa taagttaaaa agagaaaata gtgaccagca caaaagaaat      6120
     aaaaaacaaa atcgtgagtg ttaccaatac taaaaaaatc actaaagcga tggaaatggt      6180
     ggcagtgtct aaaatgagaa aaactgaaga aagaatgcga tcaggtcgac catattctga      6240
     tattattaga aaagttattg atcatgtgac acaaggaaat ttagaatata aacatagtta      6300
     cttggaagaa agaaaaacta accgtattgg catgattata atatctactg atagaggatt      6360
     atgtggtggt ttaaatacta atctttttaa acaagtatta tttaaaatcc agaattttgc      6420
     taaagtaaat attccgtgtg atttaatatt atttggttta aaaagtttat ctgtattcaa      6480
     actttgtgga agtaatattc ttgcgaaagc aactaactta ggagaaaatc ccaaattaga      6540
     ggaattaatt aattctgttg gaattatact ccaagaatat caatgtaaac gaattgataa      6600
     gatttttatt gcttataaca aatttcataa taaaatgtcg caatatccta caattacaca      6660
     attattacct ttttctaaaa aaaatgatca agatgcaagc aataataatt gggattattt      6720
     gtatgaacca gaatctaaac tgattttaga cactttgttt aatcgatata tagaatctca      6780
     agtctatcaa agcattttag aaaatatagc aagtgaacac gctgctcgta tgattgcaat      6840
     gaaaacagcg acggataata gtggaaatcg gattaaagaa ttacagttag tctacaataa      6900
     agttcgtcag gctaatatta ctcaagaatt aaacgaaatt gtttcaggtg catcagcggt      6960
     ttcaattgat taaaaattag tagaggtttt aaaataatgg ctactggaaa aatcatccaa      7020
     attattggtg ctgtcgtcga tgtagaattt aatcaagatt cggtacctaa aatatataat      7080
     gccttagaag tcaaaaacaa gcaatataaa ctgattttag aagtgcaaca acagttaggt      7140
     tcaggtgtcg tacgaacgat tgctatgggt tcatctaatg gtttaaaacg aggtttaatt      7200
     gttactgatc ttggacatta tatcaaagtt ccggtaggag aagcaacact gggtcgtata      7260
     atcaatgtat taggtgaaac aatagataat aaaggggcat taaaaaataa tcaatctgat      7320
     aaaattgaat attgggaaat tcatcgttca cctccaagtt acagagacca ggctagttgt      7380
     agagaaatat tagaaacagg aataaaagtt attgatttaa tttgtccttt ctcaaaaggt      7440
     ggtaaagttg gtttgtttgg tggagccggt gtaggtaaaa cagttaatat gatggaatta      7500
     attcgtaata ttgctgtcga acactctggt tattcagttt ttactggagt aggcgaaaga      7560
     actcgagaag ggaatgattt ttatcatgaa atgaatgatt ctcaagtttt agataaagtt      7620
     tctcttgtat acggacaaat gaatgaacca ccaggaaata gattacgagt tgcttttaca      7680
     ggtttaacta ttgcagaaaa atttcgtgat gaaggaaaag atgttttatt atttattgat      7740
     aatatatatc gttacacctt agcaggtact gaggtttctg ctttacttgg acggatgccg      7800
     tcagcagtag gttatcaacc tactttagca gaagaaatgg gtttactcca agaaagaatt      7860
     acttcaacaa aaaatggttc aatcacttct gttcaagcag tatatgtacc tgctgatgat      7920
     ttaacagatc cttcacctgc aacaacattt gcacatttag attctacagt tacattaagt      7980
     cggcaaatcg cgtctctagg aatttatcct gctattgatc ctttaaattc aaccagtcgt      8040
     caattagatc cttatattgt aggtgacgag cattatgaaa ccgcattagg agtgcagtcc      8100
     atattacaaa gatatcaaga attaaaagat attattgcca ttctaggtat ggatgaatta      8160
     gcagaaaaag ataaattatt agtatctcga gcacgtaaaa tacagcgatt tttatctcaa      8220
     ccattttttg ttgcagaagt ttttactggt tttccaggaa aatacgtttc tttaaaagac      8280
     aatattcgtg cttttaaagg tattatcaaa ggcgaatttg atgatttacc agaacaagca      8340
     ttttatatgg taggttctat tgaagaagtt atagaaaaag caaaaaaatt ataatttttt      8400
     tggatgtaca ggatatattt atgaattttt atttagatgt agttagttta acaaagacta      8460
     tattttctgg atttgtagaa aaaattcgag tttctggaag tgaaggagaa ctcggtattt      8520
     atccaggaca tgctcagttg ttaagtatac ttaaaccggg aatggtatac atttttcata      8580
     agaaagataa aaaagaagaa tgtatttata tatcaggagg aatattagaa gtgcaacctt      8640
     ctgttgtatc tattttagct gatgttgcta ttcatgctat tgatttagat cgaagtcgta      8700
     ttttaaaaac aaaaaaaaat gcggaagaat ctattaaaag taacaataca aaaattaata      8760
     aagatgctat tttattgcaa atttctaaag aaattgcaaa attaagagtg cttgaagtaa      8820
     tggataaatt taaatgaaaa ataatctttc gcggctggtt ttttcctgcc gcaagtacta      8880
     aaaaatttat tctaagaata aaaaatattt ttaaacgtca atattttctg cttttaaagc      8940
     attattttct ataaattgtc ttctaggttc aaccgcttct cccattagag tattaaataa      9000
     attatttgca gaaactgcat ctttgatagt tacctgtagc atgtttctgg tttcaggatt      9060
     cattgtcgta ttccataatt gttctggatt catttcacct aatcctttat atcgttgtat      9120
     aaacaagccg cgtttagatt gttttattaa ccatttccat gtatttttta tactatctat      9180
     tttataagta gacccagatt tttctatcaa aactttatct gaaaaatatt ttttaaaact      9240
     ttcacctaaa ttagtaatta ataaatattc tttgcttttt aaaaattctt ctttaaaatc      9300
     atattttgta taatgtgcat atctagatat ttttatagtt ggttcgaata tatttttatc      9360
     taaattttct ttaatttcta ttgaatagtg attattactg ttatcttttt tatttagatt      9420
     ttcagccaat gtgtatatcc attcttttac tatttcgata tcttttaaat tgtgtaaatg      9480
     attgtggtag attaattcat taaatactaa ttttggaaaa tagtgtttgc tttgtttcat      9540
     aattatttga atataatgat attcagacat aattttttta aattttttaa gtttttgatt      9600
     aataataaga ttatcttcac tttttaaaac aagatctttt aaagcatttt taatttgata      9660
     tgtattcatt tcttcatcat ttttaatata tttttctttt cttccttttt ttaatttgta      9720
     taatggaggt tgtgcaatat aaacataccc tttttcaatt aactcaggta gttggcgata      9780
     aaaaaaagtt aagagaagtg tacgaatatg cgcaccatct acatcagcat cagtcattat      9840
     aataatataa tgatatctta atttatctat attatattca tttttaccaa tcccgcatcc      9900
     taacgcagtg ataagagagg caacttcttg tgataaaatc attttatcga acttggattt      9960
     ttcaacattc aatatttttc ctttaagagg aagaattgct tgattttttc tgtttctgcc     10020
     ttgtttagca gacccacctg ccgaatcacc ttctactaaa taaatttctg agaatttagg     10080
     atcattttct tggcaatcag ataatttccc aggcagtgca cctaaatcta atatactctt     10140
     ttttttgttg atttctcttg ctcgtcgcgc tgcttctcta actttagccg cattgatgat     10200
     tttttgaata ataaattttg agtcagacgg attttctaaa agatattcaa tcaggttttc     10260
     attaattaat gattctatta ctgacctcgc ttcagaagaa actaatttat ctttggtttg     10320
     cgatgaaaat tttggatcag gtattttgat tgatataata gctgttaatc cttcacgtac     10380
     atcttcacct attatagtag ttttgttctt tttattatag ccttctcttt ctatatgtaa     10440
     atttaatgtt ctcgtcatac cggaacgaaa tcctgctaag tgtgttccgc catctttttg     10500
     tggtatattg ttagtaaaac ataatatatt ctcttgatga gaattattcc actgcatagc     10560
     aatttctagt tctatttgat cttttgtaga tcgaaaataa aatatatgtg tatgaatagg     10620
     tgtctttttt gcatttaaaa atttaataaa tgctttaatg ccacctttat aatgatagca     10680
     atttttaatg ctagttctat tatcttcgag ataaatagca atgtttgaat taagaaaaga     10740
     gagttcacgc aaacgtttag ataaaatttc atattgaaat tttatattat ttgtaaaagt     10800
     tttataacta ggccaaaatc ttatatacgt accagttgtg tcagttgttc caatgataga     10860
     aagaggattt tctggttttc catgtctgta tatttgttga tattttttct tatttttgtc     10920
     tattattagt tctaattttt ccgataaagc gttgacgact gatattccta caccgtgcaa     10980
     tccacctgat atttgatatg aagcattatc aaatttgccg cctgaatgta atactgtcag     11040
     aataacttct gccgctgaaa tgttttcttc aggatgaata tctgtaggta ttcctctacc     11100
     atcgtctttt actgaaactg aattgtctga atgaatggtt actattattt ctttgcaata     11160
     accagacagc gcttcatcta ttgagttatc tactatttca aaaaccatat gatgcaatcc     11220
     actaccatca tctgtatctc caatatacat acccggtctt ttacgaacag catctaatcc     11280
     tcttaaaatt ttaatattag aagagtcgta tatatttttc ataactttcc ctataatttt     11340
     tttaagtaaa ataattatta aaattattat attattttta tgtaaaaaaa taatattgaa     11400
     attattttac attatttatt atattctata atgcaggttc gaaaatattt aacgttttaa     11460
     taacattaca acatacaata ttgatgcatc attttctgct tcaatttgta ttgaattatt     11520
     agcattattt aaaaataaaa aaatattttc gctagtaata gaatttaata tttctattat     11580
     gtagtacaca ttaattgata tttttactgt atttccagta taatttatat taaatctatc     11640
     ttctgctatt tcttcttctt gattatcaga taatacttta aattgaccat ttctgatatg     11700
     aatttctact ccacaaaatt tttcatggga taaaatagca gctcgtaaca atgattgctt     11760
     taatagtttt gaatttaaag taataaaatt gtttttattt tcaagcaaaa cactcttata     11820
     atcaggatat tgtccttcaa ttaattgtgt tgtaaatata agatcttcta tatgtactct     11880
     aatattattt tttccaacta aaacttttat tggttgtttt ggaatattta ataatctata     11940
     tagttcaata acgccttttc ttggaataac tattgaaaaa ggaattatat tttcttttaa     12000
     aaaaaatttt gatattccta gacgatatcc atctgtggct actgcataaa gtgatcgatc     12060
     tgttttttct aataaaatac cattaaggta gtatcgtaca tcttgtttag ccatagaaaa     12120
     ttgaattttt tctatcattt tttttaaaat atctgaaggt ataaaaaatt ctgaaatatg     12180
     atgaaagtca tgatgaactg gaaaactatc ataaggtaag gtggttaata tataacgact     12240
     atttccagaa ataatatgca ttttattatt gtttaattgc atctctatat ttgatgaatt     12300
     taatgaattt ctgcaaatat ctaaaagttt tcggcctgaa atcgttgcag ttcctgatat     12360
     gtgttctgtt gatagttgaa tcatagcaac taattctatt tctaaattcg tccctgttaa     12420
     tgataacatt ccgtttttta tatttattaa tacattatct aaaataggaa gagaagtatt     12480
     ttttacaagc aaccgactta ttttttgtaa atttttaatt aaaatattat tattgataat     12540
     aaatttcata tgatcacttt gatagagttc taattaaatt taaaaaatct tttttaatat     12600
     cgtgattttc ttttcgcaat tgttcgattt tacaacatgc atgcagtact gttgtatgat     12660
     ctctgccact aaaagcttct cctatttcag gcaaactatg attagttaat tttttcgcca     12720
     tagccattgc catttgtctt ggacgagcta ttgaacgtga acgttttttt gataatagat     12780
     cagaaacttt aattttatag tattttgcta ctgttttttg gatattatca atagtgataa     12840
     ttttttcttg tacagcaagt atatcttgaa gtgcttcacg agcaaaatct acagtaatag     12900
     cacgatgggt aaaacgagaa ttaagaataa ctcgatttaa agcaccttct aattcgcgta     12960
     cattagatcg taaatgttta gcaataaaaa aagccacttc attagataat atgacgttat     13020
     tttgatcagc tttttttata agaatagcaa ctctagtttc aatttctgga ggatcgatag     13080
     caattgtgag accccagcta aatcttgatt ttagacgatc ttcaactccg tttatttctt     13140
     taggataacg gtcagaagtt aatatgattt gttgatttcc ttctattaaa gtattaaatg     13200
     tatgaaaaaa ttcttcttgt gaacgttctt tatgtgcaaa aaattgaata tcatcgatta     13260
     atagtgcatc aacagaacga taatacaatt taaatttttc aatagcatta ttttttaatg     13320
     cttttaccat gtcttgtaca aaacattcag aattcataaa aatgatttta atatcatact     13380
     tatatgataa aatttcattt cctatagcat gaagtaagtg agtttttcct aatcctgttg     13440
     caccatataa gaataatgga ttataagaat ttccaggatt tcttgcggct tgaaatgctg     13500
     ctgaacgtgc aagctgatta gattttcctt ctacaaagtt ttgaaaatta tatcttttat     13560
     taatattaga tcgataagac aaatttttga attttggaat attggaccag attagctttt     13620
     catttttatt attattatta ttttcaatgt ttttttttaa tttgttttct ttataaattt     13680
     gataaatttc aaattttatt aatggagaat tagtaccgca ataatcttgc agtatttttt     13740
     ttaaatgatt taagtatttg tctttcaccc attccaaaac aaatttattt ggcgcatata     13800
     tttctagaat gttattgttt agtttggcct tcagagagcg tatccacata ctaaactctg     13860
     tattcggtag ctcatcctgc aaccggtcaa gacactgttt ccaaagacaa agtgacacgg     13920
     tagactccaa gcgaacacaa tcaataaaaa aataaacttt gaaaagttat tgtttttcat     13980
     acgtttactt tgatatatat aattttatat aatttttttt atatgaaatt atgtttttta     14040
     tattaaaagt tatacaatct aagattggcg agtataacga aaaggatata atatattgtt     14100
     aagatatttt ttatctcaag aagtgatttt taaatgtact gtcattttta taaaaaaaca     14160
     taattatcat accagaatac aaaattaaaa atattttttt agatcagttg atatcgaatg     14220
     tattttaatt gataaaaatt tttataatat tttttataat caatgattta aataaagtta     14280
     attgactata gcatttagaa taattaatct tattaaacgt gaattttata aattatattc     14340
     aacaaaaaat agtaaggtaa atattaaaat gaaacgaact tttcaaccat caatattaaa     14400
     acgtaatcgt tcacatggat ttagaattcg tatggcaaca aaaaatggtc gttatatttt     14460
     atcacgaaga cgtgctaagt taagaacacg tttaactgtt tctagcaaat agtaggttaa     14520
     tattttgttg aattattttt ttaaaaaaca attacgatta tctgactcta caagttttca     14580
     agatgttttc aatggatctg taaaaaaaaa aaatacttta gaaataagta ttttaggacg     14640
     ttttaattta ttaggacatc ctagattagg tcttagcata cctcgaaaaa acattaagca     14700
     tgctcataat cgaaatttga ttaaacgatt agtgcgagag acttttcgtt tattacaata     14760
     caaattactt tcaatggact ttgtagtgat agcaaaaaaa aatattctct ttttaaataa     14820
     tacaagaata atagatatgc taaatagttt gtggtctaat tattatagat aataatattt     14880
     tttattctat atattataaa tacattatct attttaaata tgattaaaat aattttatgt     14940
     caattgaagt agtacccttt aaatatagtt atttaactgt gaatattaga gataaaagtg     15000
     aatattaatt atggaagtac aacgtaattt ttttattttt gcttttttat ttgtttcttt     15060
     tctactttgg caggcatggc aaagtcaaat gtttttaaat aaaaaaacaa atgaaaaaat     15120
     agatccaatt tttcatttta ttgatgtaaa aaaaaataaa aagaaaattt ttatcaaaaa     15180
     tgatgtaatt agtttagttg ttaatatgta tggtggtgat gtagaagagg catctttact     15240
     cgcatacaag gatacattat attcatctag accttttaaa ttacttgaaa ctggatcgga     15300
     ttttatttat caggcacaaa gcggattaat tggaaaagat ggacctgata gttcaataaa     15360
     tgatagtaga ccattatatt ctgctaataa aaattttttt gtattaggac ctaacgaaaa     15420
     agaattgcgt gttcctatca aatggttaag taaaaatggt gtaatttata aaaaaacttt     15480
     tattcttaaa ccaaatagat atgatgttca aatagagtat gacgtctata atccaagcaa     15540
     agaaagtttg aatatgaata tatttggaca aataaaacaa acaatcaatt tacctaaaaa     15600
     acgtaatgtt tatagtggaa attttgctct tcaaactttt cgtggtgcag cttattcaag     15660
     tgatgataat aaatatgaaa aatataaatt tgatatgatc gctaataata aaaacttgca     15720
     tattatgact gaaagtggat ggatagcaat gctacaacaa tattttgctg ttgcttggat     15780
     tcctgataat ttaggtaaaa atacaatata tacatctagt ttagatcatg acacagcggt     15840
     aattggatat aagtctccta taattaatat tccacctaat tctagatcga ttataaaatc     15900
     aaagttatgg attggtccga aaatacagaa agaaatgaaa ttagttgcgc caaatttaga     15960
     tttaacagtt gattacggtt ggctttggtt tttatctcaa ccattattta aattactaac     16020
     tattttatat agtattatag gaaattgggg tttttctatt attttaatta cttttattat     16080
     gagagggtta acttatcctt taacaaaagc gcagtatatt tccatggcaa aaatgcgtgc     16140
     gttacaacct aaaatacagg aaataaaaga aaaattttca aaagataaac aacgtattag     16200
     tcaggaaatg attttgttat ataaaaaaga aaaaataaac cccttaggtg gatttttacc     16260
     tatttttatt caaatgccaa tttttctatc tctttattat atgcttatag gatctgttga     16320
     attacgtcat gctccttttt tattgtggat tcatgattta tcgagtcaag atccttacta     16380
     tgtcctgcct gtgataatgg gtttaacaat gttttttatt caaaagatat cttctactaa     16440
     tcatatttct gatccacttc aaaaaaagat tatgaatttt atgccggtga tttttactgc     16500
     gtttttttta tggtttcctt caggattagt tttgtactat ataattagta atttagtcac     16560
     tattatacaa caaaagttta tcttatctaa cttagaaaaa aatagataaa attgtttgat     16620
     ttttgatata tataaagaaa ataatttatg atgcgtaatg aaactattgt cgcccaagtt     16680
     acctgtccag gaaaaagtgc tgttggaata ttgagaatat ctggttttca gacaaagata     16740
     gttgctataa aaattttagg taaaattcca ctagctagat ttgcgactta ttcaaacttt     16800
     ttagatgaaa ataatgaaat attagataaa ggaatatctt tatggtttcc tgctcctcat     16860
     tctttaacag gtgaagatgt actagaatta caaggccatg gtagtccatt aataatggat     16920
     ttactaataa gaaggatttt gtctattaat aatattagaa tggctaaacc aggggaattt     16980
     tctgaacgtg cttttttaaa tggaaaaatg gatttaattc aagcggaatc tatagatgat     17040
     ttaattaatt cagaaacaga attatccgct cgtgcttcat taaattcatt acaaggaaaa     17100
     ttttcttttt ttattaaaga actgatgaat ttgattattg aatttcgtat taatatagaa     17160
     tcaaatatag acttttcaga agaagaaatt aatattaata tgcaggatat aattaatata     17220
     aaatttcgag aactacatga taaatttttg aaattaaagg ctacagtttt aaaaggaagt     17280
     ctcttaagag aagggaaaaa aatcgtaatt gctggacttc ctaattccgg gaagtctagc     17340
     ttattaaata ttttatcata ttctgataga gctatagtaa ctgatatacc tggtactaca     17400
     cgagatcttc tatatgaaga tatcagtatt aatggtgtta gatgtgaatt aattgataca     17460
     gcaggtctgc gtgatacaga tgataaagtt gaacgtattg gtatcatgcg tgcttgggaa     17520
     atgattagaa aatctgatca tgttcttttt gtaattgata agacacttag taaatcaaaa     17580
     caaaaaaaaa tatgtgatga ttttatgaaa aatattttaa acaataaaac tcaagtaaca     17640
     tttgttttaa ataaaaacga tttaataaaa gatgaatttg gtattaaaga aatagatgga     17700
     acggcattta ttagtatatc agcacgtaca ggtgagggtg ttaatatttt acgtgaacat     17760
     ataataaaaa ttgaaaaaaa tataaataat gaaagtgttt tcattgctcg tcgtcgtcat     17820
     atcaaacaac ttgatttagc gtacgatgag tttttaactg ccgaaaatac atggagagag     17880
     tctgagaata ttgaattact agcagaatct ttaagtatta taagtaagtt tttaggcgag     17940
     ataataggtc agtgtacttc tgaagactta ttaaatcata ttttctcaag tttttgtatt     18000
     ggaaaataaa ttttaaaaga acaaaatttg cccggaggcg gaattgaacc accgacacgg     18060
     ggattttcag tcccctgctc taccaactga gctatccggg ctttttttat attaaatcat     18120
     caaatgtaaa atgttgtcaa tgttttttat tgtaaaaatt ttttatattt atattttatt     18180
     gtttttttaa aaaaaattac ttttttaaaa tattttaaaa tataaacttt cttaaataaa     18240
     aaaataaaaa aataattttt acccttgaaa gttttaataa atatccctat atttaaaata     18300
     agagaaaaat attaaattaa taaaaaataa ttttttaaaa taatctagaa agattattta     18360
     caggagcatt atcatatgaa aattcgtcca ttgcatgatc gtgtgcttgt taagcgtcaa     18420
     gaagtcgaat caaaatctgc aggtggtatt gtattaacag gatctgctgc agggaaatcg     18480
     actcgaggaa cagtgacagc tgttggaaaa ggtcgtgttt tagataatgg agacattaaa     18540
     ccattagatg taaaagttgg tgatgttgtt atttttaatg aaggttatgg tgcaaaaaca     18600
     gaaaaaattg ataacgaaga attattaatt ctaactgaaa gcgacatttt agcaattgtt     18660
     gaatagtaaa ccacatgcta tatccattga aaaattgatt taaggggatg tcaaatggcc     18720
     gctaaagatg taaaatttgg aaatgaagcc cgcattaaaa tgcttcgtgg agttaatgta     18780
     ttagcagatg cagtaaaagt gactttagga ccaaaaggta gaaatgtagt tctagataaa     18840
     tcttttggag cacctagtat tactaaagat ggtgtatccg tagcccgtga aattgaatta     18900
     gaagataaat tcgaaaacat gggagctcaa atggtaaaag aagttgcatc aaaagcaaac     18960
     gatgcagcag gtgatggtac cacaacagca acattattag cacaatctat agtaaatgaa     19020
     ggtttaaaag cagtagcagc tggtatgaat ccaatggatc tgaaacgtgg aattgataaa     19080
     gctgttatca gtgctgtaga agaattaaaa catttatctg taccatgttc tgattctaaa     19140
     gcaattacac aagttggtac tatttctgca aatgcagatg aaaaagttgg ttctttaatt     19200
     gcagaagcaa tggaaaaagt tggtaatgac ggagttatta cagtagaaga aggtacaggt     19260
     ttacaggatg aacttgaagt tgtcaaaggg atgcaatttg atcgtggtta tctatctcca     19320
     tattttatca ataaaccaga aacaggtatt gttgaattag aaaacccata tattttaatg     19380
     gctgataaaa aaatatctaa tgttcgtgaa atgttaccaa tattagaatc tgttgcaaaa     19440
     tcaggaaaac cactattaat tatttctgaa gatttagagg gtgaagcttt agcaacttta     19500
     gtagttaatt caatgagagg aattgtaaaa gtcgcagcag taaaagcacc tggatttggt     19560
     gatcgtcgta aagcaatgtt acaagatatt tcaattctta ctggtggttc tgttatctct     19620
     gaagaattag ctatggaatt agaaaaatct actttagaag atttaggaca agcaaaacgt     19680
     gttgttatta gcaaagacac tacaactatt attggtggtg taggagaaaa acactccatt     19740
     caaagtcgta ttagtcaaat ccgacaagaa attcaagaag ctacttctga ttatgataaa     19800
     gaaaaattaa atgaacgctt agctaaacta tcaggcggtg ttgcagtact aaaagtaggt     19860
     gcggctacag aagtagaaat gaaagaaaaa aaagctcgtg ttgaagatgc attacatgct     19920
     actcgtgcag ctgtagaaga aggtgtagtt gctggaggtg gtgttgcatt agtgcgtgta     19980
     gcagggaaaa tagctgattt acgtggtcaa aatgaagatc agaacgtagg tattcgagtt     20040
     gctttgcgtg caatggaagc tccattacgt caaattgttt ctaattctgg tgaagaacct     20100
     tctgtagtta caaacaatgt aaaagacgga aaaggtaact atggttacaa tgcagctact     20160
     gatgaatatg gtgacatgat agattttggt atattagatc caactaaagt tacacgttct     20220
     gctttacagt atgctgcttc tgtcgctggt ctaatgatca caacagaatg tatggtaact     20280
     gacttgccta aagaagataa atcttctgat tctagttctt ctccagcagg aggaatgggt     20340
     ggcatgggtg gaatgatgta ataaaaagtt tattttatta caattttttg aaacaatttt     20400
     aaaaatacct ttcctcagaa tcactattct gaggaaattt tttatgttct ttgaatatag     20460
     aaattatttt acttttgaaa taaatgatta gaatcttgtt ctaataacgt ttaaaaataa     20520
     tcagcactat tttctaatat tgaatatata aaaatatttt tatgtaaaaa aaaatctcta     20580
     aatttttttg aatcagtatt attaaatact ttaatagtaa aattacaatc aataaaacaa     20640
     tagtaccttt tttaatttat aaaaataact catcaaatag tattttattt ttttgatact     20700
     aaacatcatt taaggtgata attttagaag gagctaaata catattaaag atttatatat     20760
     agaggtgcta taacgatcat ctattttaaa ttttttatat ttttttataa aacttggatt     20820
     caaaatgtaa ttgtaggtat tttatatgct tatataatga tttttttaaa aattatattt     20880
     agcatttaaa atattatttt cttatataga agactatact ttactttatt tgtgtattat     20940
     atttttatgt tagaatatat tttacttagc aacataaatt aataatgtta tataatcaga     21000
     aatcttttca tataaataga ggttgtatga gaatatatca tagtaataat tttcgttcag     21060
     gtcgtaaaat tattttcgaa aacgagccgt gtttgataga atctagtgaa tttgtaaaac     21120
     ctggaaaagg tcaatctttt gttcgtgtaa aattgagaaa attattaaca aaacaactta     21180
     tagagaaaac atttaaatct acagattctt tagaaatcgc tgatattata gaatatacac     21240
     tttcttattt atataatgac ggtcgttttt ggtattttat aaataataat acttttgagg     21300
     agttatcagt agatgaaaaa attattggag tacataaaaa atggttatta gaacaagata     21360
     catgtattgt aactttatgg aataatcaac ctatctcaat tacacctaat aattttgtca     21420
     atctaaaagt catacatgtt caagcaactc taaaaggcga tactattaat actagtagta     21480
     ctaaattagc tacattaagt acaggtgcta ttgtaagagt cccgttgttt attcaagttg     21540
     gttcattaat taaagtagat acaagatcgg gtgaatatgt atcgcgaata aaatagaaaa     21600
     atttttttat atattagtat tcatttccct taacatattg tctgtaacta tcccattcaa     21660
     aagttaacca taaactattt cctaaacgca ttctatcaat gactctttca cctaataaac     21720
     ttttcattcc tttatgatct aaattagaca acattccagt agaacgtttt gaagatgatc     21780
     ttctatcaac tatttgatta ataattactt tttcgtaacg agattcagtt tgcataccaa     21840
     tttcatcaat cattaacaaa tcgacgctgc ttagatcatg taataaattt tcttcagtga     21900
     tattactagt cccactaaac gttcctttca tattagacat taaatcagct actgttacaa     21960
     gtaaaatgct ctttccatgt aaaattaagt aatttcctat agcagatgcc aaatgatttt     22020
     ttcctgttcc gggtttacct gaaaaaataa aactagcaat attttcatta aattcttctg     22080
     catagcgttt cgatgctttt agtacttttc tttgaccatc atgttcgatt ttataattgt     22140
     caaatgaaca gttcatatat aattctcgaa tacctgatct gcctagtaca cgttgcattt     22200
     tcattgcttt attttcacgt attatagatt cagatgacaa tcttccttgt tcttgattcc     22260
     aagctaataa gtcttcatca ttatcaaatt taggtttaat atttttaggc ataagacgtt     22320
     gaagacgttt aaaaaattca gtataaaatg tcattattta cctctaaatc catttggtac     22380
     agtttgatcg ggtgttggaa tatatgtaat gtctcgtttt ttttgtgaca tgtaactaat     22440
     tgatctgctt ttttgtagac ttcgagctaa tttttgctgc cattgtatat gatgaaaaaa     22500
     acaaccttct gcttgccaat aagaaataaa agatgccagt tcagattcta atatttcttc     22560
     agtcaacgta atcccccata atgcagcttg acgaatgaaa tctttatctg gagtccattg     22620
     tggatgcata gaaaattttt ttgagatttg ttgttttgtt ttatctagat ctaacagatt     22680
     acattcaaga tcaaatattt tttttaatat ataaggtgta attacataaa aaatagggga     22740
     tttatttttt aatactccta taattccttt gtttgatttt tctaaaattt ttatgggatt     22800
     tttacaaaat aattcaagag atatattatc ggaaattaaa atcttcataa gtatttcact     22860
     gtatttaatt ttttaaaatg tttacgtata ttgtatatta tcggactttt taaaacaaaa     22920
     tattattatt cttattgatt gatcttatgt actgcaaata tatagatagc attgtatttg     22980
     atttgtaatt ttttttttat atagagtcca attttttggt acaattatgg attgtttttt     23040
     ttcttgttct atataaataa aagaattttt tttaatccat tttttatttt ctagtaaatt     23100
     aatagttttt ttaactaatc cttgatgata aggaggatca ataaaaatta tatcatatgg     23160
     tttgtttcta gtttttttta accaatgcag cgtattagta cgtataattt ctacattgta     23220
     tatgtttaac tcttttatat tttttttaag agtaagaaat gttttttttt ctatttctaa     23280
     taaagttgaa aaggctgcat aacgagatat agcttctatc cctaatacac cactacctgc     23340
     aaaacaatca agacatcgag agtttttaat gtatttagat aaccattcaa atagtgtttc     23400
     tcttatttga ttagtagtag gacgtaagtt tggaatgttt ttaaaagata tctttcttcc     23460
     cttaagattt ccagaaataa tgtaaatttt actatttttt ctaaaaaaag aattgttcat     23520
     tttattaaat tatttatgtt agtgatataa tttatctaaa tattaacaac gacttaaaaa     23580
     tattttattt tttaatatta gatattttga gaaaaatagt tttgacttat aaagtaaaag     23640
     gcaaaataac atgaaagata gtaaaaaaaa tggttttttt tcttggttaa gttctaaaat     23700
     aaaaaaaaag aaaacaatag atattagaca aaataataca gataaaaatc atgatattaa     23760
     tcatgaagac ttatatacca agaaagatct tttaattaaa caagataatc ctaaaaaaga     23820
     tgaaatagat acacttaatg atcatggtaa agatatagag aaggcacaaa acacaaaaaa     23880
     taattttttt ttgcgtttga aaaaaagttt aaaaacaaca aaaaagaatc ttggtgataa     23940
     aatttatcaa atttttttat caaaaaaaat cgatgaagtt ctttttgaag aattagaaga     24000
     aaaaatgttg ttagctgata ttggaattaa taccactaat cgaattatta gtaatttaat     24060
     taaagatgtc aatcgtgaag atttaaaaaa ttctgaaaaa ttgtattttt tattaaaaag     24120
     aaaaatgttt aatattttaa aaaaagttga aataccttta gaaatatcta gtcatagtcc     24180
     ttttgtgatt ttagttgtag gagtcaatgg tacaggaaaa actacaacag ttgctaaact     24240
     tgcagaaaaa tataaactag aagggaaatc tatcatgtta gctgctgcag atacatttag     24300
     agctgcaggt atagaacaac ttcaaacatt aggaaaatta aacaatatac ctgtaatagc     24360
     acaacgttct ggttcagatc ctgcagcagt aatatttgat gctgtaaaat cagctaaatc     24420
     aaaaaaaata gatgttttaa ttattgatac agcgggtaga ttgcataata aattgcattt     24480
     aatagaagag ttaaaaaaaa tagttagagt aattaaaaaa atagatatat ctgcaccaca     24540
     tgaaaaactg ttaattattg attcatgtaa tggacaaaat acaatacaac aaacagaaat     24600
     attccataaa gcattaaatt taactggaat tataattaca aagttagatg gaacggcaaa     24660
     aggaggagtt gttttttctt tggctgatca atttcaaatt cctattcgtt atattgggat     24720
     tggtgaaaaa atgcaagatt taggtcattt taatagtcaa gaatttattg agtctatatt     24780
     tacatagaaa aggatattat tttaaaaata aaaatgttct attttttata aaatatagtt     24840
     taattatttt ttgtataaat ctttgattta tatttttaat taaagtacta taggtatatc     24900
     ccacatgttt ataattcagt atatatgatt cgttgatgcg ggaattaaaa tgattaataa     24960
     agtacagatt ttatctgtaa caccaccagg taatttagat gcttatatca gaatagctaa     25020
     tttatggccg atgctgtcaa ttgaagaaga aaaaaaatta accaaacgat tgcgttataa     25080
     tggcgattta gatgcggcaa aaactttaat tttatctcac ctccgttttg taattcatat     25140
     ttcacgtaac tattcaggat acggtttact gcaatctgat ctcatacaag aaggcaatat     25200
     aggattaatg aaagcagtac gtagatttaa tccagaaata ggcgtacgtc ttgtgtcttt     25260
     tgcagttcac tggattaaat ctgaaataca tgagtatgtt ttacgtaatt ggcgtatcgt     25320
     gaaagttgct actactaaat ctcaaagaaa actatttttt aatttaagaa aaacaaaaaa     25380
     aagattagga tggtttaatg aagaagaaat tcaaatagta gctagagagt taggcgttag     25440
     cagtagagat gtaagagaaa tggaatctcg aatgtccgct caagatgttg cttttaatcc     25500
     gtcacctgaa gagcattgtg atagtaaaac aaatagctct atacaatatt tacaagataa     25560
     aacttctaat tttgccaatg gagtagaaca agataattgg gaagaacatg ctgcgaataa     25620
     attaagtagc gcgttattaa gattagatga acgtagtcgt catattattc atgcgcgttg     25680
     gttagataaa aataaaaaaa ataccttgca gaatatcgca aataattatg gaatttctgc     25740
     agaacgcgta cgacaattag aaaaaaatgc aatgaaaaaa ttaaaattag ccatagaagc     25800
     ttaattaaaa atgacatttt taatacaaaa aaaatttttt attaaaaatt atttatatag     25860
     agtatgagac taagtttaat tcattcaaaa aactcatact cttttttttt agattaatga     25920
     aaatttttta tagattaata aattttattc tactgttacc gatttagcta agtgtctcgg     25980
     ttgatcaata tcccttcctt tttttaatgc aacataataa gcaaataatt gtaggggaat     26040
     tgtataaaaa ataggtgcta ttaattcttc tacatacgga agctttatag tatttatatt     26100
     ttcttcataa tcaaattctt gattagaaaa aacataaact attcctcctc tagaacatat     26160
     ttctttaata ttttttttat ttttctctaa tagagaattt tcaggagcaa tcataataac     26220
     tggtatattt ttatcgatta atgctagagg accgtgtttg agttctccag atggataagc     26280
     ttcggcatga atataagaaa tttcttttaa tttcaaagca ccttccattg caattggata     26340
     ctgattacct cttccaagaa agagcatgtt ttttttatta gctaatgtat tagccatatc     26400
     ttgtattaat tgtttttttt ttaaaatttc ttcaattcta acaggtaaaa tacttaatgt     26460
     ttgtacaatt ctttttgagg tattattgtt ttcttttttt gaatttatta ttttagcaac     26520
     taataaaagt aaaacagtca attgagtcgt aaaagatttt gtagaagcca ctcctatttc     26580
     taatcccgct ttagttagta tataaaaatc agattctctt actaaagatg aacttttcat     26640
     attgcatata gttagatttc ctaaatatcc aagtttttta gaatacctca atgcagataa     26700
     cgtatcagca gtttctcctg attgtgacaa agtaattaat aaactctttt ttcttacaac     26760
     tagttttctt gaagaaaatt cagatgcaat ttctacatca caaggaatat ttgcaagttc     26820
     ttcaaaccag tatcgagaaa ccatagcagc attataagaa gtaccacatg caactatttg     26880
     tatatgttct gtattataaa atatattatt ttcttttgat cctaattcag aaaaatgtac     26940
     tttattacta tttgttagac gattttttaa agtattacga attgatttag gttgttcatg     27000
     tatttctttt tccatataat aacggtactt tcccttcttt gctgatttgt attctatatt     27060
     agatactact tcttctcgtt gaattataga attattttta ttaaagatgt taatttcttt     27120
     tcttgcgaca atggcaatat cgccttcttc taagtatata aaacgttttg ttacatgcaa     27180
     taatgcaatt tgatcagaag ctataaaatt ttcttctgtt cctaatccta taattaatgg     27240
     acttccagaa cgtgctgcta ttaatttgga aggattattt tgatctatta ctaccatact     27300
     ataattacca tctaattttt ttatactatt ttgtataact tttatgaggg aatctttttt     27360
     tttgttttgt tcccaatgta ataaatgtgc aattacttct gtatcagtat ctgaagaaaa     27420
     tatatatcct tgttttttta aaaatccacg cagtgtggaa ttgttttcaa taattccatt     27480
     atgtacaaca ataatattag aagaaatatg tggatgagta ttctcttttg agactttccc     27540
     gtgagtagcc catcgagtat gagcaactcc aatactacca agtatttttt ttttatttgt     27600
     tttttttata agttcgttga cctttccaac acaacgaatt ctaacaatat tgtttttatt     27660
     atctattaca gccaatcctg aagaatcata tcctcggtat tctagttttt taataccatc     27720
     gataagaaaa ttggcaatat tacgttgtgt tactgcagca acaataccac acatattgat     27780
     acctttcatt tttttattaa aaaatttcat tttaatataa atatattgat ttaataagct     27840
     atgttaattt tttttaatga ttttttttga acgcatccag ttttttttgt atttttgttc     27900
     tttagtgtta taaactaaac atggtgtatt gacgtctttt gttacagtag tacctgctgc     27960
     aatagtagta ttttttgcga tttttatagg agcgatcagt tgtgtattag aacctactaa     28020
     aacattatca ccaataatag ttttgaattt atttgctcca tcataattac atgtaatact     28080
     acctgctcca atgtttactt tagaaccaat ttcagaatta ccaagataac ttaagtgttt     28140
     taccttagat tcatttttaa taaaagtatc ttttgtttca acaaaatttc ctatatgaac     28200
     atttctatct aataaagtat ttgatcgcaa atgagcaaat ggacctataa tacagccttt     28260
     tcctatttta gaattttcta taattgtata tgcttgaatg ttagtattac tatcaatact     28320
     actatttcta ataatacatc caggaccgat tttaacatcg tcacctaaaa taacattatt     28380
     ttctaaaatc acacctgtgt ctatttcaac gttttgacca tgttgtaatg ttcctctaaa     28440
     aataaaatga gatggatctt ttattgtaac tccattgata agaagtttat taatttgttt     28500
     tttttgaaaa attttctcta aattagataa ttgcaactta ttattaatcc ctaatatctc     28560
     ttcataattt aatggttcta ttgttttaat aaaactacct tcaagatgag ctaaagcgat     28620
     aatatctgtt gcataaaact cttgtttttc atttttttta tcaatttttt ttagccatcg     28680
     tgttaaatct ttactttgag ctataaaaat acctgaatat atttctttaa tatttttttg     28740
     ttcattggaa gcatcttgat cttctattat actaataact tttccttttt ttcgtaaaat     28800
     acggccatat ccattaggat tttttacttt tgcagttaat aaactaattt ttgattgttt     28860
     tttagatttt tgtaattttt ttattgatac tggagaaata aatgggacat ctccatatag     28920
     aactagtatt tctgtattat ctgaaatttt ttttattgct agcagtatag catgacctgt     28980
     tccttgtggt tttttttgta ttatccattg aattgggatg ttataaatat tagatagtac     29040
     aggttttttt tgatcactgt aaaccaatat aattttttta ggttttatag attgagcagt     29100
     ttctattaca tgttctaaaa ttgtttttcc tcctaaaaaa tgtagtactt taggatgatt     29160
     agatttcatt ctagttcctt taccagctgc aagtattacg ataatgattt cttgtgttaa     29220
     cataaaaacc ctttttttat atatttttta ctgaatagtt ttaattgatt gtacattatt     29280
     ttttttatat cgtaatttgt tgattcgaga atataaaatt tttaataaat actttttaca     29340
     tgcaaattaa gatatataat atagtattcg taataaaata tattatgttt ttaaggtttt     29400
     ttatgtatcg aattattgca gtggatttag atggcacttt gcttacttca gaaaataaaa     29460
     taacaaaata tactaaagag attatacaga tattaataca aaaaaaattt tattttgtct     29520
     ttgcttcagg tcgtcattat atagatatta tgaagattaa ggatagttta aaaataaata     29580
     tttttataat ttcttctaat ggttctaaaa tttacaattt agataataat ctaatattta     29640
     gtgataattt agatgaaaat attgcatcaa aactatgtag aataaaatat tcagacaaag     29700
     aaattattac tcaggtatat caaaatgatc aatggtatat aaataataat aaagtagaaa     29760
     ataatttttg ttctctactt tcatcattgc aatataaata tttttatcca gatgatttaa     29820
     attttaaaaa tatcagtaaa atttttttta caagtagaaa ttttcaaaaa ttacatattc     29880
     tcaaaagaaa aattattaat ttttatggta ataaagttca tgttaatttt tcaattccag     29940
     gttgtcttga aattgtatca gggaccactt aaaaggttat ggattaaaat taatagctaa     30000
     tttactagga gtgtctttga aaaattgtat tgcttttggc gatggaatga atgatcagga     30060
     tatgttaaaa gttgcgggta aagcatatat tatgaaaaat tctgatccac atttaaaaat     30120
     agcactgccg catcttgaaa tcattgaaag caatgataat gatggtgtag caagatgctt     30180
     gaataaaatt tttatagaaa ataataaaga gatgttataa agttataaaa atttcttata     30240
     caagaagttt tttttgattt ctgtagatgg ctatataatt attgctatgt cctttttctt     30300
     attagttttt ctttcgatta taaaccttga tttttttaat tatttaatat tcaaaaaagg     30360
     tcatgtacaa ttctaatttt ttctgagact tgtttgtatt taaaagaaaa aatgtattat     30420
     atatgatttt aaacatagat gtaagattat atcttagaaa aagataattt aatatatcta     30480
     gtctgtttta tcaaaaaata gattttgtca atattgcata tatcaggtcc gttgatcgag     30540
     tgttgttttt taaaaaaaag agtagttaaa aaatacaact aagcgtactt caaaattaaa     30600
     aactagtata tataatcaat tatttgagag tgcatacttc agaaattagt ttaatatcaa     30660
     ttttttcttg tcttagaaac cttcgaagat taaacatgat acccaaataa aaatatattt     30720
     ttattttaaa aggatttttg aagatttata atagtaattt aaactattga atatatctgt     30780
     atatttaatg aataattaaa tgattatata taatgaaagt ctatatatta tttaatatat     30840
     tttagatagt tgaaataaca ttttaccttg tattgtaaaa attatggaat tactttttct     30900
     gagaaataat ttaaatcctg ttttttctaa ttagttaaat tgatatgata ttactgattg     30960
     tatttgatat aattaaatag catctgtttt caatacactg ttattttttt aaggcttatt     31020
     atatttatag atattttatt ccaattataa cattccttca tatcgagaac taactattaa     31080
     tgcttgctca ttttctttaa ttgtaagaat tacaaatatg tattttatgt aagtatttat     31140
     aaattatttt catgatcaaa aatataattt aaaaaaatag gacatttaaa atgacaattt     31200
     taaatcatac tttaggattt ccaagaatag gattaaaccg agaattaaaa aaagctcaag     31260
     aacaatattg gtccggggaa ctgatgatta aagatttatt attagttggt tctgaattaa     31320
     ggaaaaaaaa ttggcaaaaa cagaaagaat ctggaattga ttatattcca gttggagatt     31380
     ttgcttggta tgatcatgta ttaaccacga gtatgatgtt aggaaatatc ccagaaagac     31440
     ataataatac agttgactct attgatttag attgtctatt ccgtattgct cgaggttgtc     31500
     ctccggatat ttcagcttca gaaatgacta aatggtttaa tactaactat cattatattg     31560
     tacctgagtt ttataaaaac aaagttttaa agtactcttg gaaacaaatt ttagatgaag     31620
     tagatgaagc tttattatta gggcacaagg ttaaacctat acttttagga ccgattacat     31680
     atctttggtt gggaaaagta aaaggagaat attttgatcg tcttgatatt ttaaaagata     31740
     taattctaat atataagcat gttttaaaag aattatctaa ccgtagtatt gattttgttc     31800
     aaattgatga acctgttttg gttttagaat taccaaaaaa atggaaagac gcttatcatt     31860
     atgcttataa agaattatcc ggtataacaa aattattgct tacaacatat tttgacagta     31920
     ttgagcataa tatagaattt attcgtgatt tacctgttca aggtattcat atcgatctag     31980
     tgcatggaaa atataattta aaaaatttta gttctaaaat accatcagaa tggatgctgt     32040
     ctttaggtgt tattaatggt cgaaacattt ggcgttccga tcttttaaaa tggtttaaat     32100
     ctatcaaatc gatttcaaat catcatagaa aaatattaat cggttcatct tgttctttat     32160
     tacatacacc gattgattta gtagcagaaa aacacttgga taaagaagta aaaagatggt     32220
     tttcttttgc tgtacaaaaa tgtgaagaat taagattatt atcaagtgct ttaaatgata     32280
     atgacattga ttctattaaa gaatggagtt tacctattta tgagcgcagt gtttctaaaa     32340
     gagtaaataa aatcgaagta gaaaatcgct tatcaaatgt tttaattgat aaacatcaac     32400
     gtttaagtcc ctataaaact cgctctatag aacaaaataa aaagtttaat tttcctattt     32460
     taccaacaac tactattgga tcttttcctc aaactatcag tataagaaaa ttacgaagag     32520
     attttaaatt agggttagtg actgaagaag aatacacaaa aatcattaaa aaaaatatta     32580
     aaaaagttat aaaaatacaa gaagaattag atattgatgt tttagtacat ggtgaagctg     32640
     aaagaaatga tatggtagaa tattttggtg aacatttaga tggatttgca tttacagata     32700
     atggatgggt acagagttat ggttcacgtt gtgtaaaacc tcctattatt attggagata     32760
     ttagtcgtcc taaacccatg actatagaat ggtctaaata tgctcaatct ttaactaaaa     32820
     aaccagttaa agggatgtta acaggaccgg ttacaatttt actttggtct tttcctagag     32880
     aagacgtttc attaaaaaaa attgcaacac aaattgcttt agcattatat gatgaagttc     32940
     tagatttaga aaaagaaaaa atagaaataa tccaaattga tgagccagca ttacgagaag     33000
     ggttgcctct acgaaaaagt tcttggcatg aatatttatc ttgggcggtt gatgtatttc     33060
     gtttaagtgc ttcaggtgtt aaaaatacta cacaaattca tacacatatg tgctattgtg     33120
     aatttaatga tatcatggat tctattgcat tattagatgc tgatgtgatt acaattgaag     33180
     cagctcgttc agatatggaa ttattagaat catttaaaaa atttaaatat cctaatgaag     33240
     taggtccagg agcatacgat attcattctt ctaatatacc aagcgtacaa tctataattt     33300
     ctcttttaaa taaagcaatg aaatatattc cattaaaacg tatatgggtt aatccagatt     33360
     gcggtttaaa aacgagaaat tggaacgaaa caatattatc tttaaaaaat atggttgaag     33420
     caacgaaaat acttagagaa aaaatgaaag atagtgaatg tgattaaatt gatttctttt     33480
     ttaatgatta taatataatt taatattaaa tcatctttta gaatatttta aaaaatctaa     33540
     aatgatgatt taatacttat aaatttttat atatttcaat agtcaaagac taatgtttaa     33600
     aatgcctttt tttagtaaaa atcatcgtta tattatgttc atctgcagct cgaatgattt     33660
     cttcatctcg tatagaacct cccggttgaa ttatagagct aataccgaca gaagcagctt     33720
     catcgatacc atctctaaaa ggaaaaaaag catcagaagc catagtggca ccaataatat     33780
     ttttaccctg atctttaact tttatattag ctaatttagt tgaataaatc ctgctcattt     33840
     gacccgcacc aattccgata gtaatttcat cagaaccata tacaattgca tttgatttta     33900
     caaatttagc aacttgccaa caaaagatag agtctttgag ttcttttttt gttggactac     33960
     gttttgtaac aaaactccat gagttataat ctatattatg agaatcgtat tcttgtacaa     34020
     gtagaccatt agtgatcttt tttaaatcca atccaactgt attattttgt aattttccag     34080
     taactagtac tcttatattt tgtttttttt gtaatatttt aactgctttt ttactgattt     34140
     cgggaataat aataacttca acaaattgtt gattaataat tgtttgtgct gttttttcat     34200
     ctaatttaca gttaaaagaa attatacctc caaatgctga aataggatca gaattgtatg     34260
     cagataaata tgattctaaa atattatgac taacggcaac gctacaagga tttccatgtt     34320
     ttacaataac acatgctggt ttagtgaatt gttttacaca ctctaatgct atatcagaat     34380
     ctgatatatt attatatgat aaagtttttc cttgaatttg acatgctgta ctaattgttc     34440
     cggaatcaca catgtttttt tctatataaa aagacgattt ttgatgatag ttttctccat     34500
     atcttaaatc ttgtttttta ataaaagaaa aatttatttc attcgggaat aaactattat     34560
     tagttttttt atacaagcta ttttgttcaa tgaaatactg agaaataatt tgttcatagt     34620
     atgatgtata ttcaaatgct ttagatgcta aattaaatct tttttccata ttcattgtgt     34680
     tattgttaat agaatcaata gtagattgaa aatcatcaag atctactata actataacgt     34740
     tcttataatt ttttgcagaa gcacgtacga gtgtcggtcc gcctatatca atattattga     34800
     caacattatc tatatcattt ttttttatgt ttttgatttt ttcaaatgga taaaagttta     34860
     cgataactat atcaattgga caaatattat ataatttcat aatctcctga tctttttgtt     34920
     tttgtcctaa aataccaccc ataatttttg gatgtaatgt ttttactcgt ccatccatga     34980
     tttcaggaaa ttttgtataa tctgatattt ctgtaacagg tatattgttt ttttttaaaa     35040
     tttgagccgt tcctcctgtt gaaaataaat taattttatt aattattaat ttttctgcta     35100
     cttctacaat attttttttg tctgaaacgc taattaacgc attttttata agattatttg     35160
     atggcataat atattttctt atttttaaaa aaaaattaaa atattttgtt atataatata     35220
     aagatatttt ttatatttag actattttaa atatataata ctaatttagt aaggggcact     35280
     acgccccttc tttaaatact tcataagtta taattgtttg attgcatttt ttaatgtttt     35340
     accagatgta aaactaggaa cttttgtagc aggtatctgt atttcttttc ctgtttgagg     35400
     atttcgtcct gtacgggacg atcttaaatt aactttgaaa gtaccaaaac caactatttg     35460
     tacagattca ccttttttca aagaatcaat gatagttgat aatgttgttt ctaaagtcaa     35520
     ttttgcttgt attttagata aattagattt tttagaaatg acattaatta attgagtttt     35580
     attcattatt atcccttttt tatttatatg taaaaattaa taatttattt agatattttg     35640
     taaatataaa ttgaaaaaat ttattttgaa aattatattt tttgatgata aattttttta     35700
     tacttatttg atataaaaag aaaaaatata ttttttcata ttataaattc tatattaatt     35760
     aaacatgtta tttttgaaaa aataatataa aaaaagaatc agatttcaaa tttacaattg     35820
     aataaaattt aaatatataa tatatctaaa aatcatcaaa aaaatacggt atgaaaatcg     35880
     cagttttatt tttaataaat tgttattttt tttaaaaaat aacagtattg atttctacat     35940
     gatttcaatt ttattcaaat taaatagtga tatattttta ttaaaattat ctgatatgtt     36000
     ttatgaattt gaagcgtttt tatataaaat atatataaga ttttttattt ttaaaataaa     36060
     ttatttatta tatatatttc aaatatatca ttttaaattc actcctttat taaaccttcg     36120
     aaatacaatg aattttttta aaatagtacg aattttaaaa aatataatca ctgtttttaa     36180
     atagtatttt tttaaataat tattatttta ttttataaaa tagtgttata tatttatatt     36240
     ataatataaa attatcatgt ttttactgtg gctgctttta agagcagcca taatttatat     36300
     atacaaaata ttaagatgat ttatttttct ataagagcag aatttaataa ttctgaaaga     36360
     ctagcagaag cttcttcagc actaatttga gaactgctaa ctgttggatt gttatgtttt     36420
     ttttgacgac gattcaaacg ttctttgtga tatgcatatc ctgttcctgc aggaattaaa     36480
     cgtccaacaa ttacattttc ttttaatcct cttaattcat ctctttttcc tgcaactgca     36540
     gattctgtta atactcttgt tgtttcttgg aaagaagctg cagatataaa agattctgtc     36600
     gcaagtgatg ctttagtaat tcctaataaa tctcttgaaa aagtagctgg cattttcttt     36660
     tttttatcta acatgcgatt tgatattttt atatgagaaa attcaacttg ttcaccttcc     36720
     agaaaatctg aatctcttga tttaactaca gtagcttttc gaagcatttg tcgtataatt     36780
     acttcaatat gtttgtcgtt aatttttaca ccttgtaaac gatatacttc ttgtacttca     36840
     ttcactatat atctagttac agcttgaaca cctcttaatc ttaagatatc atgtggtgat     36900
     tccggcccat cagatatgac atctcctcga tctactcgtt ctccttcaaa tacatttaat     36960
     tgtctccatt ttggaatcat ttcttcataa gaatcactac catctactgg tgtaattact     37020
     aatcttcttt tacctttagt ttcttttcca aaagatataa tgccactaat ttccgctaaa     37080
     attgctaatt cttttgggcg tctagcttca aataaatctg ctactcttgg taatccacct     37140
     gttatgtctt tagtacctcc agattcttgt gggactctcg ctaatgtatc gcctgaactg     37200
     atttgtactc cgtcatcaag ttgaacgatt gcttttccag gtaagaaata ttgagccggc     37260
     atatctgttc ctgaaataag aacatcattt ccattacaat cgataatttt taatgctggt     37320
     cttaaatctt taccactaga cattctttct gctgtatcta atattactat agaagacaaa     37380
     cctgttagtt catctgcttg tcttgtaata ctttgaccat caatcatatc tacaaaacgt     37440
     actaacccat taacttcagt aataactggc atggtatgtg gatcccattt tgcaacagtt     37500
     tcccctgaat gtactttttc accgtcccct ttagccataa tagctccata aggaacttta     37560
     tagctttctt ttgttcttcc aaaattatcg ataatattta gttctacatt tcttgaagta     37620
     attactgttt taccagcaga attaattaca aattttgcat tattaagatt tataatacct     37680
     tgatttttta cttgaatact agattctgct gcagctctgg atgctgcacc accaatatgg     37740
     aaggttctca tagttagctg tgtgcctggc tctcctatag attgtgcagc aattacccca     37800
     attgcttctc ctttattgac taaattacct cgtgctaaat ctcgaccata gcagtaagcg     37860
     catacaccaa aatcagtatc acaatttact actgatcgta ctttgacatt atctatagaa     37920
     ttatgctcta aaagatcaca ccatttttca tttagaagtg tatttctttt gattaatata     37980
     tttttagtat ttggaataat aatattttct gcagtaacac gacctaaaac acgttcacgt     38040
     agtggttctt ttacatctcc tccttcaatt aatggagtca ttaaaattcc ttcatgtgtt     38100
     cgacaatcat cttgtgttac aactaaatct tgagctacat ctactaaacg acgtgttaag     38160
     tatccagagt ttgcagtttt tagtgctgta tcagctaatc ctttacgagc tccatgtgta     38220
     gaaataaaat attgtaatac attcaaacct tctctaaaat tagctgtaat tggtgtttca     38280
     ataatagaac catcaggttt ggccatcaat cctctcatac cagctaattg acgaatttgt     38340
     gcggcagaac cacgtgcccc tgaatcagcc atcataaata tactattaaa agatatttgc     38400
     ttttgtttgt aacctttttt gttgataaca gattctgtag ataagttttg catcatcgct     38460
     tttgctactc gttcattagc tgccgcccaa atatcaataa ctttattata tctttcaccc     38520
     gcagtcacta atccagattg gaattgttct tgtatttcag caacttcaat ttcagcctca     38580
     ttgatgatat ttgccttttt ttctggtatt accatatcat caatacctac cgaagctcca     38640
     gatcttgctg cataagcgaa tccggtgtac ataatttgat cagcaaaaaa aacagtagat     38700
     ttcagtccta aaatacgata acaagtatta agcattttag aaatatcttt tttacctaaa     38760
     gtttgattaa caatactaaa aggtagtcct tttgggataa tcatccacaa aattgctcga     38820
     cctatagtag taggaattat tttttttatt gcagtaaaac ttttatcttc atttttttta     38880
     tattctatta ttcgaacttt tactagtgaa tgtagttcag caatacctaa acggtatact     38940
     ttttctgctt cattagaacc atttaataac ataccttcac cttttccatt gattttttcg     39000
     cgagtcatat aatacaaccc taaaacaaca tcttgagaag gtacaataat tggttcacca     39060
     tttgcaggtg ataaaatgtt attagttgac atcattaaag ctctagcttc taactgtgat     39120
     tctagagtta atgggacatg gacagccatt tggtctccat caaaatcagc attgtaagct     39180
     gcacatacta atggatgaag ttgaatagct tttccttcta taaggactgg ctcaaatgct     39240
     tgaataccta atcgatgtaa agtaggtgca cgatttaaaa gaactgggtg ttcgcggatt     39300
     acttcgtcta aaatatccca cactattgct tcttctcttt ccaccatttt ttttgctgct     39360
     ttaatagtag tggctaaacc acgcacttct aatttgccat atatgaacgg tttaaaaagt     39420
     tctaatgcca tttttttagg tagaccacat tgatgcaaat gaagataagg acctacagta     39480
     attactgaac gaccagaata atctacacgt ttcccaagaa gattttgtcg aaatcttccc     39540
     tgttttcctt taatcatatc agctaatgat ttaagaggtc ttttgtttga tcctgtaatt     39600
     gctctacctc ttcgaccatt atctaataaa gcatctactg cttcttgtaa cattcttttt     39660
     tcattgcgta caattatatc tggagctgct aaatctaata aacgtttaag acgattattt     39720
     ctattgatca ctcgacgata caaatcattt aaatctgatg ttgcaaatct acctccatct     39780
     aatggtacta atggtcttag atcaggtggt aatactggta atacgttaag aatcatccat     39840
     tcaggtttat tatgcgattg aataaaagat tctaatagtt taattctttt tgttaatttt     39900
     tttctttttg tttcagaatt tgtttcattt agttctattc tcaatacatt acattcttgt     39960
     actaaattaa tatctttcaa taaaaattga atcgcttccg ctcccattgt agcatgaaat     40020
     tcatctccaa attcttccaa tgaatctaga tattgttctt cggttaaaat ttgacgtttt     40080
     tcaagattag tcatgcctgt ttctatgaca acataagatt caaaatatag tactctttca     40140
     atatctctta aaggcatatc taataataaa cctattcttg atggcaaaga ttttaagaac     40200
     caaatatgag ctgtaggtga agaaagttct atatgaccca ttcgttcacg tctaactttg     40260
     ctttgtgtta cttcaacacc acatttttca caaattactc ctctatgttt taatctttta     40320
     tatttaccac acaaacattc gtaatctttt actggaccaa aaatgcgagc acaaaataat     40380
     ccatctcgtt caggtttaaa tgtacgataa ttaatagttt caggtttttt gacttcccca     40440
     aatgaccatg atctgatcat atcaggtgaa gctaacgaga ttttaatagc atcaaaatct     40500
     tcatttttag tttgggattt tagaaatttt agtaaatctt tcacacgtta gctctcgttg     40560
     gagtaaaact tttaaggtaa ataaataata cataaatatt tttataatat tgctaatttt     40620
     gttattcgct ttctagttca atattaatcc ctaatgaccg aatttctttt aaaagtacat     40680
     taaaagattc tggcattcca ggttccattt gatgatttcc atctacaata tttttataca     40740
     ttttagttct tccattaacg tcatcagatt tcacggttaa catttcttgt aacgtataag     40800
     acgctccgta cgcctctaat gcccaaactt ccatttcacc gaaacgctgt ccaccaaact     40860
     gagcttttcc acctaatggt tgttgagtca ctaaactata agatccagta gaacgagcat     40920
     gcattttatc gtctactaag tgatttaatt ttaacatata catataacca acagtaacag     40980
     gtctttcaaa tttttcgcct gttcttccat caaaaagtat aatttgacct gaagtaggta     41040
     aacctgcaaa tttcaacatt tgttttattt cattttcttg tgcaccatca aataccggtg     41100
     tagaaatagg gatgccattt tttaaattct ttgctaaacg taatatttct tcattggaaa     41160
     atgtatctaa atttactttt tgtctcaggt tatctcctaa gtcaaaagct ttttgtataa     41220
     attttcgtaa attagatatt ttttcttgtg ttttaagcat atgattgatt ttatcaccaa     41280
     taccttttgc cgccatacct aaatgtgttt ctagtatctg accgatattc atacgagagg     41340
     gtacacctaa tggatttaaa acaatatcaa ctggtatacc attttcgtca taaggcatat     41400
     cttcaacagg attaatttta gaaattactc ctttatttcc atgtcttcct gccattttat     41460
     cgccaggttg aatctgacgt ttaactgcta aatacacttt aactattttt aaaacaccag     41520
     gagcaagatc atcgccttgt gtaatttttt gacgttttat ttctattttt ttattaaatt     41580
     cttcttttaa ttcatgatgt tgtttagcaa gtttttctat ttcttttttt ttgtcttttt     41640
     gtttaatgtc tacagaaaac catttttcaa aaggtagtgt atcaagctgt tttgtttcaa     41700
     tatcaagcga tataaaagtt tttttaatat gagtaaataa actagattca aatattttga     41760
     attcttcagt aagatcttgt ttgattttct tcagttgcat gtcttcaatt tctaaagctc     41820
     ttttatcttt ttttacacca tctcttgtaa atatttgtac atctatcacg gtacctgata     41880
     ctccattcgg tactcgtaat gaagaatctt ttacatctga tgctttttca ccaaaaatag     41940
     cacgtaataa tttttcttct ggagttaatt gtgtttcccc ttttggagtt actttgccaa     42000
     ctagtatgtc gccgccagtt acttctgctc caatataaac aattcctgat tcgtctaatt     42060
     tagataatgc agcttctcct acatttggta tatctgaact aatttcttct gctcctaatt     42120
     tagtatctct tgatatacaa gataactcct gaatatgaat tgtggtgaag cgatcttctt     42180
     gaacaaccct ttctgagact aatattgaat cttcaaaatt gtatccattc catggcataa     42240
     atgctacacg catattttgt cctaatgcaa gttctcctaa atctgtagat ggaccgtctg     42300
     ctagaacatc acctttttta attttttcgc ctaaattaac gcagggctgt tgattaatac     42360
     aagtattttg attagatcga gtatatttag taagattata aatatctatt ccagcttctc     42420
     ttgaatacat ttctttttca tctactttta ttactatacg tgaagcatct acatattgaa     42480
     caacaccact tcttttagct actgctgtaa caccagaatc tactgctact gctcgttcca     42540
     ttccggtccc tatcaaaggt ttatctgttt taagggtagg tactgcttga cgttgcatat     42600
     tagcacccat cagtgctcta ttagcatcat catgttcagg aaaaggaatt aaagacgctc     42660
     caacagatac aatttgttga gtagatacat ccatataatt tacttgatta cggttgaata     42720
     aactagattc gcctttatgt cggcaagtta ctaaatcgtc agtaaaaaaa ccagttttat     42780
     cgatattagt attagcttgt gcaataatat aattgccttc ttctatagct gatagataat     42840
     gaatttcctc actaactaaa ccgttacaaa cttttcgata aggtgtttct aaaaatccat     42900
     gagaatttgt ttgagcgtac acagataaag aattaattaa tccaatattc ggaccttctg     42960
     gtgtttcgat aggacatact cgtccataat gtgttggatg tacatctcga acttcaaaac     43020
     ctgctctttc tctggttaaa ccacctaaac ctaatgctga aattcttctt ttatgcgtaa     43080
     tttctgataa aggattattt tgatccataa attgtgataa ttgactagaa ccaaaaaatt     43140
     ctttaaccgc agctgatatt ggtttagcat taatcatatc ttgtggcata agcgcatcta     43200
     aatcgccgat agacaatctt tctttaactg ctctttccac tcttactaaa ccgattctaa     43260
     attggttttc cgccatttca cctactgatc taacacgtcg atttcctaga tgatcaatat     43320
     catctacttc tccttttcca tttcggatat cgataatttt ttttataaca tcaatgatgt     43380
     cttctttatt taacgtactt gaacctttag tttcttcacg taaaagggat ctgttaaatt     43440
     tcattctacc tacagtagaa agatcgtatc tgtcttcaga aaaaaataaa ttttcgaata     43500
     aattttctgt tgcctcttta gtaggtggtt ctcctggcct cataactcga taaatttcta     43560
     ttaaagcact catacgatca ttagatgaat ctattcgtaa cgtttctgat atatatggac     43620
     catgatctaa atcattagta aacaatgttt caatagagta gaaacctaat ttttttaatt     43680
     tttctaatat ctctaaagat aattctgtat tagaagaaat aattgtttcg cctgtttttt     43740
     tatctacata atttttagat acaattcttc caagaatata ttcaacagga actgtgatag     43800
     attttatttt attatttttt aattcttgaa tatgtttagc agtaatacga cgaccttttt     43860
     ctacatatat tattccattt tttttaatat taaatgatgc agtttcacct cggagtcttt     43920
     cgggaactaa ttctaataca attttgttat tttctatttt aaaaatattt ttctcaaaaa     43980
     atatgtttaa tatttcttct gtattataat taagagcccg caaaataatg cttactggta     44040
     gctttctacg tctatcaatt ctaacaaata aattatcttt tggatcaaat tcaaaatcta     44100
     accaagaacc gcgataagga ataatccggg cattatatag aacttttcct gaggagtgtg     44160
     ttttaccttt atcactatca aaaaagactc caggactacg gtgtaactga gaaacaacta     44220
     ctctttctgt tccatttatt ataaatgttc cattgttagt cattaatgga atttcaccca     44280
     tatatacttc ttgttcttta atgtctttaa cagtagcttc taatatgtca cgttcgtaga     44340
     taacaaggcg taattttact ctcagtgccg ccgaataagt agcacctctt atttgacatt     44400
     ctttaacatc aaatattgtt tctcctaaac ggtaactaac atattgtaat tcagagtttc     44460
     cattataacc gcgaatagga aatacagaac gaaatgctgc ttctaatccg tgttgacctg     44520
     ataaatctgg ttgaataaat tttttaaaag aatttaattg aatcgaaaga agatatggta     44580
     tatctaacac tttaggacgt ttgccaaaat ctttacgaat acgttttttt tcggtataag     44640
     agtaaaccat ggggttccta agctcgttga cagataagtt gaaaattaat ttatcttttt     44700
     gtctgaaggg gagacagttt taatatttcc gtaagaattt taattacatt ttgtattttt     44760
     tttaaatgtt ttttaaaaaa tgatttgaat tttattttga tcaacagggc tggtgaagca     44820
     acatcaccag ccgtatttga aaattaatta aattataaaa tttaatattt ttatttaatt     44880
     tcgatttcgg caccaacatc ttccaatgtt tttttaagtg attctgcgtc ttctttgctg     44940
     atattttctt ttaaaactgt tggggcagat tctactaaat ctttggcttc ttttagtcct     45000
     agaccggttg cactacgtac agttttaatt actgacactt tatttggccc aataactttt     45060
     aaaaaaatat caaattctgt tttttcttcg cgtaaatctt tttcattatg gttgttgcta     45120
     ttaatagaca tgctagcaga gacaccaaat ttctcttcca ttgctgtaat aagatctaca     45180
     acattcataa cagacatttc tgatatagct tctaagattt gttctttagt aatagacata     45240
     acaataattc ctaataacca ttagaattat tttagatgtt attaatacat caaaaataat     45300
     aacctttaag aggtttcttt tttctgtttt atagcagata atgtataaat tagttttccg     45360
     gcaatcaaca tcttccatgt taacagaagt ttgattattg cttctttata agtaggcata     45420
     tctgcaagtt gattaatttc taaaatagag agtaattttc cttcaaaagc tgctcctgta     45480
     attttaaatt gtgtgttttt ttttgaaaat tctttaaata atctagcacc actacctgga     45540
     tgtatcatag aataagcgat aaaggtagag ccttttaatt ttttttttaa acactcaaaa     45600
     acagtatttt taattgctaa agacaacaga gtgttttgaa caatgctcat tttcactcct     45660
     acttcacgtc cagattttct taactcgttt attttattta cacacacacc ctgtaaatct     45720
     gcagtaacag ctgataatgc tgtgttagat attttattaa tttttgaaac aattattttc     45780
     ttgtcatgaa tacttaatgc catttatcag attttcctta ttgatctaga gaaaaataat     45840
     ttgaattaat tttaaagaaa gacagtaagc atgataattc gttttttcaa aatatacttt     45900
     gatagaattt tattctatga ctatagtaaa aacattgaat aataaatttt cagtactaaa     45960
     attagattgt ttttaaatat ttttaattaa aaaaactttg aatactagtt aaaaaaaggt     46020
     tattattata aataattttt cttatagcgt aaagtggaaa tcattttctt acagcgataa     46080
     agtagactga tcaaccatta atcctacacc catagttgtt gataaaacta ttttttttat     46140
     atatatccct ttggattgcg gcggttttgc ttttttaata gattctaaaa acacatttaa     46200
     attttctttt atctcatttt tatgaaaatt aattcgacca attgtagcat gaataatccc     46260
     gtttttatca tttcgataac gtacttgtcc tgtttttgca tttttaatgg cttcagcaat     46320
     atttgttgtt attgttccta atttagtatt aggcattaag ttgcgaggac ctagtatttg     46380
     tcctagttgt gttactattt tcattgcatc aggggtcgca ataacaacat caaaatcaac     46440
     accttctttt ttaatttttt ccgataaatc ctccatccct attaattctg cacctgcatc     46500
     tttagctatt gcaatattat caccttgtgt aaatacggct actcgaatag aacggccgat     46560
     accatttggt aatactgttg agcttcgaat attctgatcg gattttttag aatttatacc     46620
     taaattaatt gctatatcaa tgctttcatt aaattttact gtcgatgatt tttttaataa     46680
     gtctattgtc tcgtcaatat ggtgtaattt tgcaaaatta atatgttctt ttattttttt     46740
     catacgttta gtttttttat tcattattat ccctcaataa ttagacccat agatttagca     46800
     gtaccttcta tagatcgcat catgttttca atattagaac cagtcatgtc attattttta     46860
     ataattgcta tctctttgat ttgtgagcga tttatttttc ctattttttc tgatttattt     46920
     ttactagaac cttttttaat tccagatagt ttttttaata atacagaagc aggaggagtt     46980
     tttgtaataa atgtaaatga acgatcagaa taaactgtaa ttattactgg tatgggaagt     47040
     cctttttcta tattttctgt ttttttatta aatagtttac aaaactccat gatattcaca     47100
     cctttttggc ctaaagctgg accaattggt ggactaggat tagctgcacc agctgaaact     47160
     tgtagcttga tatatgattg tatttttttt gccattattt tctcatttta tataaaattt     47220
     ttattaaaat ttacaagata tgttaatttt tttcaacttg tctaaaatct agttcgaccg     47280
     gagtagatct tccaaaaata gaaacagaaa ctttcagtct acttttttca taatcaactt     47340
     cttctacaac accattaaaa tcagcaaaag gaccatcatt gacgcggatc atttctcctg     47400
     gttcgaataa ggtttttggt cttggtttat taccaatttt acgtagtcta ttaatgataa     47460
     tttctacttc tttgtcacta atcggtgaag gtttatctga tttcccccca ataaaaccta     47520
     aaacttttgg gacatttcta attaaatgcc aggttgaatc tgtcattttc atttgtatca     47580
     aaacatatcc aggaaaaaat ttatattcgc tttttctgcg ttgtccacct cgtatttcaa     47640
     caacctcttg agaagggacc attacttctc cgaataaatc ttccatttga tttaatttca     47700
     catgttcccg tattgattgt gctacacgac tttcgaatcc agaaaaagct tgtaatacat     47760
     accatctctt tttttgactc tcatgcattg ttagaacctt aaactaataa taaatgctat     47820
     taaacgaaag attacactat ctatactcca taaaataaag gatataaaga ttgttacaga     47880
     aatcacaatg aatgtagtat ataaagtttc tttatattta ggccatatta ttttttgcat     47940
     ctcttttttg gacattacta tatataataa tatatctttt ccctttttcg tgtatatcat     48000
     agtacctatt gcacagagca ttaaacagga tataataaat atacgtataa ataattgtgt     48060
     ctcgtaaaaa cacatattaa taaaaaaaga tagaataaaa aatatagata tagatatcca     48120
     ttttactttt tctggaattt tatgcttatt tcgattgtag tgatgtttat tcataatttc     48180
     tcctaaaatt ataaaataat atagaaaaaa tatgttaata cataaaaaat ttcattcttt     48240
     tttttatttt taaaaattat attttcaaat gaaaaaaatt ttcgttattg tgaaaattat     48300
     aaactattaa aataaactat ttttttttaa aatagattaa tttttttatg aagtaagtgt     48360
     agaagtttta atatatagaa tattttaaaa taaaaagtat taggtgagag ttatgataaa     48420
     tgatttgaaa aatatttatt taaaaaatta aattatttta gatgatatta aataaatttt     48480
     agttattatg ctgataccca ggattgaact ggggacctca cccttaccaa gggtgtgctc     48540
     tacctactga gccatatcag cagttttcat ttttttagcg gacagcggga attgaacccg     48600
     cgtcatcagc ttggaaggct gaggtaatag ccattatacg atgtccgcat atttttatag     48660
     tttttatagt tggtggtggg agaaggattc gaaccttcga agtctatgac ggcagattta     48720
     cagtctgctc cctttggccg ctcgggaacc ccaccttaaa aataatttta tgccggctac     48780
     cggaattgaa ctggtgacct actgattaca agtcagttgc tctgcctgct gagctaagcc     48840
     ggctattttt tataatattt tagttatttt ttaaaataac aattttaaat gaattatatt     48900
     atataatttt tcatttgtat gcaagttttt ttatttaaaa ataatattaa tagaaagtat     48960
     tatatttttt tgatctgtat ttatataact ttcaacttac tgtttaattt aaaaattttc     49020
     gatgctttta tttttccgga tgctccgata agatctactt ctggttctaa taatatatta     49080
     aattttttta aaatacattt gtgtattatt ttagctaatt ttataatttc ttgagcagtg     49140
     gcattttttt tattaattaa tataagtttt tgttttttat gaatagctgc atcgccaatt     49200
     tgaagatgtt taaatttata attttcaatt aaccaagcag cagaaatttt cactaaaccg     49260
     tttttttgtg gataatttgg tactttatat aaatttatta gtttttgtgc ttttttcttt     49320
     ttaattaggg ggtttttaaa aaaactgcct gcattgccga ttttttttgg atcaggtaat     49380
     ttttttttac gtattttaca tattatattg aaaatcttgt atgcagttat atttattggt     49440
     gtaatataat tttctaatga agaaaaaaga attggacgcc atttctttga cagctttatc     49500
     ccgactctaa taacagcatg ttcatttttg tattgatctt taaaaatact attacgatag     49560
     gaaaatttac aagaattttt ataaattctt ttaattgtat tgtcttttaa agacaatata     49620
     tcaacgtatt gacatacatc tttaaattct aatccgtatg cgccaatgtt ttgaatagct     49680
     gcggatccta tacaacccgg aattaatgct aaattttcta atcctaaaat acctaaattc     49740
     aatgttaatt ttactaaatt atgccatttt tctcctgaaa aaacatgcaa taaccaaaaa     49800
     tttttttttt ctactatttt tattccttta atacgattaa taattacgac tcctacataa     49860
     ttttccaaaa ataatacatt acttccctct cctaaaatta tataaggaat attagataat     49920
     tggcaaattt tagatatatc aattagtgat tgaatcgttt ttacaaaaat tatttttttt     49980
     gctgttacat ctattgcaaa tgtgtttaaa tcttttagtg attgactaga aaaatatttt     50040
     tttttatgca tagaaaatcg attaataatt ttattagttt ttttataata atcaatacat     50100
     attcattagt atatagtgat ttttttgaaa aattttagat aaattcattt taatggaatt     50160
     ttataatgaa aaattattct cagtatcatc aagatataat gaatcaaaaa ttagaaaaca     50220
     ttcgcaataa tatacagtgt tcttttgaat tttttccgcc gaaaaattct tttttagaag     50280
     aaaatttatg gtctacagtt aaccgtcttt ccttattaaa accaaaattt ttttctgtaa     50340
     cttatggcgc aaatactggt gaacgtgaaa aaacatatga tactgtacag aagatatata     50400
     aaaaaacagg tattattaca gcggctcatt taacttgtat tgattccaca cctcataaat     50460
     taaaagaaat agcatacaat tattggaata gcggaattaa aagtattgta gcacttagag     50520
     gagatacatt agaaaaagat tataggcata ctatgtatgc agtagattta gttcttttat     50580
     taaaaaaaat agctgacttt gacatttccg tagccgctta tcctgaatta catcctgaat     50640
     caaaaaacgt taaatcagat atactgaatt taaagaaaaa agttgatgca ggtgcgagca     50700
     gagcaattac tcagttcttt tttaatattg aaagttattt gcgttttcga gataattgta     50760
     ttaaaaataa aataaatatt gatattatac caggtatttt accggtatgt aattttcaga     50820
     aattaaaacg tttttcaagt atgactaatg ttaaaattcc aaaatggatg cttgatatgt     50880
     ttaatggttt agatgatgat atattcacac agaaaataat tggttctagt atagctatag     50940
     atatggtaaa aaaattatct tgtgaaggag taaaaaattt tcatttttac actttaaatc     51000
     agtctgatat tacttattct atttgtcata tcttaggtct ataaaaatct ttaatttaat     51060
     aacaaaattt atttattaat ttagtaataa tgttttttgt gggttgaata aaataatgtt     51120
     ctaaatattc atctggctga tgtgcttgtt caatagaacc tggtcctaat attaaagtag     51180
     gtgcaattct ttgaagaaaa ggtgcttctg tacagtaatt tactgctgca ctattgagtt     51240
     gacataattt ttcgactatt ttaatagttc cgctattatg cggacattca taagcaggaa     51300
     cagaagaaaa aagtttttta ataaagatac gatgagacca ttttttcatg attgtttcta     51360
     atttttcttt aattacaatt tcaatttgtg ttaaagtgag tccaggtatg ggtcttattt     51420
     caaaatttaa tatacataaa ggacaaattc gattaattgc actacctccg tgtatagaag     51480
     ataaattcat ggttggatat ggaatagaaa agtttggatg ctggtattct tctttaaaat     51540
     actttttcaa aatcaataaa gaacgaataa catcatgcat aatttcaata ctattcacac     51600
     catgatcagg attactagag tgtcccgtat ctccaatgac tttaattgaa taagacatgt     51660
     gacctttatg tgcattgatt agctttaaag atgttggttc tccaattatt atgcaatctg     51720
     gtttaataat agtcgattgt ataaaatttc tagctccaga catatctgtt tcttcgttag     51780
     cagtagcaag aatataaatt ggtttattta ttttttttat atttatagaa gatattactt     51840
     ctaatataag agcaaaaaac cctttcatat ctacggctcc taatccataa aatttattgt     51900
     tagtttcagt taatttgaaa ggatcttttg tccatttttt ttcatcaaaa tctaccgtat     51960
     ctgaatgtcc agacaataaa agaccgccat ttcctgaacc aacacaagct aacatgttat     52020
     acttatcagt atgtggaatt tgataatttt ttactgaaaa atttaaatca gaaaagtagt     52080
     tagacagtag atcaatgaaa tttttattac tttgatcaag tagtttgtta ttactgctaa     52140
     ttgtaggaat ttgaattagt gacttataaa cttcaataaa agaaggtatt tttcttatca     52200
     tactagaatt ttaaaaattt atattattat tgtaatgtaa aatattttat tcataaatag     52260
     ataattgatc aatattttaa taatataaaa tatatttttt ataaaattta atacattatt     52320
     ttatctataa aagagtaatt tttttaaggt ttattaattt tatgttaaat gtagtaattg     52380
     ttggtgctag tggatatgct ggcgcagaat tggttaacta tatgcaccgt cataggtttg     52440
     ctaatataaa aaaaatattt gtatcaaaaa atagtttaaa tatagataaa ttgttttcgg     52500
     atgttcatca acaatttaaa aatattgtgg atctcagatt tgatacaata cgtaattgta     52560
     ctttaattaa aaaaaatatt gatgctgttt ttttagctac agatcatcgt gttagtcatt     52620
     ctcttgttcc ttttttttta tcgtctaatt gtattgtttt tgatttgtct gcttcttaca     52680
     gaatgaacaa taaaaaagtg tatttggatt attatggctt tgttcatgaa tatgaagaac     52740
     ttttaaaaaa ttcagtttat ggattagcag aatgggaaca agaaaaaatt aaaaaagcaa     52800
     atctgattgc attacctggg tgttatgcaa cttgcattca attagcgctc aaacctctta     52860
     taaaagaaaa tgttctttgc gataaaaata taccaattat taacgctatt agtggtgtta     52920
     gtggtgccgg tagaaaagct tctttaaata atagtttttg cgaagtaagt ttacaaccat     52980
     ataatatttt cactcatcgt catacgcctg aaattataga aaaattaggt gttccagtaa     53040
     tttttatccc acatttaggc cctttttctc gaggtataat tgcaactatt acatgcaaat     53100
     taaaacctaa tgttaaatca attgatatac acaatatttt caataaattc tataaaaata     53160
     aaccgttaat tcgtatatat aaaaaatatt tacctagtat taaatcagtt gaaaaacaac     53220
     cattttgtga tattggattt gtaattaagg acgactatat agtaattgtg gcagcagaag     53280
     ataatttgtt aaagggtgct gctgctcaag cagtacaatg ttttaatgtt cgttttggtt     53340
     tttctgaaac ggaatcaatt atttaattaa taatcaggcg ttgataatga atcctttagt     53400
     tattaaatta ggcggagtac ttttagaaag tgacgatgct atgaagcgtt tatttgaagc     53460
     tttagttgat tatcagaaat tttataagcg tcatgtgtca gtgattcatg ggggaggtcg     53520
     tttaattgac aatttaatga ataaactgtc tttaccagtt aaaaagaaaa atggcttacg     53580
     tattactccg tctgaacata tcaatattat tacaggagct ttagctggaa ctgctaacaa     53640
     aactttactt gcgtgggcat taaaatataa tattaatgct attggattat gtttagcaga     53700
     tggaggaagt gttgatgtag aaagattaga tgaaaattta ggtcatgtag gtaaagcgat     53760
     accgggatca ccattatttt taaaaaaact ctttaaagaa ggtactattc caattattag     53820
     ttctatagga attactaaag atggtttatt aatgaatgta aatgctgatt tagcagcaac     53880
     agctttagca accactttac aagctaattt aattttatta tctgatataa gttcgatatt     53940
     agacggcaag ggacaaagaa tcacagaaat tgatagcatt caagctgaaa aattgattat     54000
     gcaaggaatt attactaatg gtatgattgt taaagtacgt gctgctttag aagctgctcg     54060
     agttttacgt cgtcctgtag atatagcaag ttggcaaaat acagaaaaat taaaattatt     54120
     atttaatggt gtgaatattg gcactcgagt ttatgtatga tattactata aatatagtag     54180
     gtttaaaaaa tgataagaaa aaaaaataat aaagttgttt tagcttattc tggcggttta     54240
     gatacttctg caattattcc atggcttaaa gaaaattata attttgaagt tgttgctttt     54300
     gtagcagaca taggacaatc aaaaaaagat ttaaatggaa ttgaaaaaaa atctttagaa     54360
     tctggcgcat ctagttgtca tgtttttgat ttaaaagaag aatttataga aaattatgtc     54420
     tatcctgtac taaaaactgg agctttatat gaaggcagtt atttgttagg aacagcaatg     54480
     gccagaccta ttattgcaaa gaaacaagta gaactcgcat tgaatattgg agcaaattca     54540
     ctatgtcatg gtgctactgg gaaaggaaat gaccaagtac gttttgaaat ggcttatgcc     54600
     gctttagctc cgaatttaaa tgtaattgca ccgtggcggg aatggaatct taattcacga     54660
     gaatcattat taaaatattt agataaaaaa aacatctcta caacagcaac attagaaaaa     54720
     atatatagta aagatgaaaa ttcctggcat atttcaactg aaggaggttt gctagaaaat     54780
     ccttggaatc aatctaatga agattgttgg agctggacgg ttaatcctga ggatgctcca     54840
     gaaaaaccgg aatatgtttc attgcaatta aaagaaggct gcgtagtatc cgttaacaat     54900
     caaaaattaa atccgttaaa atgtgtagaa gaattaaata gtttaggtgc taaacatgga     54960
     attggtagaa ttgatattat tgaaaataga ttaattggaa tgaaatctag gggatgttat     55020
     gaaacacctg gaggtactat tattatgaca gctataaaag ccatcgaaca gttagtttta     55080
     gatcgtgaaa gttttcgatg gagggaaaaa ataggtttag aaatgtcatc tattgtttat     55140
     gacggacgtt ggttttctcc aatacgtaaa tctttacaag ccgctgctga ttcattgtct     55200
     ttggaaataa ctggagaagt aatattaaaa ttatataaag gctctgtcac agctgttcag     55260
     aaaaaatctc ctaattcctt atattctgaa gaatatgcca cttttggtga ggataaagtg     55320
     tataagcaat ctgatgcaga tggttttatt cgtctttttt ctctttcttc aaagatacga     55380
     gcacaaaata tgttgaagta gttttaaaaa agtcacaaat atatttacag aattttacat     55440
     ttaatttttt cagtttttta tagagataat atatgggact ttggggtgga cgattcatta     55500
     atgaatctaa taaattattt aaagaattta atagatcttt atcttttgat tatattttag     55560
     cagaagaaga tgtaatttct tcagttgctt ggtctaaaat tttaatgaaa agcaagatta     55620
     ttactgaaaa agaacagatt acaatagagt ctgcactttt tgaactactt aaagaaatta     55680
     aagagaataa tcaaaaaatc cttaaaagca agtgcgaaga tattcatagc tggatagaag     55740
     aaaagcttat tcaaaaaatt ggtatattag gtaaaaaatt acatactggt cggagtagaa     55800
     atgatcaaat tactactgat ttaaaattat ggtgtagaaa gaaaattcat cttttattag     55860
     aaaatattat tgaactgcaa aaaacattta ttttaagtgc tgagtctaat cataatatca     55920
     tcatgccagg atatactcat ctacaacgag ctcaaccgat tactttttcc tattggtgtt     55980
     tagcttatgt tgaaatgttc agacgagatt tcagtcgttt aaaagacgtc ctgaaacgat     56040
     taaacgttag tcctctaggt tctgctgctc tttctggaac cgcatggaaa atcaatcgtg     56100
     aagaattagc tttatctatg ggatttgact ctgcaactaa caatgcgctt gatactgttt     56160
     ctgatcgaga ttatgtcgtt gaattattgt cctctgcatc aattagtatg atgcatctat     56220
     cacgtttttc tgaagatata atttttttta attctggtga agctgatttt attgaattat     56280
     ctgatacaat tacatcgggt tcatcattaa tgcctcagaa aaaaaatcca gatgcactag     56340
     aacttattcg agccaaatgt ggtcgtgttc atggttcatt gatttctatt ttagttatat     56400
     taaaatccct tcctttatct tataataaag atatgcaaga agataaagaa ggtttatttg     56460
     attcaataaa aacatggaat gattgtttat gtatggctat tttagtattg aagaacatgc     56520
     aaataaaaaa tgaatcatgt cgtaaagctg cagaagaagg atattctaat gcaacagaaa     56580
     tcgcggatta tttggtaaaa aaaggaattg cttttcgtga agcacataat atatcgggtc     56640
     aattagttct tagagctatt agcgagaaaa aatctttaaa cgaactgaaa ctatctgttt     56700
     ttcaaatgta tagtaatctc ataaaaaatg atatatataa aaatattact ttagaatcct     56760
     gtcttgaaaa aagaatgtct aaaggtggtg ttgcaccatc tcaagtatat gaagaaatta     56820
     taaaagcaaa aaaaagattg aatatttttt aaagtaggat acttgttaac tagcatttaa     56880
     aaattattta aatgctgagt taataacctt atcaagtata ggagagtgga tatatgcagg     56940
     atgtaatatt tttcttgagt aaacacattt tactaattag tatatggatt ttttgtttta     57000
     ttgcagccgt tttttttata actagaactc ttttgtcgaa atctaaaatg attaataatt     57060
     ttcaagcaat taaattaatt aatcaagata aagctattgt tgttgatact cgttctttag     57120
     aatcattcaa agagggtcat attcttaatt ctattaatgt tccgttaaaa aatatttttt     57180
     taggaaaaat taaagagata gaaatatata aaatgtttcc tattattctt gtattaagtg     57240
     acacatataa agttaatgca tgtattaaaa agttttttga atatggattt aatcgtgttt     57300
     atattttaaa aaatggtcta tattattgga agacagacaa tcttccactt attgttaacg     57360
     ataaatgatt ttaaaaagta taaaatgatc tttttattaa aatatcttct ttataaatta     57420
     attttataaa caatatcaac ttatatcttt ttattatttt tttttggatc cgttatgtta     57480
     gaagaaaaaa aaaaacaaga atcttttgaa atccaacgta tttatataaa agatgtttcc     57540
     tttgaagctc cgaatacacc aaatattttt catgttaatt ggattcctac cattaaatta     57600
     aatttaaata ctactactaa aaaaataaaa gaaaatattt ttgaagttgt tttaatggtt     57660
     aaagtaacag ttaaaattaa agaagactta gtttttttat gtgatataga tcaagctggt     57720
     atttttttta ttgcaaacat taatgagaaa agattaaaac attgtttata ttcttactgt     57780
     ccaaatattc tatttcccta tgcgcgtaca tgtatatcta atctagtatc ttgtggcagt     57840
     tttccacaga tgaatctcgc tcctattaat tttgatgctc tctatcatga tcatattaaa     57900
     taaaaaaaat ataaaaatat aaattacgaa tatactcatt tttataagat aataatataa     57960
     ttttttagta taaaaatact ataaatattt tgtaggagaa aattatgtgt attttgaaaa     58020
     tatcaagaat atggaataaa atactctacg atgtttcttt tttattaaaa aaagaaccaa     58080
     ttttatcaga tttttaccaa agtagtattt tacaacacca aagttttaca agttctttaa     58140
     gttatatatt atcaaataaa ttatctacat ctatgatttc tgaaaagaaa atacaaggta     58200
     tatttgatga tgtatatctg aatgatcgtt ctattttaaa ttttatagtg caagatatta     58260
     aggctgtact aaaacgagat ccagcagtaa atgattattt aacaccttta ctttatttaa     58320
     aaggtttcca tgcactagaa gcttatagaa taagtcatta tctctggaat acagggaaaa     58380
     aatcattatc tctgtatctg caaagtagaa tctcttctga attttctgta gatattcatc     58440
     cagcagcgtt tattggatct ggtgtaatgc ttgatcatgc aactggcatt gtaatcggag     58500
     aaggtgtgac tatagaaaat gatgtatcaa ttcttcattc ggttacttta ggaggaactg     58560
     gtaaaaactt tagccaaaat agacatccta ctattagaaa aggcgttgtt ataggggcgg     58620
     gtgccaaaat tttaggaaat attgaagtag gttcaggcgc gaaaataggt gcgggatcaa     58680
     tagttttaaa aaatgttcct tcagatgtaa cagttgtagg agtaccagcg aaaattgtta     58740
     gtcaagtatc tagtaaaaag tattattctc agaagaaaaa aaatagttta aaatatataa     58800
     atatatttca acacggagat ggtatttaat ttatttctta tataaaataa aaacttctgt     58860
     tttgttcgaa aaaaatatag tggttagact aataccagta cagaagcttt attttatatt     58920
     taattcttct atttttaatc gtctaaaaaa ctgcgcaaaa cttctgatct gctgggatga     58980
     cgtagttttc taagtgcttt tgcttctatt tgacgaattc tctctcgagt aacatcaaat     59040
     tgttttccaa cttcttctaa agtgtgatca gtattcatat ctattccaaa gcgcatacgg     59100
     agtacttttg cttcacgagc tgttaaacct gatagaacat catgtgttgc agaacgtaaa     59160
     ctttcagagg tagcagagtc taatggtaat tccaaagtag tatcttcaat aaaatcacct     59220
     aaatgtgaat catcatcatc tccaataggt gtttccattg agatcggttc tttggctatt     59280
     ttcaatactt ttctaatttt atcttcagga ataagcattt tttcagaaag ttcttctgga     59340
     gtcggttctc gacctatttc ttgtaacatt tgtctagaaa tacgattgag tttattaata     59400
     gtttcaatca tatgtactgg aatacgaatt gtacgagctt gatcagcaat agatcgagta     59460
     atagcttgtc gaatccacca agtagcataa gttgaaaact tataaccacg acggtattca     59520
     aatttatcta cagctttcat taaaccaata tttccttctt gaattaagtc taaaaactgt     59580
     agtcctctat tcgtatattt ttttgcgata gaaataacta atcgtaaatt agcttcgacc     59640
     atttcttttt tcgctcgtct agcttttgct tctccaatag acattctttt attaatatct     59700
     tttacttgtt caattgttaa gccagtttct tcttctattt taattaattt tttcacacta     59760
     ataaacacat cttctttaac tttttttaag ttttcagacc atggttgatt tgtattttgt     59820
     tctcttataa accaaagata gttaattttt tttattggaa aaattttaat aaaatttttt     59880
     tttggcattt tacatatttc aacacataat tttataataa ttctttcttg ttttcgtact     59940
     ctttccatca tatgtctcat attattaact aaatgatcaa attgttttgg aactagtcga     60000
     aattgtttaa aaacttctga aagattgtaa atttctaata atgaatcttt atgtgttcga     60060
     tttttatttt taattgtatt atttgtatta ttatattgta tacgtaattc agaaaatttt     60120
     tcattagcta attctggatc aatactatga tcatcttcat gatcttcttg attgttttct     60180
     tcgtcttctt cattattttg ttgttcatca agaagttcag aacctatatg aatagctgta     60240
     ggggggaaaa tttcttctgc attgggatct acaaaacctg ttattatatc tgataatcgt     60300
     atttgtccag ttttaacacg atcatattgt tcaagaagat atgtaatggc ttctggatac     60360
     tctgatactg agcattgaac ctgattaatg ccttcttcaa tacgtttagc aatatcaatt     60420
     tctccttctc gtgtgagtaa ttcaacagta cccatttctc tcatatacat gcgtacagga     60480
     tcagtagttc gtcctaattc agattctaca ctagatagta cctgagttgc tgcttcaact     60540
     gcatcttcat ctgtatctgt attgatttca tttaatatta gatcgtcagc atcaggtgct     60600
     tcttcaacta ctggaatgcc catgtcatta atcatctgaa taatatcatc gatttgttca     60660
     gaatcaataa tgtcttctgg tagatgatca ttcacttcag aataggttaa atacccttgc     60720
     tccttaccat gtgtgacaag tagcttaagt tgcgactgtg ggttttgatc cataatgtgg     60780
     tatccggaat tctattaatt gaatgaatat taattgactt ttttgtcaat gatgaataat     60840
     aataaaatta tttttaatat ttaaataaat taaagagttt tttaattcat taaactttta     60900
     gtatatttaa tttttattat attttttaat aagtataatt ttatcttttc gataactttt     60960
     tattaataga ccaaatctct tttttttcat tcatttgcaa tccttttttt ctctcttttg     61020
     caataagata ttctcgtctt ttttcaagga ttttatcatg tatattcatt aataaatcta     61080
     aaaacatgtt ttgagtttct ttttgaatta tcatgtgatc ccatcgtgct aaaattttta     61140
     aaacattaat tattgtagta tttctgtata gttctaataa ttgacccgta tgaatattag     61200
     gattatcacg acatgtctgt aatatttcta aaaaaataga taatcctttt atttgtaaat     61260
     ttttaaattt cattgtcaca ggcactagtt ttgctaaact aggattttgt actaataatc     61320
     ctattaaagt acgcatggga gtacgtttta tttggaaata tgttttttga gtatttttag     61380
     tttctttttc atataaaaat ttttcaaatt gattatcatc taaaattcct atcattctag     61440
     ctaatatttg acgcaaataa attcttatag tgtcactaga aatcgtattt attaaaggta     61500
     aagcatgtac gcttaaatga aatttgtcat catcagatga taaattgata ttttttagta     61560
     tatttttaaa aaaaaatttt gacatggtaa ttgcgttatc aattcgtttt tgaaattttt     61620
     ctctaccttc ttttctaata attgtatcag gatcttcctg gttaggtaat aaaataaatt     61680
     ttaatgtttt tttgtctgat atatacggca aggctttttt taaagttttc caagctgcat     61740
     tttttcctgc atcatcacca tcatagcaac atataatgat atcagtattt ttaaagagaa     61800
     gttgaatgtg ttcagttgtt gttgaagttc ctaatataga aacagcataa tcgatattat     61860
     attgtgttaa tgttataaca tcaatatacc cctcaacaac caataaatat acaggttttg     61920
     aacatttttt tataacttga tataatccat atatttgttt tcttttataa aaaatatctg     61980
     tttcaggtga gttaagatat tttggtgaca tatcatttaa tgagcggccc ccaaaaccta     62040
     tgattctgcc atgattatct tgtataggaa atattatacg tccttgaaat cgatcatata     62100
     tatatccgtt tttgtcagta gcaataatat tgtttattaa taattcttgt tcaaattctt     62160
     tacttatatt tattttttta taaaattcgt tccattttaa actagaaaat ccaattaaaa     62220
     aaaaatcaat catattttgg ttgatacctc ttctagctag atatttatta gctaaatgag     62280
     taacattaat attttttttg tataatttac atattttttc cattaataaa tataactttt     62340
     gttttttaac ataaatagaa ttttgtactg tattttcaaa tggtatttta acaccatgta     62400
     ttaacgctag ttcttcgatg ctttctataa aacttaaatg ttcatactgt attaaaaaat     62460
     caattgcgtt tccatgtgca ttacatccga aacaataata aaattgtttt tcattactga     62520
     cggtaaaaga tggagtttta tcatgatgaa aaggacaatt tgtttgataa tttttaccat     62580
     atttttttaa ttctagacgt gtattaatta attctatgat attagttcga gacagtagtt     62640
     cagtaataaa gtatttaggt atttttccag acatataatt ttataattat agaattcgtt     62700
     tccgttcttg aacaagaacg gcttttttta tttattttat gttttaaaac atatttagta     62760
     catacgaata cgtcttgcat tttctcttgt aagttttttt gcaagacgtt tgacagccga     62820
     agctttagct cgtttgcgtt cggttgtagg tttttcataa aattctcttc gacgaatttc     62880
     agctaaaatg ccagcttttt cacaagaccg tttaaaacgg cggagtgcta catcaaatgg     62940
     ttcattttcg cgtactttta ttattggcat tcaaaattta ccttaattat ttaatttatg     63000
     tgataaaaaa ttatcgaaat ttttaggata atagatccta tatcaattag tgtgatattg     63060
     taaagtatca tttttttatg ttttaatgca gttttaatta aatatttaga ttagttcatt     63120
     taaaatgaat gttcatttta aaatttatgt caaatatatt ttttcttatt gtaaaaattt     63180
     ataatatata gaggtttaaa tttatgagaa tattaggtat tgagacttct tgtgatgata     63240
     caggaatagc tatttatgat actaacaaag gtttgttaat taatgagata tataatcaaa     63300
     gaaagttaaa caatatatat ggaggtatta ttccagaatt agcatctcga gaacatatgg     63360
     aagcaatgat tgttttatta aataaaatat ttaagaaaaa aaatatttat aaatatgttg     63420
     atatgattgc ttatactgca ggacctggtt taattggttc attattagtt ggagctacat     63480
     ttgcttgttc attagggtta tcattaaata taccagttct acctgtgcat catatggaag     63540
     cgcatttatt atcaccgatg ttagactata aaacaattca atttccattt attggattat     63600
     tggtatcggg aaaacataca caaattatag gtgcacataa atttggtgag tatgaaatac     63660
     ttggaaattg tttagatgat gcagcaggtg aagcatttga taagacagca aaattattag     63720
     gattaaaata tccaggtggt ttagaattat ctaaattagc ttctaaggga ataaaagatt     63780
     atttttattt tcccagaccg atgatacatc attctgattt aaattttagc ttttcaggtt     63840
     tgaaaacttt tgcagctcaa acgattaaga aatccagtaa aagtatgcaa gaaaaagcta     63900
     atattgcaaa agcttttgaa gatgcagtaa ttgatatatt attaattaaa actaaaaaag     63960
     cattaaaaaa acaaaaatgg aaacgtttag ttatagctgg tggtgttagt gcaaatcaaa     64020
     aattacgtaa aaaatccgag atcatggtta aaaaaaattt taatggaaca gttttttatt     64080
     caagtttaga attttgtaca gataatgctg cgatgattgc ctatcttggt tcattgcgtc     64140
     aaaaagaagc gcggaattct caattagaaa tattggttaa accaaaatgg tctatagatg     64200
     atttatgttt ttaatataaa aaattaagtc ttgtatggtt aatacttgca tttttttatt     64260
     ttcagaaaat tttattattt caggggtacg agccatggta ccatctttat ttgttaattc     64320
     acaaataacc ccggctggtt tgaaacctgc tagagaaaca atttctatag cagcttctgt     64380
     gtgtcctggt cttgataaaa ctccgccttt atgagctcgc agaggaaata catgacctgg     64440
     tctatttaaa tcacttggtt tagcgtcatc agcaatagcg gtttttatag tagtgagtct     64500
     atctttagct gatacgccag tagatatacc tttagaagct tctattgtga ctgtaaatcc     64560
     ggtgcgatat gcgctagtat ttttcttaac catcataggt aaattaagtt gtttccgttt     64620
     agattcggtt atacaaagac atactattcc actaccgtac cgaatactta gagccatttg     64680
     ttctactgtc atattttcac atgcaaaaac aagatctcct tcgttttcac gttcttcatc     64740
     atctaatata ataacacctt gtccggactt caaagcaagt attgcatttt taattctttc     64800
     tataggtttt ccaaatttag ataatagtgt ttgattcatt ataaaaatct taatagagtt     64860
     aaattattta aaaaaagttt tatttataga aaaattagtt aaattttatg tttgtatagt     64920
     taatatatta tatattgaat taaatttaag agcaatgtag aaattattat attgaataat     64980
     attttttcaa ttttttatct attagcattc taaacaacat attgatataa aattttactt     65040
     cgattttttt ttaaaagctt acttgaaaaa atagaccaaa taaaaataca aaaattaaat     65100
     aacagtactt ttattgatgg tttaaaacag aatttaactc attaatattc aatgtttcag     65160
     ttccaatttt ctgtataaca atactggctc caatattggc ataaaaacaa gcttcttcta     65220
     aagaatatcc agttgctaaa gatgctgcaa ttatagcgat cactgtatct cctgcaccag     65280
     ttacatctga agctatttta gatgcggcag gaaaatgtat tggttttttt tctttttgaa     65340
     atagagtcat tccattctta gaacgagtaa ctaataaagc tgataactgt agttcagata     65400
     ataattttat ccctctttgt agtatttcat tttctctata acatttgcca actatctttt     65460
     caaattcaaa aagatttggt gttaataaac tagctcccga atatttttta aaatctattc     65520
     ctttaggatc tataagtata gggatagaca ttttttttgc aagatcaata atattttgta     65580
     tatttgccaa agtgcctttt gcataatctg aaagtactaa aattttaaaa gacgatattg     65640
     aatcaataat tttttgatgt aatagattgt ttttattaga aatatatttt tcttgaaaat     65700
     ccactcgaat taattgtttt ttctctgata agattctaat cttagtaata gttttattgt     65760
     tttttataga gattaaatca gaatcaattc gaatatgatc cataagtttt tttaatatta     65820
     atccttcatt atccattcca ataaaaccaa caattttagt atacccccca atctctgcaa     65880
     tatttttagc tacatttgca gcacctccag gttgttcttt gattttatta attggtacaa     65940
     ttggtgttaa ttgttcagat agcatatagt gatttttgct ataccaataa caatctagta     66000
     ttagatctcc gacaactaaa actagtgagt tattgaaatt tattaatttt ttcttcatag     66060
     tgttatctct gtatatttta aagaatataa tgaaaattaa aaattcaatt tttttataaa     66120
     tataaacatt tgaaagttta atagatattt tttatttaat atataaatat tattatatta     66180
     ttgaattgtg gaaaaataat aaataattat ataaaaaatt ctatttttct attatagaat     66240
     agaattttgt ttttagtatg agaaaattat tatgaaaata tatttagtag gaggagctgt     66300
     gcgtgactcc ttacttaatt tacccgttaa agataaagat tgggtagtag ttggtggtac     66360
     agaaaaaata ctgctagaaa gaaattttca gcaagtcgga aaagattttc cagttttctt     66420
     acatccagaa acacatgaag agtacgcttt ggcaaggaaa gaaagaaaat ctggaaaagg     66480
     atatactgga tttgatactg attgtaattc agatgttact ttagaagaag atttaataag     66540
     acgagattta acaatcaatg ctattgctca agatgagtac ggtaattata ttgacccgtt     66600
     tcaaggtaaa aaagatatag aatgtggttt aataagacat gtatcagaat cttttataga     66660
     agatccattg cgtgtattac gtgtagcaag atttgctgca actttagtac atttaggatt     66720
     taaaattgca gaagaaacta tgttattaat gtgcattata gttaaaaaac aggaattgtc     66780
     atatttaacg tcaaacagaa tatggaatga aactgaaaaa gctttgaaaa cccttaaccc     66840
     tcatgtatat tttcaagttt tgtatgaatg caatgcattg catttttttt tccctgaaat     66900
     gtatttttta tatgaaaaaa aaaatttttt aaaccgttct tttttcaaaa aattctgtaa     66960
     taagaatatt atattaatgg gtttggctga aatatcactt ttgaataaag atatcgatgt     67020
     tcgtttttct tatttatgtc aatttttatc agttaatcaa atagatagaa attattcaaa     67080
     aatatttttt gactcatatg cggcttctat tattcatagt gtatgtaaac gctttaagat     67140
     cccatcttat attcgagaca tagcagtatt aaatactggt ttttattttt ttttaaatac     67200
     gattcattat caatcatcta aaaatattat aaatctattt tcaaaagttg atgcttggag     67260
     aaaacctgat cgtgtaaaaa aattagcatt tttaagtaat tttaattttt taagaaactt     67320
     taaatctgaa tttttttgta taaagtctgg ttgtttttta gaaaaatgtt tttctgttgt     67380
     aaaaaatgtt tctattaaat taattttaaa aaaaggtttt aagggatatg aaataaaaca     67440
     agaaataacg cgtctaagaa ttaaaaaatt agaattttgg cgtataaaaa atattaaaca     67500
     tcgtttctat ctatgaaatc aatctttaat taatatttta atcaattaat aaaataaatc     67560
     aatccagata tgataaagcg atatattccg aagaatatta gtgacgttct attgattatt     67620
     tttaataatt ttttgataca caatatagat actataaaag agatcatgaa tccaataaaa     67680
     aatattggaa gatctaatat tttaaaatta tgcatattat ttataaaatc ataaaatgat     67740
     gctcccatta ttaatggaat agatattata aaagaaaatt ctattgcaac tgatcgttta     67800
     attcctaata atattgcagt tcctatagtg gctccagatc ttgaaaaacc aggatacaaa     67860
     caaaaaattt gaaaaaaccc aattattgcg gattgaagca aactaatatc attaatacta     67920
     cacgttttat attttttagg tttaaatatt tcagatatta ataaaaaaat tccacctaat     67980
     attaatgcat acataacatt atatgtatta aatagtagtt ttattttttt ataaaataga     68040
     agtccaaaaa atattgtagg taaaatagca aggagaatat gaagattttt tgtatttgtt     68100
     tttttaacat ttatgttaaa ttttaatatt cttaaaattt ttttatgaaa aaaatacaat     68160
     atcgataatg cagagccgaa ttcaataaat atttctaata ttttggtatt ttcgttatct     68220
     atttttaacc aatgagaagc gataatcata tgtcctgtag aagatatagg aagaaattct     68280
     gttatccctt ctattactcc gataataata gaaacaataa cttgatgtag atcaagcata     68340
     tattttcctg ttataaaata attttatttt agtatatata aattaaaacg gtactaaata     68400
     atagcaccgt ttttgtatta aaaatcaatg atacaaagtt ataataactg tctgtccagc     68460
     agcaatagtt cctgatgatt tttttatttt tttaaaattc tctatgtttg atattacaac     68520
     aggagttaaa atagactctg ctttttcttt tataaattct aagtctagta taataatttc     68580
     atctcctatt tttacttttt gattatcttt tgcttttttt ttaaaacctt ctccttttaa     68640
     ttttacggta tcaataccaa aatgtataaa taattcaaca ttatcttctg aaatgattga     68700
     aaaagcatgc atagtttcaa atatttttcc aatcgttcca tttactggtg cgagtatccg     68760
     attacttgaa ggtttaatag ctattccgtc tcctacaatt tttttagaaa aaacaggatc     68820
     tggaacatct tctatattta ttatatctcc tgataaaggt gcaaaaattt ctgttttttt     68880
     actgttaaaa aaatcagaaa agaaactcat ttttttctcc taataactct tacgttattt     68940
     ttataatata ttctgcctct taatgattaa caaaattttc tactaaatta agtatttctc     69000
     tgttagtagg tagtgtcaat gctttttgag ctaatttttt agcactagaa aaagatgttt     69060
     tgcgaatgat ctctttaatt ttagggatgc ttattgaact catactaaat tcatccaatc     69120
     ccatccctaa taatagaata gtagctcgtt catcgcctgc aagttctcca cacataccag     69180
     tccattttcc atgtgtatgc gagacgttta taacttgttg aattagtttt aaaacagatg     69240
     gattcatagg attataaaga tgtgaaatca aatcgttacc tctatcaaca gctaaagtat     69300
     attgtgttaa atcatttgtt ccaatgctaa aaaaatctac ttctttaatt aaatattcgg     69360
     ctattatagc tgacgctgga gtttctatca taattccaat tttaatattc ttatcaaatg     69420
     gtatgttatt attttttaat tgtatttgaa gttttcgaac ctctgatttt aaaattctaa     69480
     tttcttctac ggatattatc atagggaaga ggatatatat ttttccaaaa gcagacgctc     69540
     taagaatagc atttaattgt gtatgtaata tttcttttcg atccattgaa atacgtatag     69600
     cacgccatcc aagaaacggg ttttcttctt ttggtaaatt catataagga agatctttat     69660
     cccctccaat atccattgtt ctaataataa cagatttatt tttcattaat tctgcaatgg     69720
     ttttatatgc ttggaattgt tcgttttcat caggtaaaca gtttctgccc ataaataaaa     69780
     attcagttcg atatagacca atacattcag cgccattttt ttttgctgat ttaatgtctt     69840
     caacatttcc aatattagaa ccaattttaa tagcatgtcc gtcagtagta atagcttgta     69900
     aattctttaa atttattaac tgattttttt ttgtgagata tttctttttt attacttctg     69960
     tttgattaat taatttatga gatggattta tgagaatttg attatttata gaatctaaaa     70020
     tgataaaatc attatttttt actatctttg taatgttccc ggttcctact attgcaggaa     70080
     tttctaatga tcttgccata atagatgtat gtgatgttct acttcctaaa tcagtaataa     70140
     atcctaaaat atattttaga ttaatttgag cagtttcaga aggagttaag tcttttgcaa     70200
     ttaaaattac ttcattattg atattattta aatcaataat gtttaaatta agtatatttt     70260
     ttaataaacg attgccaata tctcttacat cgattgctct attttttaaa tattcatctt     70320
     tcaatttttc cagagctttt gcttgtcctt caataattaa ttcagttgct gctgcagccg     70380
     acatattttt ttcttttatt aaagaaataa cttcttgttc tagctcttca tcttcaagaa     70440
     gcataatatg tccttcaaaa atactttctt ttttttctcc aaacttttct tttgtcttag     70500
     tttttatttc tgtgagttgt tgaattgatt ttcttcttcc ttcaaaaaat ctttctattt     70560
     cttttgtaat atttttaata ttaattattt tccggttaat aacaatttca tcttctttta     70620
     ataaaagagc tgttccaaaa gctatacccg gtgatgctaa aatgcctgaa atcataacat     70680
     tacctttaat aataaagttt atctattcag agatggaaat atgacgtgtc aggcgaatca     70740
     tttttcataa aataattaga agttttttta ttcagctcct acgtattttg tagagaaatt     70800
     taacattaat acttaagaac aatttattct aattctgtca ttattagaga taaatgttca     70860
     attgcctttt tttcatcttc tccttcagct gataatgtaa taagacttcc ttgaataagg     70920
     cctagtgttt gaattttaaa taaacttttt gcatttactg attttccgtt ataaataata     70980
     gaaatttcag aagtaaattt ttttgcttct tttacaaact gagcagcagg tcgagtatgc     71040
     aaaccatgtg gagcagtaat tttaacttgg ttttgaaaca ttttttttcc ttagtaagag     71100
     ttgattaatc taatattgta ataattttaa aaaaaatttt tattgtaact attaaaatac     71160
     aaattatcta ataaaaacaa ggttttttag agtttttata ttaaataaat tctattttta     71220
     atagtttttt tatagttcag aaaataattc tgtacttaaa taacgttctc ctgaagaagg     71280
     taaaataaca actatttttt tgtctgaaaa ttttttttgc tgttggattt ttattgctgc     71340
     atataacgca gcaccagaag agattcctgc tagtatacct tcttttttca ttaattcttt     71400
     agccgttaat attgcttctt cactagaaac agtaataact tgatcgatta ttgttaaatc     71460
     taagtttttg ggtataaaac caggcccaat tccttgaatt ttatgtggtc caggctcgat     71520
     tgcttttcct gctaaaaatt gtgtgattac aggtgattca gaaggttcaa cagctatact     71580
     gattaaattt ttttttcttt ttattttttt gatatatctt gtgataccag taattgtgcc     71640
     acccgttcct acagcagaaa ttaaaatatc taaattgcca ttagtatcgt tccatatttc     71700
     tggtccagta gtaatttgat gaatttcagg attagctgga ttctcaaatt gttttaataa     71760
     aaaatattta cttggattgc gagatataat atcatttgcc ttagaaatag ctcccttcat     71820
     gccatatctt ccatcggtta aaatcaattc tgcacctaaa gattttaata tttttttccg     71880
     ctcaatagac atggtttcag gcatagttag agttaatcga taatttctag aagctgcaac     71940
     ataagctaat gctattcctg tattaccact agtcgcctcg attagtttta catttttatt     72000
     tatattatta tttttttcgg cgtgccatat catattagca ccaattctac atttaacact     72060
     aaaacttgga tttctagatt ctatttttac taaaatattt ccatttccaa ttctatttaa     72120
     acgaactaga ggtgtattac caatagttaa agaattatct tgatatattt tactcatttt     72180
     tttccttatt tttaaatttt ttcctgtgac ataataatta catcatatta aattgaatat     72240
     tattccagtg ttatagttaa atatttttta ttatcttttc tagtggaact tattttaaaa     72300
     tattgttttt aattgcaaat aaaaattata taataaaaaa tatcttaaac tatcaatatt     72360
     attaatttat aaaatttaaa aaaaatttta aaacttgtct attttatacg ataattatat     72420
     ataataaatt catgacatct actaaagata aaatcgaaaa attaaggaaa attcttttaa     72480
     agtatgaata tttttatcat acattaaatc aatcaattat ttctgatgca gaatatgatt     72540
     acttatttcg tcaattgtat gaattagaac taaaaaataa agaacttatt ccttcagact     72600
     cacctactca aaaagtagga tcgcacatat tgcagaaatt taaaaaaatt aaacattttt     72660
     cccctatgtt atcattagaa aatacctttg atgttaatgg atatttaaac tttaaaaaaa     72720
     gaattaaaaa atccatccat aataatgagc cattatcctt ttgttgtgaa ttaaaattag     72780
     atggagtagc tattagtata atttatgaag aaggcatctt tgtgcgagct gcaactcgcg     72840
     gtgatggttt tgaaggagag aatattacat ctaatgctcg aatgattgat tccatccctt     72900
     taaaattaaa aggaattgac atacctaaaa gattagaaat tcgaggtgaa gtatttatgt     72960
     tgaaatcgaa ttttataaaa ttaaataaaa aatataaatt aaatcaaaat aaatatttct     73020
     ctaaccctcg aaatgcagca gcgggctcat tgcgtcatat tgatccaaat attacagctg     73080
     aaagaaaatt aatattttca tgtcacggat gtgatttttt tgtaaaaact aacaaagagc     73140
     taacaactca ttatcaacga ttaatgaaat gtttatcttg ggggatacca gttaataaag     73200
     aaattgttat ttgttcaagt gacatagaga ttatccagtt ttataaaaaa attgcacaaa     73260
     aaagaaattt tcttgatttt gatatagatg gtattgttat taaagttaat tctttagaat     73320
     tgcaaaaaaa aataggatct accacaaaat caccgagatg ggctatagca tttaaatttt     73380
     ctcctaaaga aaggattaca acattaaatg atgtgaaatt tcaagttggt agaacgggcg     73440
     tgattacacc tgtagcttat tttaatcctg tctatatatc tggagttatg attagtaagg     73500
     catcattaca caataaaaat gaaatagaaa gattaaacct acattttaat gatactatta     73560
     ctatttgtcg ttccggtgat gttataccaa gattattaaa tgttattgag ataagacgtt     73620
     gtgacaatgc aaaaaaaatt atttttccta gtttttgtcc ggtatgcaat acagaattat     73680
     tagaaaatat tgaggaaaaa ttaattcgct gtcattctgg attaacatgt gatgcgcaaa     73740
     aaaaacaagc attatatcat tttttttcaa aaaaatcttt atatgtagtc ggtttaggac     73800
     cgaaaattat caatgaatta gtagaaaagg gattagttaa gaatccaata gatttttttt     73860
     accttaaaga tattgattta attcaattga aaaatgttgg aaaacggaaa agtataaaaa     73920
     ttattaatag tattaaaaaa tgtaaaaaaa ctactctgaa atgttttatt tatgctttag     73980
     gtatacctgg tgtaggagag gtggttgcgg gaaaaatagc aaattatttt ataaaattag     74040
     ataaattgat gaattctaat attttagaac taaattgtat ttcaggagta ggaaaaatta     74100
     tctcaaataa tatatttaat tatttttcta caatttcaaa tcgtgaaatg gtggttaaat     74160
     taataaaaca agccggaatt tttttgaatg atcaagaaat ccacaaaata aattcagaaa     74220
     aaacttattt ttttaataaa aaaattgttt taacaggggt ttttaaatcg ttttcaagaa     74280
     tagagttaaa aacaatttta ttaagtttag gtgcaaaaat ttcaaataat atttctagaa     74340
     aaacagattt tttaatttat ggcaataatt tcggttcaaa attttttaga gcaaaagatc     74400
     tagacgtcaa aattattaat caagaggagt taaattcttt aattcgtatt aaagagtagt     74460
     agtatatttt ttgggtcgtg caggatttga acctgcgacc aattgattaa aagtcaactg     74520
     ctctaccaac tgagctaacg acccttttaa agagtttttc aatgatgttt tatgggtgat     74580
     gacggactcg aaccgccgac ttcctccgtg taaaggagga gctctaccaa ctgagctaat     74640
     cacccttttc tacacctatt tatattgtaa agatagatgt gatagagtca atcttttttt     74700
     aaaaaataat atttgtttgg tgtaaattta atcataatga ttaaattata atctattttc     74760
     tgaggaatac atgaaagtaa aaactcgttt tgcacctagt cccactggaa acttacatat     74820
     tggaagcatt cgtactgctt tgtattcttg gttgtttgca agacatcata atggaaagtt     74880
     cgtattgcgt atagaagata cggatctagt acgttctgaa ttaatttcta tagattctat     74940
     ttttaatgga ttaaaatggt tgggtctcaa ttgggatgaa ggtccttatt ttcaaactaa     75000
     acgattagat agatataaag aagttattaa tgttatgtta gaaaaagaag atgcatatat     75060
     ttgcgtgtgc tcttgtcaag aattagaaga aatacgaaag aaacaaattg aaaaaggtaa     75120
     taaaccacgc tatcctggta catgtagaaa tttaaatatc aagaatatat caaatcaaaa     75180
     tcatgtaata aggtttaaaa atccactttt tggaaaagta aaatttcaag ataaaattcg     75240
     aggagaaatt gtttttgata atgctgaatt agatgatctt gttattcaac gttctaacgg     75300
     tatgcctact tataactttt gtgtcgtcgt cgacgatatg gatatgaaaa ttactcatgt     75360
     tattcgtgga gaggatcaca ttagtaatac accccgtcaa atcaatattt tgaattcttt     75420
     aaaagtaaaa atacctgtgt atgcacattt atcaatgatt ttagatgaga aaggtaataa     75480
     aatttctaaa agaaaaaatg ctataaatat aattgaatac tatgaaaatg gatttttgcc     75540
     agaagcatta ttaaattata tcatacgatt aggttggtct tatggcgaca aagagatatt     75600
     taacctctca gaaatgaaag aattatttaa tttaaaatct attactaaat cttctagtac     75660
     agtaaatttt aaaaaacttt tatggatgaa taaatattat attaataatt caccattaga     75720
     ttatgtttct gactgcctta agaattacat ggaaaagaaa aatattaatg tagaaaaggg     75780
     tcctgattta gaattgttag ttaaattatt tagaagtcgt catcatactt taaaagaaat     75840
     aacagaatct tgtcgatatt tttacgaaga aattaatttt tttaatcata cagtcataga     75900
     aaaatatttt acaagaaaaa attgttttat tttacaaaca tgttataaga aaattgaaaa     75960
     attatctatt tgggacaaca aaaatatatc taaaataatc aatgacgtat ctgaattaat     76020
     caaagttaca aaaaaagaaa ttagtatgat attacgtatc tctatgacag gagatatctg     76080
     ttcgcctagt ataagtactg tcatactttt aattggaaaa gaaaaagctt tattaagaat     76140
     caataacgtt gttaattata ttaaaaattt ataaaaatag tatttttcaa tatctttatc     76200
     tgagacatat aaaaattatt tataaaaaat ttgacacata tgatttttag taagattatg     76260
     tttaagtttt tacaaaaaat acatttaaaa aattatttat aaaaaataaa ttgacaggat     76320
     tcatgtgttt ttatattgta atattttggg gctatagctc atttggtaga gcgcttgcat     76380
     ggcatgcaag atgtcagcgg ttcgattccg cttagctcca cgaaatttat tcttttagat     76440
     tgaaaatttt ataaaaaata ttttttaacg ctgtgctaaa ttttttttta ttcagcacag     76500
     taacttttat aaattatatt tgttgactca taatttcttg ataagctgat acaattttat     76560
     ttcttatttg tactgctaat tgcatagaaa tagaagattt ttctaaattg atcattacat     76620
     cgtttagaga aattcctgat tgatttaata tgaatttttc agaatcaatt tttgcatgat     76680
     tttgattttt gcttatttct cctagtgcta tttttatata gtctataaaa ttttcactgt     76740
     cttttttttg tgcgtctaac aaattaaatt ttgtattaat attttgatga ttgatatttt     76800
     caataaacat aatcttcctc tataaaaaaa aataattttt atatgtttaa atttttcaaa     76860
     tactatcata tctttatcaa gataaaaata atatcttcat aaaagataaa tatataatat     76920
     taaaattaaa taatattttt tatatatata ttcttaataa gcattgaatt aaaattaatt     76980
     taacaggaaa tttttttatt tcatactatt ggtgtatgtt gtagttttca ctaaattata     77040
     gttagaaata attatattag ataggaagat ttcatgaatt tcagtactat agaagagtcc     77100
     gttttaaaag agaaaaaaaa atttaataat tttttatctg gttttttaaa aaattctcgt     77160
     tttttaatta ttttattaac agctgcagct attactgctg tttctatttc agtatggatt     77220
     aaatctcctg agtatcaagt tttgtataat cacttatcta atgaagatcg tggatctatt     77280
     attaacgaat taaacgaaat gaaaattcct tatcaattca ctgattctga tggtccaata     77340
     ttagttccaa aagataaagt atatgaaatt cgattgcgtt tagcagaaaa taatttgcct     77400
     agaggcggga gtattggatt tgaattatta gataaagaaa aatttggaat tagtcaatac     77460
     aatgaacaaa taaattatca tcgtgcttta gaaggagaat tagctcgaac tataaaaaaa     77520
     attaattctg taaaaaatgc cagaatacat atagcatttt ctaaatcatc actattttta     77580
     caggataaaa agaaatcatc agcttcaatt attttagaat tacaaccagg aagaaatcta     77640
     aatacaggtc aaattaatgc tataatgcat ttaatttcaa gtagtatatc tgaccttcca     77700
     gtggaaaata ttactattgt agatcaatca ggtaagttat taaatcaaac ttctgtggaa     77760
     tatgatcagg tgaatgattc acaatttaaa tatactgaag agattgaaac tcgctataga     77820
     aatagaataa aaaatatttt agaaccatta gtgggaattg ggaatattta cgctcaagtt     77880
     actgctcaga tagattttaa tgcacaagaa aaaacacagg aaaaatattc accaaatagt     77940
     gatcataaaa atcaatcaat aagatcgcat caaataatta ttcacaacga aatagaaaag     78000
     agcaatattc aagaagagac gcctattcct ttatctaact ctaataatca tgtttatttt     78060
     aataataata ttaaaaatag taaaaattta aaaaataatt atattcctgt tgatagtaaa     78120
     attaatcgtg ataacacagt aaattatgaa ttaaatcata gtgtatcaca tacaaaaatg     78180
     aacataggag aaattaaaag gttatcagca gcagttatag tgaacttttc taaagataaa     78240
     aatggaaaat ttgtcccttt aagcacacaa aaaataaaaa atattgaaca tttaatacga     78300
     gaagcaatag gatattcgaa agctcgagga gatagtgttc atcttgttaa tgcatcattt     78360
     gctaaatatg atcaaaaaat accagttcat ataaatcata taaatacttt tagaaaatca     78420
     aattttttat ataattttgc accatggttt tgttcttttg cacttctttt tcttttatta     78480
     aaaaagtaca tatgtccttt ttcaaaaaat aatacgtttc aaaatacaat acctgtacaa     78540
     gaaaaaaaaa gtatagatac acgtaatatt atagaaaaaa atacttttca agtagatctt     78600
     caaaataata ctaatacaga taaattaatt cataaaattt gtaatatatc taatcagaat     78660
     ccacgtacta tagcgttgat tattcgtcaa tggatgagtg ataaaatatg attgtaaatg     78720
     gtactgaaaa aagtgcgttg ttattaatgg caataggttc tgatcaagca ggggaaatat     78780
     taaaacattt aactcctttt gaagtgcaag aactaattac cgctatggta aatattaaac     78840
     gagtttctgc tcaaaaatta aatgaaatat tactacagtg ttataacctt gcaataaaaa     78900
     acaatgcatt taactgtaat aatagtgata aatatcttat taagatgcta actaaagcat     78960
     taggagaaaa aaaaggcacg tctcttttaa aagaggcttt agaaattcga aatgctagga     79020
     tttgcattaa agctcttaat tatatgaaag caaaacaagt ggctttttta ttagataaag     79080
     agcatcctca aattattact acaatactca tatgtctaaa taaaaatcaa tcagctgaag     79140
     ttctttcgtt tcttagtgat aaaaaacgtg ctgaaattat tttaagaatt gtagattttc     79200
     atggtattga agagtctagt ttagtggaat taactcaggt gattaacaat ttattaaaaa     79260
     ataaaaaatt aattttatca gaaaaaggag ggataaaaac tgccgctcaa attttaaatt     79320
     cgatgaaaat aaagcatgag aaagaaatta tagaaaatat tagtaaatct aacgaacaat     79380
     tagcagataa aattattaaa gaaatttttt tatttgaaaa tttagtagat ttagatgata     79440
     aatatattaa aattttactt gaaaatatcg aaaaagaaaa actacacatt gcgcttcaaa     79500
     atactagtca agcaatcaga gaaaagtttt ttaaaaacat gtctcataca gagtctaacg     79560
     aactaacttt aaatttagaa aaaaaatctt atatttctga tatttctata aaaaatgaac     79620
     aaaaactgat tttaataatg cttaaaagca ttgtagaaaa cggaagaatt tcattaaaaa     79680
     atttaagaga atattatgtc taatttaatc ttagaaaaaa aatggacgaa atggtatccg     79740
     gaaaatatat cttttaaaaa tacaaaaaaa attaaaaaaa ttttatgttc ttctaataat     79800
     tttaaaaaag aagatttttt tatagataaa aaaaatcaaa aagatcttac ttttagcaaa     79860
     gaaacgtcag agataaattt aacacaaaaa aaagcatatg aaacaggttt ccaaacagga     79920
     cttctaaaag gcaaagagga gaacactttg ttgaaaaata aattaaatga tttattttta     79980
     aattttgaaa attctcttgc taaatttgaa aatgaactat gttctcaatt actaaaaaca     80040
     gttttaaaaa tttcatctta tgtaattggg aaaaaaattg atatagataa acaaatttta     80100
     ttaaattaca taaaaaaaat aattaataaa gagggtgttt tcttaaaaaa accacagttt     80160
     ataatccatc ctaaaaataa aacactaata gaagatattt ttaaaaaatt tttaaatagt     80220
     cacaaatgga ctatagtttg tgacgacggt atagacttaa atggttgtaa aattaaatca     80280
     gaaagtgtgg atatagatgc gaccgtagat gctagatggc agcaattatg tcgtcttatt     80340
     tatttagagg aatattaatg aatttaagat ttgctcaatt tttaaaaaat atttcttctt     80400
     ttgaaagtag aattgagaag ctatctgata ttattaatta tggtcgtctt gttagtatta     80460
     atggattaat tttagaggtg gtaggattga acacatctat tggttcagaa tgtttaattg     80520
     aaagaacaat agatggtaaa aatgcgaata ttaatgctga agtgataggt ttttcgggag     80580
     aaaaaacttt tttattatct tttgaagaca ttcatggtat ttttcccgga gcacgtgttt     80640
     tttcaaaaat agctagcaat agcaattttt ttataaaaaa attgccatta ggtatggaat     80700
     tactaggtag agtgttagat ggacgaggtc aaccattaga tcaattgcct aaaattgatc     80760
     ataagtatta ttctacgata aaaaattata gtattaatcc attgaataga actccaatta     80820
     ctgaagtatt agatactgga atacgcgcta ttaatggact tttaactatt ggaagaggtc     80880
     aaaaaatagg gattttttcc agttctggta ttggtaaaag cattttactc ggaatgatag     80940
     cacgatatac acaagctgac attattgtta ttgctttaat aggagaacga ggtcgagaag     81000
     taaaagattt tatagaaaat atattaggtt tagcagggtt atcacgttca gtaattatcg     81060
     ccgctcctgc agatgtatct cctttattaa aaataaaagc agcatcttat gctactaata     81120
     ttgcagaata tttttataaa aataataaac atgtattgct tattatggat tcattgactc     81180
     gctatgctat ggcacaacga gaaatttcat tgtctctagg agagctacct gtctctaaag     81240
     gttatccatc ttctatattt tcaaaaattc ctaatttaat agaaagaacg ggcatattta     81300
     ataaaaacaa aggatctatt acttcatttt acacagtttt aactgaaggt gaagatgaac     81360
     aagatccagt ttcacatctt gctcgttctg tattagatgg acatattatg ttgtcgcgtt     81420
     attatgctga tttaggccat tatcctgcta ttgatattga atcttctatt agtcgtgtta     81480
     tgcctaacat tattaatgct aaacaatatt ctcaagcttt ttattttaaa aaactagttg     81540
     cgtcttatca aagaaatcga gatttaatta atataggggc ttatgtgagt ggcactgatg     81600
     taattttaga tcatgcgatt aaaatttggc caaaattaga aaaattctta cagcaagaaa     81660
     tctcagaaaa aagtgattat cttttttctt gtgaagcatt aaataaaata tttatttaat     81720
     atttaaagaa actggatatg atatgttaat gaaacataaa acattttctc ttttggaaaa     81780
     gatagaaaaa aagaaaatag aaaaagaaac aattaagatt aaaaatattt atttgcataa     81840
     aaaaaagcat atcaaacaat taaaactact tagtggttat caacaagaat atttaagaaa     81900
     aatacatgat aaattaatat taggtgtgtc ggtacatcaa tggcaaaact ataatagttt     81960
     tatttctgta ttagaagtaa ttattcaaga taatataaat acaatcaaaa aagacgagaa     82020
     aataattcaa gaaagtttta aaatatggtc gaaaaatcaa attcaaggta atatttggaa     82080
     acatttaaat atgatacata aaaggaaaat attaagaata aaaaaaataa aggacgcaat     82140
     tatcaatgat agtcatattc aattaaaatt ttttaaaaag gtgtagtcat tgtaatgata     82200
     gaaataatta gcaatataac atcgcaagat aacgtttcga ctaataaaaa taatagtttc     82260
     tttaatatta ttaattcatc atatttatta aaatctactt ttagtagatt taatcaatat     82320
     tttctaaata aaaaaataga atttgatcat attattgcag aagaaaaaaa agagaacaag     82380
     gataaaattg ttatttcctc tcattttata gttaattatt tattaaatat tttaaatcaa     82440
     aaaaatacag attttaattc caaaaacttt aataattcta aaaatgatca aataaaaaaa     82500
     aaaaaaatag ataacaacca ggttaattta taaaaaacgg ggcatttttt tagaaacaca     82560
     aaaaatacca cagaaaaaaa atttttaaga gaactattta aacataaaaa taatttcaat     82620
     aaaattcatg aatcaagtaa tattaaaaaa aaaaatgatt tcgactttaa aaatctaaaa     82680
     aataaaacac ttcaaaaaaa aataaatgtt tttgacacca ttaaaaatca cataaaaatt     82740
     ataaataacg aagaaaaaat tattttgcca ttaaatatta aaaaaaataa aaagattgta     82800
     tttgattcta aaaatatcaa taaaatcaat cccatgatca gtaaaagaca ttcatgtaaa     82860
     attctttcta ataaaaagga atttataaaa tcatatatag aaccatttat gtcgagcgac     82920
     acaaaaaatt ctattgaatg gaaaaaatta attagtcata aaatactttt atcaatttct     82980
     aataagtaca atcaagctaa gatacatttg aaaccggaat cgctagggtc tatatatgta     83040
     tcaattagca tgaaaaataa tattgccaca ttaaaattta tttctgaaca taatgaagtc     83100
     aaaacatttt tagacagtta tatgcctttt ttgtataatt cattaaagaa aaatggaatt     83160
     aaattaaaag aatttaagat ttctatttct tcaaaaaaaa accagttaaa aaattataaa     83220
     aacttatttt ataaaaatat ttattacaca gatcatatca agaaaacatt aaattggaat     83280
     gaaaaaaaaa tagactatat aaaagataaa acaattgatg tatatgttta ataaataata     83340
     taaaatattt attcaaaaaa taatgatact attcgatata aaaaatcaag cgtgttagct     83400
     tgtcttttaa taacttttac ctgtgaggca tgtaaaatgg gggaaagtaa gaatctacat     83460
     gatgaaatta aaatattaga aaagattaat cgtcattttt cagatgaatt tacaaaattt     83520
     ttttctaatt tccttaaaaa tagcgtggaa ttagtttcct gtagtataaa aataggatct     83580
     tgcacttcta ataaagaaat tataaccaac ctaagatgtc ttaatttaat agaaatatta     83640
     ccttataaaa aaaaatcttt tataattttt ccctataatt ttttgtctaa tattatagat     83700
     attttatttg gaggccaggg tgattttaaa gatcatacta aaaaaataag agatattact     83760
     tctactgagt ctttagttaa taaaaaaata atgaaattta taacaaatgc tttttctgaa     83820
     atttacaaga agtattttgt aaaagaaata aattttttca atacaaaaac attttttgat     83880
     tttaaaaaat ataactttga tcttaacaaa ttatttttaa ttaattgttt taattttaaa     83940
     attaataata cagaaatttt ttttaatttt ttaattccca aatcaatact aaaatatcaa     84000
     aatgagaaaa aatttttttc tacatatgat agtcataaaa atacatgtat agaaaaaaat     84060
     attgagaata aagtatcttt aaatgatata tacaatgttg aagtaaatat tatatctaaa     84120
     ataattggta tttctgtttc gtatgataag atttataatt tatcaatagg agatgtttta     84180
     tcaattaaaa aacctaataa aattacagga tttatccaag atcaagctat atttcttggt     84240
     aattataaga ggtttaatga acagtctatt atttttatag aagagtttat tgactctagt     84300
     tcagagtcta atcaagataa ggaatactct aatgagtaag atacagaaaa actctgataa     84360
     tgacaaatta attgattctg aaaaaaaaat acctacagat caagatgttg acaaaaattt     84420
     attaccccaa gaaaattcaa aaaatagtac attagataat actattgata tagtagacag     84480
     caaaaaaaca atacttaatg tacctgttaa tattactgta gaattaggaa catcaagaat     84540
     aaaaataaaa gattttctta aattttcaaa aggaagcatg ttaattttaa atgaatcaat     84600
     taaagaacca ttaaatattt ttatgaatgg tcatttaatt gcatctggag aaattgtagt     84660
     tttagaagaa aaatacggaa tacgtattac taatataaaa aattccttaa aaactataaa     84720
     tatttcatct taaataaaaa ttttatgaaa aataatttgt tttttcaatc aatatcaaat     84780
     tctcttcatc caatatttaa cagtgaaaaa tttttacaaa taatgagttc attgtctgaa     84840
     ataatattgc taatattaat ttttagttgg atcttaaaaa agatttcttc ttttaaaatt     84900
     aacaagataa tatctcgtat gaaaattata gaaagattgt ctgttggatc tcaagaatct     84960
     attattcttg tagaagttaa acaattaaga ttattattag gtgtgacaaa aaaaaatatt     85020
     agtcatttgc atacgtttcc gtctaattca aaagatgaac taattaaaga aacaaatgat     85080
     actttgttgc aaaaaaatct ttttgatcgt tctttgaaaa atttttctaa aacatcctgg     85140
     aaaaaaacaa tgttttatag aattattcca tttgtatttt tattgtcact ttgcccttcc     85200
     gcgcatgcag atatgcctgg tttaacaagt catattttag atgatggcag tcaaacttgg     85260
     tctgtaccag tgcaaacatt agtttttttg acatctctga cttttcttcc agcatttctt     85320
     ttgatgatga ccagctttac aaggatcgtg attgtttttg gtctattacg aaatgcattg     85380
     ggaactccat atgcaccacc aaatcaaata ttacttggtt tagctctttt tttaactttt     85440
     ttcataatgt ctcctacatt tgaaaaaatc tataaagatg cttatgtacc atttagtcaa     85500
     gaaaaaatga atatggaaga cgctatttta aaaggttcaa tgccattaaa gaaattcatg     85560
     ttaaatcaaa tacgtacacc tgatttagaa ttgttttcaa aattagccca tatttcttct     85620
     tataaaaata aaaatgatat accaatgcga attttattgc cttcatttat tacaagtgaa     85680
     ttaaaaacag cttttcaaat tggatttact atttttatac cttttttaat tattgatttg     85740
     gttgtagcta gtgtattaat ggctcttggt atgatgatgg taccaccttc aacaatttcc     85800
     ttgcctttta aattaatgtt gtttgttcta gtagacggat ggcaactatt aattacttca     85860
     ttagcacata gttttaatac ataatatttt tataaaatat tttttgttta ttacaaataa     85920
     ttttaaatca actttaaaaa tggagatgtt tatttatgac atccgaatat gtaatggaat     85980
     tattttataa tgctatgaaa gttgccttga ttattgcatc accattatta ttggcagctt     86040
     taattagtgg tttaattatc agtatattac aagcagctac acaagtgaat gaacaaactt     86100
     tatcttttat acctaaaatt atttctgttt taggcgtaat atcaatactt ggaccttgga     86160
     tgttaggtgt tatgctggat tatatgcata atttatttaa taacataata ttgattatca     86220
     aataatgtta acatttaaca gtttacaatt gataacttta attagtaatt ttttttggcc     86280
     tatgataaga gttttatctt ttttttctgt tgcacctatt tttaaggaaa aactgataaa     86340
     taggaagagc aaaattcttt tgtctggtat gattagttgg ttagtatggc cctttttgcc     86400
     tgaagttcat acagtattat tttcatactt tggattttta ttgattttac aacaaatatt     86460
     aattggtatt gttttgggtt ttactgcaca attattgttt gctacaataa atttatccgg     86520
     tgaaataata ggcttacaaa tgggtctatc atttgcaacc ttttttaata ataatagtca     86580
     aattggcacc tctataatat ctcgtttttt gaatatttta gctttgtttg tatttataac     86640
     tcttaatatg catctttatt taatttcgat agtaattgat agtttttata gtatgcctat     86700
     tgatggttat tttttaaatg taaatatttt ttttatttta ttaaaatttt ctagttctat     86760
     ttttttaaac ggtcttttat tagttttacc aattatgatt attttattat ctattagttt     86820
     tgtaatgagc ttattaaatc gtttatctcc tcagatatct attttttcca ttggttttcc     86880
     tttaaattta atattaggga tgttaatgtt atatttttta atacctgtta tgctgccttt     86940
     tttaaaaaaa attttagatg atttgatatt ttttatgaat aataatcttt tacatatata     87000
     gttttaattt tttctatata atttaaaaat atacttgttt catatgaatg tatatcttat     87060
     gaattttaat atttaaaaaa tttctacaaa taaagtataa ttttttaaaa aaattatact     87120
     ttaattttta gtgtaaaaaa atagattatt tttttattta atttttcctt cattatataa     87180
     gatgtgttta cgaattacag gatcatattt ttttaatttt aatttatctg gtgtgtttct     87240
     tttattttta gtcgtggtgt aatagtgtcc agttcctgca gaagatatca tttttatttt     87300
     ttcacgagat tttttagcca ttgattcacc tttatttttt catatttatt tttcttatta     87360
     ctgtttcaat tcctttttta tcaatataac gcataccatt ggtcgaaaca tgtaacttaa     87420
     taaatctttt ttcatcagca atccaaaatc gatggtattg aatgtttatt aaaaattttc     87480
     ttttggtggc atttaaagcg tgagaacgat tattgccaat cattcttttt ttacctgtga     87540
     tctgacatat acgtgacatg aggtgttctc tcaaattaat atttgatatt attttaaatt     87600
     aaaaaacatt ataattttta ctttttataa agtagagaac aatattttaa catattataa     87660
     aaaactataa tagttgttta atttttcacg tgttttatga agtgaatata atatgttata     87720
     aaattaaaat gagttctaat ataatagaaa tatattataa aaacatgcaa aaaaatagtt     87780
     ttcaagtaga aaaatatcgt ctttttttta tttttaatat aaaatatatg atgttaacta     87840
     ttagttaatt tattataaat taatttttat atttataatt taatactaaa tcaggacaat     87900
     ttttatgagt atatatcgga gatatatatc taaatctgta attttttttt ctgttttctt     87960
     tgttatattt tttttattta tagaaagcag tgttggtttt aaatatattt ttaattttac     88020
     gaatcgtatt tttataggat tgaaagcaga agaaatatca ggaaattggc gtgattttac     88080
     attaaaaaat attaaatatg atgtttttgg aatctccata acagctaata gtttacatat     88140
     agtattagac actagatctt tatttaaaat gtcaacaatt ttcaaaaaga ttgagacaaa     88200
     aaatgtaata ctttcattaa aaaaaaatac cgcttctaat ttttcacaaa acagcctacc     88260
     ctctaagatt tcaaaaaaca ttttttttat aaaatatccg attattttaa aaaaaataca     88320
     tgcagataaa attcttttta catcacctaa agtacgtgta tcttttttag atgttttaag     88380
     tggcataaaa ttggttagaa ataatattat tttttcacct acttatataa atactattca     88440
     tgtatcgtct gcaaaattta attttgaaaa aaaaaatatt ttaaataaat caactattat     88500
     taaaaatttt aataaaatta aaaaaatata tagtttttcg tatttttctt caaatcaaac     88560
     aaaaaaaaat tttccattaa atatttattt gaagtcttta aaatgcaata aaacacaatt     88620
     tatagattat gaatataaga atctattgca agtagagtta caagctaata tagaaaataa     88680
     tattttacaa ataaataaaa tgaaagtaga ttcttccttt ttaaagatga attcttatgg     88740
     aaaagttatt tttaataatg attattctat ttcatgtgtg atgaatagta aaacagtaat     88800
     accaagcttg tataataaaa gtataaattt tcaacttaaa gccaatttta acgtagatca     88860
     tcaattaata tttaaattaa tctctaaaga tttatataat atgaaaatta atggtttagt     88920
     atttttaaat ttttcagatt atccattttt tataaaatta cagagtcgta atttatcttg     88980
     tgtaattaaa aaaaattata tatttaaatt aaaaagtttt gatggtgttt taaaaggata     89040
     tattaataat tatttttttt ctttaaaaaa tatttttact ttacaagatt tgcctccaat     89100
     tttcattgat attcaaggga gaggtgattt aaataatatt tttttaaaaa aaattaattt     89160
     ttttccgatc aaacaaaaaa aattttataa aaaagtaatt catccagaag attatataaa     89220
     atacaatcaa tatatattaa aattaatagg acaaattaac atcacaggaa aatctgatag     89280
     acatacacat tatgtacata tccctaaaat agatttatat gctaatataa tgaaaaaaaa     89340
     attatctata ttaggcgctt tatattataa aaattttaat tttatagaaa ctcctgggat     89400
     aaatttactt ttaggaaaaa ataaactgta tttaagaggt tcattaggaa aaaaatataa     89460
     tatttattca tctatttatg cgaataattt agattatttt tttcctaaat tacaaggtag     89520
     aatgcaagct aaagtgaatt ttctaggaaa taataaattt cctattatat ctagcaaaat     89580
     tttagctcga gacttaaatt ggaacaacat atattttaag aatattaaag tacttacggg     89640
     aataaatatt aataatacat tttcaggaaa aatgttaata tatgcaaata aaattcattt     89700
     ttataaattt tatattaata ctttacatat tcaaacttat tcgaataatc ataaacaaaa     89760
     tttttctttt ttattaaaaa gtaatcgatt acatataaat ttaataataa atggagcttt     89820
     taataataag acaggacatt ggcatggttt ttttaaaaaa ataaatattc gtactttttg     89880
     ggggcaagtt actgcaaaaa aaaataattt tattcattat tatgattctc ataacagtat     89940
     cactaatttt tatcaaaaaa gtatcaaaaa aaggaattgt ttttcatctt ttttatacaa     90000
     tgtaaagatg tcttttttta atttatttaa tagatccttc attagttttg aaagtaaatt     90060
     atctattaat gcaaaattaa aattaatatt aggaaaaatg atttctgatg gtgcaatttt     90120
     tttaaaaggc aataatacga aattagaaaa aaaaattaat aaaaaaattt ttattcaaaa     90180
     tatagatttt tttaaaatat ctatgaattt aataaaaaat gattttaaaa gtaaatggat     90240
     aataaaaaaa aataaaaaat tatcgaataa taaaaatatt tttgggtatt taaacattat     90300
     agacatttac aacaaaaaaa acataaaagg tgaatttatc ttttataaat ttcctttttc     90360
     ttttataaat ttttttacta caaattttaa agaagttagt ggtaagtttc aaagtaaaat     90420
     aaaattattt ggaactttat atcagcctaa agttttggcc gatgtacatt ttaaaaatat     90480
     ttttattaga agtaacaaca tattaaagta tataacttta ttttttcctt attttttagg     90540
     aaaagtagat aatataaaga ttaatcaaga aataatgatg aataaaggaa atatattatt     90600
     tacattaaaa ccatttttca aaaataactc tgctgatata gaatggaata ttgcatttaa     90660
     tagcaaaaaa atatcagtat taatttttcc aaaaataaag gtaaaatttt cttcgaaatt     90720
     aaatttgcat tatttatttt caaaatatga cttaattgga tatataaaat tttccttatt     90780
     ttactttcaa attaacgaaa aaaattttat tttttaatgt tatcaaaaaa tatcacttat     90840
     ttaaaaagat actatttttt ttagcacggt tatatgcatc attaatttct aattttgcat     90900
     cttgacagtt tccccatcca ataatttcca cccatttttc tttttctaat gttttataat     90960
     tctgaaaaaa atgagtaatt tgctttttta acaattctga tatatctgat atatcattta     91020
     tgtttttata ttcttggcaa attttacttt tgggtactgc tattatttta gcatcatcac     91080
     ctgattcatc ttgcatattt aatatcccaa taggtttaca atgaatgaca cagctagact     91140
     ttattgggta atgagaaggt actaaaacat ctaagggatc accatctaaa gataaagtat     91200
     gattaatata accatagtta cagggataga acattggagt aggtataaaa cgatcgacaa     91260
     aaagcattcc tgatttttta tctacctcat atttaatagg ggatgaattt gatgaaattt     91320
     ctataataac atatatatca tttggtatat catcaccagc aacaatttta tttaaattca     91380
     ttttttttcc ttattaatac tttgtgatta ttttatataa ttttaagata agtagatgag     91440
     tttatagttt taaataaatt ttaacatcga agaataatta tatctacgtt ttgtacaaag     91500
     taatgtgttt taattttgaa tgttttttaa tataatattt atatacaaaa aacatgttgt     91560
     aaggatttat atatatgcaa ttaattaaag aaatagaaaa cgaagaatta catcttgtga     91620
     atacagtaaa aaacactctt aaactatcta aaaatattaa tgcctctgta gaagtattta     91680
     taaaaaaaac aataggtatt agtgttaatg taagaaataa tgttgttgaa aatgtagagt     91740
     ttaatagcga tggtggattg tttataacag tatataataa gttctctaaa ggtagtgttt     91800
     catctaaaga ttttagtatt aagaacatta aaaatatgtt agacatagct attaatattt     91860
     caaaatattc ttcttctgat tttttctcag gtttgccgga cataaaattt ttatgctttc     91920
     attctatgga acttgatttg tttcatccgt gggaatttaa catagaaaat gccattaaga     91980
     tgtctatatt atcagaaaaa tcagcttttg aatctgataa aaggattgtt aatagtgaag     92040
     gaagtttttt aaatagtcat acaactataa atgtttttgg aaacagtcta ggtgtgttag     92100
     aaaaatataa atctactcgt tattctaatt atacttgtat gatcgctaaa gataaaaatt     92160
     ctatgcaaag agattttgat tattctcttt caagaagaat tgatgattta ataaaaccag     92220
     aaattttagg tcaaaaaaca gctaaacgag ctatatctag attaggttct cgaaaaatac     92280
     aaactatgag atctccaatt attttttcat cagaaatatc tcacatgttt ttttcacatc     92340
     ttgctagtgc gattagcggt gataatgttt atcaaaaatc tacattttta attaatgatc     92400
     tgaaaatgaa aatctttccc gattggcttg atattgaaga aaatccacat ttaaaacgag     92460
     gtttgggtag taaacctttt gataatgaag gtgtagctac agaaattaaa tatattatta     92520
     aagctggaat cttacaaact tggttattaa attgctacaa tgctcgtaaa cttaaattag     92580
     acagtacagg aaattgtggt ggaattcaca attggttagt ttcgaatcaa aatatatctt     92640
     ttgaagaact tttaaaaaag atggatcaag gtatattagt aacagaatta atgggacaag     92700
     gtgtagatat tataaatggt aattattcac gtggagcagt aggtttttgg gttgaaaaag     92760
     gaaaaatttc ttatcctatt aatgaaatta ctatatctgg aaatttaaga aatatgtgga     92820
     ataatatcgt gagtattagc agtgatgttg atagacgtaa taatattcaa tgtggttcgg     92880
     tattattatc tgaaattcag gtttctggaa attaacttat attgtttaat tttaaataat     92940
     gaactaaagg taataaattt attaccttta taaaaatatt tctagttatt gaagttgact     93000
     cgtgtaagcc gggttctgtt ttaacagtca ttcatctaga ttagcaatca cttactaatt     93060
     caagcagcct acccaggttt aagaagtacg agcagtacaa aaaatttatc ctatatttgg     93120
     ctttgctccg ggtggagttt accatgccat gaattgttac caattatgcg gtgtgctctt     93180
     accacgcctt ttcaccctgg ccatattttt atatattaca aaataggtgg tttattttct     93240
     gttgcactag tcataagctc acgctttcca gatgttatct ggcaccctgc tctatggagc     93300
     ccggactttc ctctttttaa tttttaaaaa ctaaacagcg actgttttta gtcaacttca     93360
     aaatcaaatt atacattatt ttaataattt tgtcactctt ctttttttat tacatattga     93420
     tataatttat ttttattaat atcatgtatt tgtgcagtaa ttaaaactga tgtttttaat     93480
     gaaaaaaact ttcttaatat tgaaaatgta tctaatattt tttttgatag agtataattt     93540
     tttaattttt taaaaccatc aatgataatt accatttctc ctttataacg atatttattt     93600
     tctttaagcc attcaagtat taaacttgct tttgcaccat aaatagattc ccattttttt     93660
     gtcatttctc ttgctattac tatatgtcga tttttatcta tttgttctat tatatctttt     93720
     atactttcaa gtatcctgtg ttttgattca taaaaaataa ttgttcgtgt ttcttctttt     93780
     aaagaatgta gtaaatcaca tcttgatttt tttctagaag gcaaaaagcc ttcgtagcaa     93840
     aaacgattat ttattattcc agaagcgctt aatgccgtga tagcagcaca agcacctgga     93900
     agaggaatta cttttatatc aaaaatatga cattgtttta ttaatataca accaggatca     93960
     ttaataatcg gtgtgcctgc attagaaact aaagcaattt ttttcccttt tttcagttct     94020
     tggatcaaat tatgactttg ttttttttca ttatctttgt tcattaatat taaattattt     94080
     ttaatattaa aatgttgaag taaaatatta gtgtgtctga tgttttcagc ggcgattata     94140
     tcaacatctt ttaacacttc taatgctcta taagtaatat ctgatagatt accgatagga     94200
     gtaggtacaa tataaagaat accaatataa aattcattca ttttttttcc ataaaatatt     94260
     attatatatg tgataatagt taagattaat caaacatttt atttaaatat aaaatttttt     94320
     tattttttta ttctaatttt aattgaatat ataagttttt gtaaatgtaa ggacaaaaag     94380
     tgagacgagt agttataaca ggcattggga ttgtttctag cattggtaat aataaaaaag     94440
     aagtactagc ttctttatat aaaggtgttt ctggtattgt ttcttcagaa gaaatgaaaa     94500
     aattaggcat gcgtagtgca gtttggggta atattaaatt agaaagtata aacataataa     94560
     cacaaaaatt atctcgcttt atgaataatg cttctagata ttcttttgtt gctatgatgg     94620
     aagctattaa agatgctaag atagatagag aatattatca aaaaaatcct cgtgttggac     94680
     taatttctgg atcaggatgt agtttttcaa aaaatacttt aacatctgat attcatctca     94740
     tgaaaaataa acatatttca aaaggcatca gtccgtatct tgcagttaaa acgatgcctt     94800
     ctggaatatc agcttgctta tctactctgt ttaaaattta tggggtcact tattctataa     94860
     gttccgcttg cgcaacctct gcacattgta tcggaaacgc atttgaatta attcaattcg     94920
     gtaggcaaga tcttattttt gcaggtggag gagaggaaat aagtttagaa ctagcaatgc     94980
     aatttgatgc aatgagagct ttgtctacgt gttttaataa tgaccccaaa aaagcatcac     95040
     gtgtctatga tgtatatcgt gatggttttg ttatttcagg tggagcaggt atgctagtaa     95100
     ttgaggaatt gaattcagct ttatctcgtt ctgcttatat ttatgcagaa attattggat     95160
     atgcagccac atctgatggt tcaaatatag ttgtaccttc aggagatgga gcaattcgtt     95220
     gtatgaattt agctagaaaa ggtaaaaata ttcctattga ttatcttaat gtacatggta     95280
     ctggaacaaa aattggtgat ttaatagaat tagaagcaat tagaaaagta ttcttaaatg     95340
     aaaaaaaacc aatgatttct gcaacaaagt caatgactgg ccatggatta ggagcttcag     95400
     gagtacatga aatgatttat acactattaa tgttaaaata taattttata gctcctacaa     95460
     tcaatataga aaatttagaa ccttgtgcgg aaaatatgaa tattattcaa aaaactacaa     95520
     atatagaaat taatacagct atgtctaata gttttggttt cggtggaact aacgtgtcac     95580
     taatagtaaa aaaatattaa tatactatca ataattgaaa tattttttaa aaatcttttt     95640
     ctatttaaaa aacatatttt ttatatatct gactagtatt ttttaaaaaa atcattttaa     95700
     tatttttttg atattaaaat gattttttat tcttaatata tattattcag tttatataaa     95760
     ataaaaaata tatttatgaa atctaattta tttatttttt gatttaaatt tttttattga     95820
     aaaacaagag agattaaata tgaatcaatt gagtgctttg aaacaatttt ctattattgt     95880
     tgcagatact agtgatataa aatctatttg taaataccaa ccagaagatg ccactaccaa     95940
     cccatcttta atactacaag cagtaagttc taatactaat caaaattttg tagatcaagc     96000
     tgtgcaatat gcaaaaaaga aaggagggct atataaagat cagatcatca atgcaagtga     96060
     taaaatatta gtagatttag gaatagaaat tctaaaaaaa ataccaggtt atatttcaag     96120
     cgaagtagat gctcgtttat cttttagtac agaggcgtct attttaaaag caaaaaaaat     96180
     aattgattta tatgaagaac aagggatttc taggaataga gtcttaatta aattagctgc     96240
     tacatgggaa tgtataaagg ctgcagaaga acttaaaaaa gatagtattc tttgtaattt     96300
     aactctttta ttttcctttg ctcaagcgcg tgcttgcgcg gaatcaaatg tgtttttaat     96360
     atctcctttt gtcggacgta tttatgattg gtatatttca caaaatttac tatctaaatc     96420
     ttttttagga aaagatcctg gtgtaatatc tgtttgtaaa atatatgaat attataaaaa     96480
     gtatggctat aaaacgatta tcatgggggc tagcttccgt aacattcaac aaatattata     96540
     tttatctgga tgtgatcggt taactatttc acctgtttta ttaaaagaac tcgaatctaa     96600
     tactgcaaaa attgatagaa atcttgctcc tcctagtttt atttcagtcc ctccagtagc     96660
     actttctgaa gaagagtttc gatgggaaca taatcaagat gctatggcgg ttcaaaaatt     96720
     atctgacggc atacgaaatt ttggaaaaga tcaattacgt ttagagaaaa tattttctaa     96780
     aaaaatataa ataatataaa aaaataaagt ttgactaata tttttaaatt gataaggaaa     96840
     atctatgtat tcacgaaaag aattagctaa tgcaattcgt atgttaagta tagatgctgt     96900
     acaaaatgca caatcaggac atcctggtat gccgatggga atggcagata ttgctgaagt     96960
     gttatggaga agttttttaa aacataatcc agcaaatcct aattggaatg atcgcgatcg     97020
     ttttatatta tctaacggac atggttctat gttgctctat agtttgttgc atcttacagg     97080
     ctataatcta ccgatcgaag aattaaaaaa atttagacaa ctgaattcaa aaactccagg     97140
     acatcctgaa acaggtgaaa cacctggtgt agaaacaact actggtccat tgggacaagg     97200
     gttagcaaat gctgttggta tggctattgc agaaagaact ttaagttctt attttaatcg     97260
     accaggatat gatataatta atcattatac ttgggttttt gtaggcgacg gttgcttaat     97320
     ggagggtatt tctcacgaag tctgttcttt agcaggaact ttaaatcttg gaaaattaat     97380
     cgttttttat gataaaaatg gtatttcgat agatgggaaa acagctcact ggttcaccga     97440
     tgatacagca aaacgttttg aatcttataa ttggcatgta ttagataata tagatggtca     97500
     tgattcagaa tctatagaaa gaagtataaa acaagcaaaa ttaataacaa atcaaccttc     97560
     tattattatt tgcaatacta ttattggttt tggttctcct aataaatcag gaacagcaga     97620
     atcacatgga gctcctctag gtgaggttga aatttcttta attcgagaac aattgaaatg     97680
     gaattatcct ccttttcaga tacctaaaga aatttataaa aaatggaatt ttatagaaga     97740
     aggatctaaa cttgaaaaga aatggaacga aaaattttct ttatatcaat ccaaatatcc     97800
     tgatttatcg actgaatatt tgcggcgaat aaataaaaaa ttacctgttg agtgggatag     97860
     agtaactaat aattacattt cttttttaca aaaaaataga caaagtattg ctagtcgtaa     97920
     agcttctcaa aatacattag aaaaatatgc gatgatttta cctgagttaa tcggtggttc     97980
     agcagattta tcaccgagca atctcactat gtggtctaga tgtaattcca ttaaagataa     98040
     tttatctgga aactatattc attatggagt acgtgaattt ggaatgaccg ctattgcaaa     98100
     tggcatatct catcatggag gttttatacc ttatactgct acatttttaa tgtttgtcga     98160
     atatgcacga aatgcagttc gtatggctgc tttaatgtgt accaaacata tttttgtgta     98220
     tactcacgat tctattggac tgggtgaaga tggtcctaca catcaaccag tagaacaatt     98280
     atctagtttg agaataactc ctaatataga tgtatggaga cctagtgacc aagtagaaac     98340
     agctgttgct tggaaaaaag ctattgaaaa aacatcagga cctacagcat taattttatc     98400
     acgtcaaaat cttgatcaat ttgagagaag ttctgaacaa ttagaaaaca tttcttatgg     98460
     agcatatata ttatatgatt caaaaaaaag acttgatatt atctttatat caactggatc     98520
     agaattaaat gttactttaa ttgctgcaaa aaaattggct tctttagggt attctgtacg     98580
     tgttgtatct atgccctgta ctagtgtttt tgatagacaa gatgcttctt ataaagaatt     98640
     tgtattaccg acttatgttg ctaaaagggt tgctgttgaa gctagtatag aagatttttg     98700
     gtataaatac gtagggataa atggtgtaat tattggaatg aaaacatttg gtgaatctgc     98760
     tccagcagaa gatttattta aaaaatttgg ttttactgta caaaatatct tcaataaatc     98820
     attaatttta ttaaaatctt aatttattta aaaattttaa atatttatgg ggctcaatta     98880
     tagccccatc ttttatgaaa aataaaaata atatttatca atagaaatat taaattagga     98940
     aaaaatatga cttgttctat tactgaatta gcaaaaaaac taatttctat tccttctgtt     99000
     agtccaaaag atttaggttg tcaagatatt ataataaaac gtttatgtgc aataggattt     99060
     gacattaaaa gagtaaatgt taatgataca aaaaattttt gggcttttag aggtacaggt     99120
     aaaacattaa catttgcagg acatacagat gtagttccaa taggtcaaga taaagattgg     99180
     caaactgatc cttttcaacc agtcatacga agtggatatt tatttggcag aggttctgct     99240
     gatatgaagg gtgctttagc agcaatgatt actgcggctg aaagatttgt aaataagttt     99300
     ccaaatcata aaggacgttt gtcttttctt attacttcag acgaagagtc tagtgcagtt     99360
     gatggaacaa ttaaaatagt agaatattta atgtctaaaa gggatatgat tgattattgt     99420
     atagtaggag aaccctctag tactaatata gtgggtgatg ttataaaaaa tggtcgacgt     99480
     ggttcaatta cagctaatat aactatttat ggaatacagg ggcatattgc atatcctgat     99540
     ttagcagata atccaataca taaagggtta cctgttattt taaaaatatt gtctataaaa     99600
     ttagattctg gaaatgactt ttttttacct agcagcataa atattgcaaa tattcatgca     99660
     ggaaatggat ttaataatgt gattccagga tctctatttg ttcaatttaa tattagattt     99720
     agttccgaag tttctgaaaa acacattcaa tctcaaatag taaatatatt aaattcaaat     99780
     gatattaatt attctataga atggttattt tcaggaaaac catttatcac taaaaaaggt     99840
     ttattgatag acacagtgat acaatctatt ttttatttta acaaaaaaaa gcctatttta     99900
     tctacttctg gtggcacttc tgacggtcga tttattgctt taatgggttc tgaagtagta     99960
     gagttaggat tagtcaataa tacaattcat aaagttaatg aatgtgtcaa aatatctgat    100020
     ttaaaattat taagctgtat gtatgaagat attatgaaaa atttattatc ttaatttttc    100080
     aacaaaaata tttataaaaa aacatttttt atatttttta taaatgatgc agaatatcat    100140
     agagatagtc tgcaccaatt attacgcatg aatatttagt ataaaaaata ttttcttaaa    100200
     tattattatt atttttaata tattatatat tttataccgg tggaaatata tcataatttt    100260
     cttttttgag atctttatct tgatagggaa tgctatattc ttcttttttt ttagggctgc    100320
     taattccttt cggaataatc aatctacgaa attgtttttt tattttatca aaacgataat    100380
     tttctttaga atcatttaat gtacaagatg ttattaaaaa tatatttaat atttgagata    100440
     ttattataat tttgaaaaat tttctatgat attttgagat tagcatattg aattgctttt    100500
     tcaagttgaa aacgtgtaga atctaaaacg ggtgtcatag gcaaacgaag tgtatcactt    100560
     tttattaatc ctattttttt tgctaaccat tttacgggaa taggattggg ttctatgaac    100620
     agcgcttcat gtagtaacat taggcgttta tttatagatc ttgcatttat aaaatcccct    100680
     tttaatgcat acgaacaaat ttccatcatt tcttttgcag caatatttgc tgtaaccgat    100740
     attacacctt gtccgcctaa ttgcataaaa tctaaagctg ttgcatcatc tccactgatt    100800
     aataaaaaat tagttttaac taattctttt attttatgga ttcttgataa atctccagtt    100860
     gcttctttaa ttcctattat gttgttaaaa tgagataatt tggcaactgt ttctgggagt    100920
     aaatcacatc cggtacgact gggtacatta tataaaattt gtggtaattc agtgttttct    100980
     gaaatagctt taaaatgttg atacaatcct tcttgtgtag gtctattata atatggcgtt    101040
     acacttaaac aacctgcaac accagatttt tcaaatcttt tggttaaaga tatagcttct    101100
     gttgtagcat ttgctcctgt acctgcaata actggaatac gtccatctgc taattctaaa    101160
     gtgagcataa caatatttat gtgttcttct tgactaagtg ttgcggattc tccagtagtt    101220
     ccaattgaaa caattgcttc agttttacta gcaacatgat aattaattaa cttttctaaa    101280
     ctaatacgac aaatctgacc tttttcatcc atgggtgtaa ttagtgcaac aatacttcct    101340
     ttgaacatta gttgtcctcc tccataaaaa atattttatg ggatgtttgg cacgttttaa    101400
     aaattaagta tatagaaatt attaatataa tatcttaaaa atataatttt attgacaaat    101460
     aaatatataa atattagata atattgtaca tataatagag ttttaattat ctaattcaat    101520
     gaaaaatttt ttataataat aacttatatt taatattttt tattttttta aatgaaatac    101580
     aattaatttg aacaatatat tttatagaga aacaaaggta gaaaatatat atttattatt    101640
     aacatttcgc tttataagta tgattgtacg taacatcttt ataaaagtat ttatttttac    101700
     agaagaaaaa ttttgcaatt tttattgcat tatttttcaa atatattttt ttatatactt    101760
     caaaagtatt tttaaaattt aattatagta cttagcataa ttaaattatg cgctatttct    101820
     agaaaaatat aattctattc atgtgaaaaa tatcaatgat atttaatatg atcatcctat    101880
     cgaataaata gttatttagc attatgaata tattttaaag gaattatttt ccactgcatt    101940
     gtgcgcgaaa tcttaataaa tgatccatta atacaattgc taccattgct tcagtgattg    102000
     gaacagcgcg taaacctaca catggatcat gtcgtccttt agtaactatt tgaacttttt    102060
     cgttattttt atttattgta ttgcctgctt ttcgaatact tgatgtaggt ttaaatgcta    102120
     cttttagtac aatttctcga ccattactaa taccacctag aataccacca gaatgattag    102180
     ttaaaaatcc ttgtggcgta atttcatcac gatgttcact tcctcgttga tttattactg    102240
     aaaaaccgtc tccaatttct actccttttg cggcattaat actcatcaag gcgtgtgata    102300
     aatcagcatc aagacgatca aaaactggtt ctccaagtcc tacagggata ttttcagcaa    102360
     taattgttat ttcagcacca atcgaatcac ctattttttt gagatattta attaaatttt    102420
     ctagtgctaa aattttttca ggatcagaac agaaaaaagg attattttcg acttcttgcc    102480
     aagatttaaa agggcatttg atattgccca ttgctgacaa atatgctcga atagttatcc    102540
     catatttctc attaaggtat ttttttgcta tagctcctgc tgcaactctc atagcagttt    102600
     cgcgagcaga agatctacct cccccgcgat aatctctaat tccatatttt ttttcataag    102660
     tataatcggc atgtcccggt cgaaataaat tctttatatc gctatagtct tgagacctat    102720
     gatcatgatt ataaattatt aaaccaatac tagtaccagt tgtgaccccg ttaaatatac    102780
     cggaaagtat attaacttca tcaggttcac ggcgcaaagt cgtgtaacgg gaagtacctg    102840
     gtcttctacg attcaaatca tattgcaaat ctttacaaga taattcaaga ccaggaggtg    102900
     ttccgtcaat tatgcaccct aatgcttctc cgtgtgactc gccaaaagtg gttacacaga    102960
     atattttccc aattgtattt ccagacattt tttatccttc tgcaattgtt aaaatgaaat    103020
     aatacaacta tacagaacaa ataaacaaaa tgatttttta ttttttaaaa tatttaaatt    103080
     gtatttattt tttaaaaaat catctgttta aactaattgt ttcttttttt atgtagtttt    103140
     ataataatat ttttttattt gttgttttta caaaaactaa attatataat taatgaaaaa    103200
     tacataattc attataaata ttttaaatta aatacatatg tttggaattt ttaattaatt    103260
     aacattattg gtaacaaaca actatggata aaaatagccg atataccgtt gattcgagta    103320
     ttttatttcg tcaatggtta aatgatactc gtgaaatggt acaagatact atttttcatt    103380
     ctcgaattca aaaaaaaaat aataatcatc cagtatctca acgcgttttt ttcgaacaaa    103440
     atgctcatag tcattatttt tcttatagaa ataataaaaa tttatttaaa gaaaatcctg    103500
     tttcttatat tcgtcatcaa agcttgtata atgttttaaa aaatctaaaa aaaggaagat    103560
     acaatccaga tatttctatt gatttgcatg gattaacaca acatcaggca caacaggctt    103620
     taggagaatt aatcacgaca tgtcaaaaag aaaaaatttt ttgtgctcat ataatgcatg    103680
     gtcatggtaa acatatttta aaaaaacaaa ctccgttttg gttgtctcaa caccctgata    103740
     taatagcctt tcatgaagct cctaaatttt ttggaagcga tgctgcaatt atagttataa    103800
     ttgaaattaa ttctctaaaa aaaaatataa atatttttaa ttagaaaatc aaataatttt    103860
     atatcaagac attaaaatag aaatattgct ttctgaatta aactaaaaca gtgctatttt    103920
     atttaatata aaaagtttct ttaattattt tttttaaact acaatgttat caataatttt    103980
     aatttattat acttcatttt tgcaataaca ttgtctatgt cataaaatga tttaattata    104040
     attttttcat gagcactaat aagatatttt ttttaaaacc cttatttttt gggttttttt    104100
     attttctaaa aaagtaaatt tatataagtt tttttatgta ataaaaagaa ctttaaggga    104160
     ttcgaaatat gtttgaaaat aatcgtgtac gtatagcgat gcaaaaaact ggccgtttaa    104220
     gtaaagattc tatcagacta ctgacatctt gtggtgttaa aattaattta aaacaacaaa    104280
     aattaatagc atttgctgaa aatatgccca ttgatgtaat gttagttcgt gacgatgata    104340
     ttcctggatt ggtaatggat ggtgtagtag atttaggaat agttggagaa aatgtgcttg    104400
     aagaagagtt attgaaacga aaatcacaaa aatctgaatg ttcttatatt actttaagac    104460
     gactagattt tggagtatgt agattatctt tagctttacc ggtaaatact atatacacta    104520
     atataacatg tttaaaaaat attagaatag ctacctcata tcctcattta ttaaaaaaat    104580
     atttagacga aaaaaatatt tcttttaaat cctgcatgtt aaatggatcg gtagaagttg    104640
     cacctagagc tggtttagca gatgctattt gtgatttagt gtctacagga gcaacattag    104700
     aagctaatgg tttacgtgaa gtgcaagtag tttatcattc tcatgcctgt cttatttgta    104760
     agactggaaa tattaattct ataaaaaaag aatttattaa taaattgatg actcgtatta    104820
     aaggcgtgat taaagctcgc gaatctaaat atattatgtt acatgctcct ataaaacaat    104880
     tagaagcggt gatatcttta cttcatggag cagaaagacc aaccatttta aaattagcag    104940
     gtgatgataa tcgagtagca atgcatatgg ttagtagtga gacattattt tgggaaacga    105000
     tggaaaagct aaaattatta ggcgctagtt caattttagt tttaccaatt gaaaaaatga    105060
     tggagtaaga aatgcaatga aatattttaa aaatataatt ttttggaaca aactacaccc    105120
     tgatgaacaa aaaaaaatat tatcaagacc tattttaaaa gaaaataact tcattaaaaa    105180
     gactgtaaaa gaaattatag aaaatgttag attatttgga aattcagcat taaaaaaata    105240
     tactttttta tttgataaac aagatataaa tacatttcaa gtttcaaaag aaaaaatctc    105300
     ttcatcttcg ttttatttaa gtaaggttct aaaagattcc atttctgtcg cgcaaaaaaa    105360
     tattacatgt tttcataaag ctcaaattcc atctaaaata gatgttgaaa cagaagttgg    105420
     agtccgttgt gagcaaatct atttacctct aaattctata ggaatttata ttcctggcgg    105480
     aacagctcct ttattttcga ctgtattaat gttagcgata cctgctaaaa tttctggttg    105540
     taaaaaaatt attctttgct ctcctcctcc gattagtaac gaggttcttt atgctgctca    105600
     tatttgtgga attcatgata tttatcaagt tgggggagct caggctatag ctgcactcgc    105660
     tttaggtact gaaacggtcc ctaaagtaga taagattttt ggaccaggca atgcgtatgt    105720
     tacagaagca aaattacaag ttagttcaat ttttaatgga acagaaatag acatgttagc    105780
     aggaccttca gaattattaa tcattgctga caacactgct aatccagatt ttattgccgc    105840
     tgatttatta tcacaagctg aacatggtgt ttcttctcaa gtaattttgc ttacaccatg    105900
     ttttgaatta gcagaaaagg tagtgctttc cattaataaa caactgaata atttatctag    105960
     attatcagaa attttgaaaa cattaaaaaa cagtagtgtc ataattgtca aaaatttatc    106020
     agaatgtatt gaaatctcta atatgtatgc acctgaacat ctaattattc aaacacaatc    106080
     acctagagaa gtacttaact acatctctaa tgctagttct atttttcttg gtttatggtc    106140
     tcctgaatct gccggagatt atgcgtctgg gacaaatcat gttttaccaa catatggaaa    106200
     atctattaca aattcgtctt taggattgtg tgattttcaa aaacgtgtat tagttcaaga    106260
     attaacagct aaaggactaa tgaaattatc taatactatt gaaattttat cttccgcaga    106320
     aaaacttcaa gcacataaaa atgctgtaaa aattcgcgta gattttttaa agggaaaaat    106380
     atgacagata atgttttgaa attgtctaga aaaaatataa aaaaactaat accttatcaa    106440
     tccgcaagac gtatcggagg ggaacatggg aatatattat taaatgctaa tgaatcgcct    106500
     gtatctattt tttttaaatt aaaaaaaaaa ccatttaatc gttatccaga atgtcaaccc    106560
     agtaaactaa tatcttctta tgctcattat gttaatttat cttgtaatca aattttagcc    106620
     acaagaggtg ctgatgaagg aattgaatta ttaattaagg ctttttgcga acctggtaaa    106680
     gatgctatta tttattgccc tcctacttat gatatgtatc gaataaatgc aaccatagct    106740
     ggtgtagaaa taaaagaaat tcctactatt aaaaatactt ggcaattaga tttgttaaat    106800
     attaagttaa acttaagtag agtaaaatta atttatattt gcaatcccaa taatcctact    106860
     ggtaatattt tttttaaaaa agatcttatt tttttattga atataacttt aggacaggct    106920
     ctagttgtaa tagatgaagc ttatattgaa ttttcaccag aagaaagcat gacaaattat    106980
     ttaaaagatt atccgaattt agttgttcta cgaaccttgt ctaaagcttt tgccttagct    107040
     ggaatacgat gcggatttac tttagctaaa aaagaaatta ttcaaacttt aagtaaagtt    107100
     attagtcctt atccaatatc tatccctgtc tctgatatag ctatacgatc tttagaaaaa    107160
     gattatgttc aattaatgaa aaatagagtc ttagattcaa acaataatcg tatttggttg    107220
     attaatcaat tgaaaaacat cacatgcgta gaaacagtat ttgaaagtaa tgctaattat    107280
     gtattagtaa aattttctat gtttgaaaag gtttttgaaa ctttatggaa taaaggtata    107340
     attttaagaa atcaaaatga gaaaacgaat ttaaaaaaat gtataagaat ttcaatggga    107400
     acacgatcag aatctttgcg tttaattaaa gagcttaaaa ttttttctaa aaaaaacatg    107460
     tgtcaaggtg aaatgagtga aaaataaaat attatttatt gatcgagatg gtacattaat    107520
     tgatgaacca attaatactt ttcaagtaga ctcaataaat aaattagtat ttaaaaaata    107580
     tgttatttcc tcattacgta aattagttga actcgactat aaattgataa tgattactaa    107640
     tcaagatggt cttggtactg aatcttttcc tttacaagat tttagtacag ctcatctttt    107700
     tatgttgagt gtttttcgtt cagaaggggt tatttttgat gatatattaa tttgtcctca    107760
     ctttttagat gatgactgtg tatgtcgaaa acctaaaata aaaatgatag agccatggtt    107820
     agataaaata gacttaaaga agagctatgt gattggtgat cgagatacag atatgcaact    107880
     atcaaataac cttaaaataa aaggtataaa atacaaagaa gatatatgta attggttaca    107940
     tatcacaaaa tacattataa aacataatag atatgctgaa attatcagga gaactaaaga    108000
     aactaaagtt agtattaaag tttggttaga tttagaagaa acaagtaaga ttgatactgg    108060
     tgtaaagttt tttgatcata tgttagaaca gttatcagta catagtggta tttgcatgaa    108120
     tatttctgta cagggagatc ttgatattga cgatcatcat acaatagaag acacaggcat    108180
     tgttttagga gaggctttat tgcaagcttt aggaaaaaaa aatggtctat ctagatttgg    108240
     tttctacttg ccaatggatg aaagtagatc taattgtatc atggatatat caaatcgtcc    108300
     gtatttaaat ttcaaagcaa aattcaatca taaaatggct ggagatctaa gcactaatat    108360
     ggtagagcat tttttttatt ctctttgtta ctctatgaaa attacacttc atttatatgc    108420
     tgaaggtaaa aacgaccacc attgtattga gagtttattt aaagtttttg gacgaacgtt    108480
     acgtcaagct attaagatag agggaaatat gttaccaact tcaaaaggga ttttataatg    108540
     tacatagtaa tagtagatac aggttgcgct aatttgacat caataaaagt agcaattaat    108600
     aacttaggtt ataatgctac aataacttct gaatcatcaa ttattttaaa gtctaataag    108660
     atttttttac caggagtagg aactgcctcg gcagtaatgg atcttttgtc taaaaaaaaa    108720
     atcatcaatg ttattagaga atgcaaacaa acaatattag gaatatgttt gggtatgcaa    108780
     cttttttgtg cttctagtga agaatctaat ggcgtaaaaa caattggtat tattaaaact    108840
     cctgcattgc gtttaaaagt taataattta tctttacctc atattggttg gaatcaaatt    108900
     acatttcaaa aaggacatgc tttatttaaa aatataccaa ataattcaag attttatttt    108960
     gttcatagct atatggttcc aataaataaa tatacattat ctacaactaa ttatggtatt    109020
     aattttagtt caataataca aaaagacaat ttctttggcg ttcagtttca tccagaaaaa    109080
     tctggaaata tagggtctca attgttaaaa aattttttgg agatataatt gaatgattat    109140
     tcctgcattt gacttaatca acggtagaac agtacgttta tatcaaggtg attattcgaa    109200
     tcaaaaaaat tataatgtaa acttattcaa ctccttagaa gtatacaaat caaaaggaat    109260
     tgagatagtt catttagtag atttagatgg tgcaaaaaat agcgcaaata gacaaataga    109320
     attgtttaag aaaatagttt ctcatactac cgtacctgta caagtaggtg gaggaataag    109380
     aactacaaaa gatataagca cacttcttga tttaggagtc aaaagggtag taattggttc    109440
     ttctattgta agtaataaaa aacaagtaaa acaatggtta aatttttatg gtccagatgc    109500
     aattgtttta gcattagatg tacatgttga tggtagcaac aaaaaagaaa tctctattga    109560
     tggttggcaa aaaaaaacaa attttattct agaggaaata attgaatatt tcttatctag    109620
     tggtttaaaa cacgtattat gtaccgatat ctctagagat ggaacacttt taggaccaaa    109680
     ttttaagttg tacaaagaaa tttgcagcaa ttttaaaaat attaattttc aagcatctgg    109740
     aggtgtagca tcattacaag atattatttt tttaaaaaaa actggagtga agagtattat    109800
     tattggtcgt agtttattag aaaaaaaatt tacaatagaa gaggctgtta aatgctggca    109860
     aagagaatca tagcgtgtct tgatgttgat gatggtgtag tagtgaaagg aattaaattt    109920
     cagaatcata aaatcgtagg cgatattgta ccattagcca gacgctacgc aaaagaaggt    109980
     atagatgaat tagtttttta tgatattact gctgcaacaa aaaataaatt agttgatcgt    110040
     agttggataa aaaatgtttc taaagttata aatattccat tttgcgtagc tggaggtatt    110100
     aaaagtgtag aagatgctaa aaaagtttta tctagtggtg cagataaaat atcaatcaat    110160
     tcttcagcat taatagatcc taatttaatt actaaaattt cagaacgttt tggtgtacag    110220
     tgtgtagtta ttggaattga ttcttggttt gataaaacaa aaaattctta tatggtacaa    110280
     caatatacag gagatattag taaaacttat caaacgtctt ggaaaacatc tgattgggta    110340
     aaaaaagtac aagaaaaagg tgctggtgaa atagtgttaa atatgatgaa taaagatgga    110400
     ttacaaaagg ggtatgatat atcacattta agtgaaataa gaaaaatatg taaagtaccc    110460
     ttaattgcat caggtggcgc tggaagtgta gaacactttt atgaagcatt atattattct    110520
     aatgttgatg gagtgctagc tgcatctgtt tttcataaaa atatagtaga gataaaagtg    110580
     ttgaaaaaaa aattaattgc gcgaggaatg gagattagag agtgttaaaa aaacatgatt    110640
     tattaaatct tgattggaca aaaactaacg gtatgattcc cgtgatcata caagattatt    110700
     cttcaagtga agttttaatg catggataca tgaatcaaga tgctttgact aaaacccaag    110760
     aagatggctt agtgacattt tattctcgta ctaaaaattg cttatggact aaaggggaaa    110820
     tatcaggtaa ttacttaaaa gtaattgaaa ttagtacaga ttgtgataat gatacattat    110880
     taattttagt tgcagctcaa gggaaaacat gtcatttagg taattcaagt tgttttattt    110940
     caaataaata caatataaat tttttattta aattagaaga aattatagaa gagagaaaaa    111000
     ataaattttc agataactca tatacatcta gtttatataa atcgggaaca agtcgtatag    111060
     cacaaaaagt aggtgaagag gctatagaaa caatattagc agcgatgaat aaagatcaga    111120
     ttgaattaat taatgaagct tcagatttaa tttatcattt agtcgtattg ttacacgacc    111180
     aagatttaaa tttcaattta gttattgata acttaaaaaa aagaagagaa aaaaatctga    111240
     acactaattc tgaaaaatta ttgaaataat attttggagg cactaaaaaa taaatttata    111300
     atatttcaac atcacaataa attttaataa tataagaacg tgtattttat gtattatcat    111360
     atttaaaaat atccatatta aaaatattta ttaaatagca tatcaattaa tgtttttatt    111420
     taaaaataaa aaataaaagt catgttttta aaaagtttta tctatatttt aattgataga    111480
     tattctttat gaatgtttta ttttaaacta atagaaagtt gaaaatattt aaaatatgat    111540
     ttactgttta agtaatttaa taaaatttaa caatgtaaaa agataattat tgaatatctc    111600
     tttgatatat tttagttgga ggacaaaatg tcacggcaac aaataggtgt tgtcggaatg    111660
     gcagtcatgg gacgaaattt agcattaaat attgaaagca aaaattacag cgtatctata    111720
     ttcaatagaa ctagatcagt aacagaagaa gtatttaatc agaataagaa aaaaaatatt    111780
     gtcccatatt tttctattaa agattttatt gattcacttc tcaagcctag atgcatctta    111840
     ttaatggttc aatctggaaa agctactgat gaaactatca agatgattct gccctattta    111900
     gaaaaagaag atatattaat tgatgcaggt aatacatttt acaaagacac tattcggaga    111960
     aatgaaaaat tatctaaata tgagattaat tttattggaa tgggggtgtc tggaggtgaa    112020
     ttaggagcat taaacggtcc ctctattatg ccgggcggac aaaaagaagc atacaaactt    112080
     gttttaccta tgttagaaaa aatatcagca aagtttaaag gtgagccatg tgtaagctat    112140
     attggtccta atggtgcagg tcattatgta aaaatggtac acaatggtat tgaatatggt    112200
     gatatgcagt taatatcaga gtcatatttt ttattaaaat atttattaaa tatgagtaat    112260
     gaagaattat catctacatt ttctaaatgg aataaaggtg aattaaatag ttatttaatt    112320
     gaaataacaa aaaatatttt tattgaaaaa gatgaaaagg gaaaatattt gatagatcgt    112380
     attttagatg tagcagaaga taaaggtact ggtaagtgga ttagcaaaag tgctttagat    112440
     cttcgagaac cgctttcatt aattactgaa tccgtttttg ctcgttattt atcttctcta    112500
     aaaagacaac gcataattgc atcaaaaata ttacagggtc caaagataaa aacgtttatt    112560
     aaagataaaa atagttttat tgaagaagtt cgacgagctt tatatttagg taagataatt    112620
     tcttatgctc aaggtttttc tcaattaaaa agagcgtcag aaaaatatca ttggaattta    112680
     aaatatggtg aaattgctaa gatttttaga gcagggtgta ttatacgagc aaatttttta    112740
     caaaaaataa cagacgaata tactcaaaat aaaaatgtag ttaatttatt attaacacct    112800
     tatttttcca aaatagctaa tgaatatgaa aattcattac gcaatattgt tatgtatgcg    112860
     ataaaatatg gaatttctac tccaactttt tctgcggcaa tatcatatta tgatagttat    112920
     agagcattat atttaccggc taacttaatt caggctcaaa gagattattt tggttcacat    112980
     acttatcaaa gaacagatca gactggttac tttcatacaa actggtctca ataaaaaaca    113040
     ttaagatagt tgatatttat atatgaatat catatttctt atattactgc tactagttta    113100
     tgataaaaaa ttaaaatagc agacgatgtt agaaaatatc tctgctatta gattatatct    113160
     attacttcat atattttctt tgttttataa cacgtgatgt taaaatatat caaagataat    113220
     atcataggga taaaaatgcg tttatgtgat aaagatattg aagagtggtt ggagagaaaa    113280
     gaattaatta tagaacctta tcctaataaa acattaatta atggcattac tgtcgatata    113340
     caccttggta ataaatttcg ttttttttat gaacatactg gatcttgcat tgatttgagt    113400
     aattctaaaa taatcggtgg attatcatta acggaaatta tgagtaatga aataatattt    113460
     tctaaagaac agccatgttt tttacaacca ggatctttag tattatgttc gacttttgaa    113520
     agtattaaaa tgccaaataa tttagtgggt tggttagatg ggcgttcttc tttagctcgt    113580
     ttaggattaa tgattcacgc taccgctcat cgtattgatc caggttggaa tggtaatatt    113640
     gttttagaaa tgtttaatgc aggaaaatta actttagtat tacgacctaa aatgaggatt    113700
     gcagcactta gctttgaagt tctatctcaa ccagttttac gtccctataa tttaagaaaa    113760
     gaggctaaat ataaaattca aaatggagta gttcccagtc gtattcataa ggaataaagt    113820
     ttttacgtaa tatactatgt atatttttta atttcttagt tatatcataa gtcaattatt    113880
     cataaaacta tttttttaaa tcaagaatag tttataatta ttatttttat atcatattac    113940
     tctatttaaa aaaaatataa tattatgtca agtgtattta gaaaaatttt agttacctgt    114000
     gctttacctt atgctaatgg ttctattcac attggccata tgttagaaca tattcaagca    114060
     gatatttggg tacgttatca tagaatgcgt ggtcacgaag tatggtttgt ttctgctgat    114120
     gatgcacatg gtactgctat aatgttaaaa gctcaagatt tagaaatatc tcctaataaa    114180
     ttaattaaaa atattaggat agagcatcaa atagattttt cgaattttaa aatttctcat    114240
     gataattatt attcaactca tagtttagaa aatttatatt tatcaagaaa aatttttaca    114300
     tgtttaaatg aaaaaggttt aattaaagaa aaaaaaattt tccaacttta tgatacagta    114360
     aaaaaaattt ttcttccaga cagatttata aaaggtacat gcccaatttg taaatcaaaa    114420
     aatcaatatg gtgataactg tgaaatatgt agtgcaactt atgagcctac agatttaatt    114480
     aatccaatct ctgttatttc aggaaaaaaa cctattttaa aaaacactaa acatttatat    114540
     tttgatttac cttcttttac taatatgtta aaaaaatgga tacattctgg tgttttagaa    114600
     gaatcagtta ttaaaaaaac agaagaatgg tttaaagtag gtttaaagtc gtgggctatt    114660
     tctcgtgatg caccttattt tggttttaaa attccaaatt atcctaacaa atatttttat    114720
     gtttggcttg atgctccgat cggttatatt agtgcgttta aaaatctttg ttttaagagt    114780
     aaaaaattaa attttaatga actttggaac caaaattcta attatgaatt ataccatttt    114840
     attggtaaag atattattta ctttcatact ttattttggc ctgcaatatt agaagctgtt    114900
     tcttttagac agcctagtgg aatttttgtt catggacatc ttactatgaa tggactgaaa    114960
     ttgtcaaaat ccagaggtgc tttgattaaa gctagtgatt ggattcagta tttcgattcc    115020
     gatagtttgc gttattatta tgcaagcaag ttatctaata aaacccatga tattgaaatt    115080
     aatttagaag actttattca aaaaataaat agtgatatcg taaataaact agtaaattta    115140
     gcagcaagaa atgccagttt tattaataaa tattttaatg ggtatttatc tgataaatta    115200
     agcaatataa aattatataa atattttgtt aatactagta gtagtattga agattttttt    115260
     gaaaatcgtg aatttagttt tatagttaaa gaatcaatga gattattaga tgtagccaat    115320
     caatatatta atgaaaaaaa accatggaaa attaaaagaa cagaagaaaa tatcagggaa    115380
     ttacaaaata tttgcacaat gggtattaat ttatttagaa ttataatgat ttttttaaaa    115440
     cctatagtac ctgatttagc aatcaaaaca gagtctttct tgatttctaa attgacttgg    115500
     gatggtatta aaaaaccatt attatctcat cagataaata aattttttcc attatataaa    115560
     agaattgatg tcgaaaaaat gtttgaattc atgaatatat gtagataata ataaatttta    115620
     ttataaagta tgacaatttt tcctaattaa ttactttaat aaaatgaaaa aaaattatta    115680
     gtagttgatt ttaaatcatt ttgccaggat attatgcact ttgttctatt tttgtttttt    115740
     atattaacaa caaagactcc tatggcactg ataaaataat tattataaaa taatagggga    115800
     atttgatttc tcaaccaagg agggatattt ttttcttgcc atattttttt tatttttctt    115860
     tttttacttc ttcctaaaat taagacatat ccttcgtatt gaaaacgaat attaattaat    115920
     tcattttctt taggaccggg aagtacagtg ccgttgttat tttttattaa atatcctaaa    115980
     ttattaggaa gtgttagttt tatattgttt ttatgccaaa acaataaagt atttttgaga    116040
     ctcggttgag tttttataaa atgaagtgat tgtttataac gtctcacttc atgtttgcct    116100
     aaaataattt taggatttga atctatacga ctgaaaatca tttgacgata aatgcattga    116160
     atatttttgt atgatggcat tttaattttt tttaacaaaa gccagtatct aattaaagct    116220
     gtgcacattg cttgttttat atttttaaaa ttctcgatat ttaaagaatc atcaaatttt    116280
     ataagtttgt atattctttc acgaagaaaa tcatttaata atcttgtttc ttgttgacat    116340
     ataatagttg tacgaaaaca attttttaaa aaataagacc atcttttttc taatataggg    116400
     ataacttcat ttcgtataaa gttacgatca taatcaatat ttaaattact aaaatcttca    116460
     atccagtgta attttttttt cttagcccat gtttgtagtt ctatttttgt tttttttaga    116520
     aaaggacgaa ctattttttt agtcccaaat aaagtctcaa aagacatgct ggaaagacca    116580
     gtaggaccac ttcctctttt taaagataaa aagaaagttt cacattgatc atttatatga    116640
     tgaccagtta gcagtatttc gtcagaaaat agatgattat atataatatt atatcgtttt    116700
     attctgagtt tttcttcaag attatttgtt ttgtttttaa tgttaatatt ttcaactatc    116760
     aatgggatat gatttatatt gcaaattttt ttacagtgtt ctgaccattt ttttgatagt    116820
     aaagtaagat tatgattgat atgaatagca cgtattttaa tgtagtattt tttttttatt    116880
     tccagcaatt tataaagaag tacggttgaa tctaatccac cactataagc gactaagaat    116940
     gatttatttt gatattgact aataatttct ttaatcaaaa aaattaccta taatttaatt    117000
     tttttaatac gttcgagtgg acttgaacca ctaacttcta ccatgtcatg gtagcgctct    117060
     aaccaattga gctacgaacg taaaatattt aaaaattttt tgatattttt atgattttaa    117120
     ttatatatta ttattaatat aatatacaaa tattttttat cattaataaa tataaattaa    117180
     agatattatt ttgaggaaag attatgttta caggtattat aaatggaaca gctactattg    117240
     tttatataga aaagaaaaaa aaaaaatata gatatacagt tgaacttcca tcaaatttat    117300
     ctaaaaattt aaagttaggt gactcaatat cacataacgg atgttgtttg actgtaaaat    117360
     taattaataa ttcttttata atatgtgatg ttattcaaga gacattaaag agtactaatt    117420
     taggaatatt aaatattgga gatagtatta atattgaaag atctataaaa tatggcgatg    117480
     aaatcggtgg tcatataata tctggtcatg ttatgaatac cgctgaaatt tctaaaatgt    117540
     caaagtcaga caataactgt gtaatatggt taaaaatgaa taatatgtct ttaatgaagt    117600
     atattttcta taaaggattt atctgtgttg atgggattag tctcactgtc aatgatatta    117660
     ttaaaaatga attttgcgtt aatattatac cttatacttt ccttttcact actataaaag    117720
     ataaaaagaa cggtagttta gtaaatattg aaatagattt ttatactcaa acaattgtag    117780
     atactacaga acgattaatc aataataatt taaaatcatt gtatgattaa cattgaaaat    117840
     taatatactt tatcttggaa ttataaatga aacattatat tttatttttt atttctaata    117900
     tattaattga aaattttatt ctagtaaaat ttctcggttt gtgtcctttt ttaggagcgt    117960
     cgagtaatat tgaaactgct tttggaatga gttgcgcaac tactttcgtt atactcacat    118020
     catcagtatt attatggtgt gttaattttt tcattttgtt acctctggat ttaatttatt    118080
     tgagaattat tgcttatatg ttaattgttt cagttagtgt tcaattttta gaaatagtgt    118140
     tacgaaagac gagtcctatt ttatatcgtt tacttgggat ttttctccca ttaattacaa    118200
     ctaattgtac agtgttagct attccattat tcagtttata tgaacatcat acatttttag    118260
     aatctatatt ttatgggtta agtgcatcgt taggatttgc tttagtgatg attatttttt    118320
     cttgtattcg tgaacgtata gtattatctg atattccttt gccatttcaa ggtgctccta    118380
     ttattttaat tact