(data stored in ACNUC7421 zone)

EMBL: BA000004

ID   BA000004; SV 3; circular; genomic DNA; STD; PRO; 4202352 BP.
XX
AC   BA000004; AP001507-AP001520;
XX
PR   Project:PRJNA235;
XX
DT   02-DEC-2004 (Rel. 82, Created)
DT   11-MAY-2017 (Rel. 132, Last updated, Version 10)
XX
DE   Bacillus halodurans C-125 DNA, complete genome.
XX
KW   .
XX
OS   Bacillus halodurans C-125
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-4202352
RA   Takami H., Takaki Y.;
RT   ;
RL   Submitted (22-MAR-2000) to the INSDC.
RL   Contact:Hideto Takami Japan Marine Science and Technology Center, Deep-sea
RL   Microorganisms Research Group; 2-15 Natsushima, Yokosuka, Kanagawa
RL   237-0061, Japan URL    :http://www.jamstec.go.jp/jamstec-e/bio/DEEPSTAR/
RL   FResearch.html
XX
RN   [2]
RX   DOI; 10.1007/s007920050095.
RX   PUBMED; 10086841.
RA   Takami H., Nakasone K., Hirama C., Takaki Y., Masui N., Fuji F.,
RA   Nakamura Y., Inoue A.;
RT   "An improved physical and genetic map of the genome of alkaliphilic
RT   Bacillus sp. C-125";
RL   Extremophiles 3(1):21-28(1999).
XX
RN   [3]
RX   DOI; 10.1007/s007920050096.
RX   PUBMED; 10086842.
RA   Takami H., Nakasone K., Ogasawara N., Hirama C., Nakamura Y., Masui N.,
RA   Fuji F., Takaki Y., Inoue A., Horikoshi K.;
RT   "Sequencing of three lambda clones from the genome of alkaliphilic Bacillus
RT   sp. strain C-125";
RL   Extremophiles 3(1):29-34(1999).
XX
RN   [4]
RX   DOI; 10.1271/bbb.63.452.
RX   PUBMED; 10192928.
RA   Takami H., Takaki Y., Nakasone K., Hirama C., Inoue A., Horikoshi K.;
RT   "Sequence analysis of a 32-kb region including the major ribosomal protein
RT   gene clusters from alkaliphilic Bacillus sp. strain C-125";
RL   Biosci. Biotechnol. Biochem. 63(2):452-455(1999).
XX
RN   [5]
RX   PUBMED; 27385575.
RA   Takami H., Horikoshi K.;
RT   "Reidentification of Facultatively Alkaliphilic Bacillus sp. C-125 to
RT   Bacillus halodurans";
RL   Biosci. Biotechnol. Biochem. 63(5):943-945(1999).
XX
RN   [6]
RX   DOI; 10.1271/bbb.63.1134.
RX   PUBMED; 10427704.
RA   Takami H., Nakasone K., Masui N., Inoue A., Horikoshi K.;
RT   "Replication origin region of the chromosome of alkaliphilic Bacillus
RT   halodurans C-125";
RL   Biosci. Biotechnol. Biochem. 63(6):1134-1137(1999).
XX
RN   [7]
RX   DOI; 10.1007/s007920050120.
RX   PUBMED; 10484179.
RA   Takami H., Takaki Y., Nakasone K., Sakiyama T., Maeno G., Sasaki R.,
RA   Fuji F., Hirama C., Masui N.;
RT   "Genetic analysis of the chromosome of alkaliphilic Bacillus halodurans
RT   C-125";
RL   Extremophiles 3(3):227-233(1999).
XX
RN   [8]
RA   Takami H.;
RT   "Genome analysis of facultatively alkalihilic Bacillus halodurans C-125";
RL   (in) Horikoshi K., Tsujii K. (Eds.);
RL   Extremophiles in deep-sea environments:249-284;
RL   Springer-Verlag (1999)
XX
RN   [9]
RX   DOI; 10.1007/s007920050143.
RX   PUBMED; 10805564.
RA   Takami H., Horikoshi K.;
RT   "Analysis of the genome of an alkaliphilic Bacillus strain from an
RT   industrial point of view";
RL   Extremophiles 4(2):99-108(2000).
XX
RN   [10]
RX   DOI; 10.1093/nar/28.21.4317.
RX   PUBMED; 11058132.
RA   Takami H., Nakasone K., Takaki Y., Maeno G., Sasaki R., Masui N., Fuji F.,
RA   Hirama C., Nakamura Y., Ogasawara N., Kuhara S., Horikoshi K.;
RT   "Complete genome sequence of the alkaliphilic bacterium Bacillus halodurans
RT   and genomic sequence comparison with Bacillus subtilis";
RL   Nucleic Acids Res. 28(21):4317-4331(2000).
XX
RN   [11]
RX   DOI; 10.1007/PL00010713.
RX   PUBMED; 10972189.
RA   Nakasone K., Masui N., Takaki Y., Sasaki R., Maeno G., Sakiyama T.,
RA   Hirama C., Fuji F., Takami H.;
RT   "Characterization and comparative study of the rrn operons of alkaliphilic
RT   Bacillus halodurans C-125";
RL   Extremophiles 4(4):209-214(2000).
XX
DR   MD5; 1545fd04de42ff83bf62e201e553de19.
DR   BioSample; SAMD00061093.
DR   EnsemblGenomes-Gn; EBG00000012484.
DR   EnsemblGenomes-Gn; EBG00000012489.
DR   EnsemblGenomes-Gn; EBG00000012491.
DR   EnsemblGenomes-Gn; EBG00000012494.
DR   EnsemblGenomes-Gn; EBG00000012496.
DR   EnsemblGenomes-Gn; EBG00000012498.
DR   EnsemblGenomes-Gn; EBG00000012501.
DR   EnsemblGenomes-Gn; EBG00000012503.
DR   EnsemblGenomes-Gn; EBG00000012506.
DR   EnsemblGenomes-Gn; EBG00000012509.
DR   EnsemblGenomes-Gn; EBG00000012511.
DR   EnsemblGenomes-Gn; EBG00000012514.
DR   EnsemblGenomes-Gn; EBG00000012517.
DR   EnsemblGenomes-Gn; EBG00000012520.
DR   EnsemblGenomes-Gn; EBG00000012521.
DR   EnsemblGenomes-Gn; EBG00000012524.
DR   EnsemblGenomes-Gn; EBG00000012528.
DR   EnsemblGenomes-Gn; EBG00000012531.
DR   EnsemblGenomes-Gn; EBG00000012534.
DR   EnsemblGenomes-Gn; EBG00000012536.
DR   EnsemblGenomes-Gn; EBG00000012539.
DR   EnsemblGenomes-Gn; EBG00000012540.
DR   EnsemblGenomes-Gn; EBG00000012543.
DR   EnsemblGenomes-Gn; EBG00000012545.
DR   EnsemblGenomes-Gn; EBG00000012548.
DR   EnsemblGenomes-Gn; EBG00000012550.
DR   EnsemblGenomes-Gn; EBG00000012552.
DR   EnsemblGenomes-Gn; EBG00000012555.
DR   EnsemblGenomes-Gn; EBG00000012557.
DR   EnsemblGenomes-Gn; EBG00000012559.
DR   EnsemblGenomes-Gn; EBG00000012562.
DR   EnsemblGenomes-Gn; EBG00000012564.
DR   EnsemblGenomes-Gn; EBG00000012567.
DR   EnsemblGenomes-Gn; EBG00000012569.
DR   EnsemblGenomes-Gn; EBG00000012572.
DR   EnsemblGenomes-Gn; EBG00000012574.
DR   EnsemblGenomes-Gn; EBG00000012576.
DR   EnsemblGenomes-Gn; EBG00000012579.
DR   EnsemblGenomes-Gn; EBG00000012582.
DR   EnsemblGenomes-Gn; EBG00000012583.
DR   EnsemblGenomes-Gn; EBG00000012585.
DR   EnsemblGenomes-Gn; EBG00000012588.
DR   EnsemblGenomes-Gn; EBG00000012591.
DR   EnsemblGenomes-Gn; EBG00000012593.
DR   EnsemblGenomes-Gn; EBG00000012595.
DR   EnsemblGenomes-Gn; EBG00000012598.
DR   EnsemblGenomes-Gn; EBG00000012601.
DR   EnsemblGenomes-Gn; EBG00000012603.
DR   EnsemblGenomes-Gn; EBG00000012605.
DR   EnsemblGenomes-Gn; EBG00000012607.
DR   EnsemblGenomes-Gn; EBG00000012610.
DR   EnsemblGenomes-Gn; EBG00000012612.
DR   EnsemblGenomes-Gn; EBG00000012614.
DR   EnsemblGenomes-Gn; EBG00000012617.
DR   EnsemblGenomes-Gn; EBG00000012619.
DR   EnsemblGenomes-Gn; EBG00000012621.
DR   EnsemblGenomes-Gn; EBG00000012624.
DR   EnsemblGenomes-Gn; EBG00000012626.
DR   EnsemblGenomes-Gn; EBG00000012629.
DR   EnsemblGenomes-Gn; EBG00000012631.
DR   EnsemblGenomes-Gn; EBG00000012633.
DR   EnsemblGenomes-Gn; EBG00000012636.
DR   EnsemblGenomes-Gn; EBG00000012639.
DR   EnsemblGenomes-Gn; EBG00000012642.
DR   EnsemblGenomes-Gn; EBG00000012643.
DR   EnsemblGenomes-Gn; EBG00000012646.
DR   EnsemblGenomes-Gn; EBG00000012649.
DR   EnsemblGenomes-Gn; EBG00000012651.
DR   EnsemblGenomes-Gn; EBG00000012653.
DR   EnsemblGenomes-Gn; EBG00000012656.
DR   EnsemblGenomes-Gn; EBG00000012659.
DR   EnsemblGenomes-Gn; EBG00000012661.
DR   EnsemblGenomes-Gn; EBG00000012663.
DR   EnsemblGenomes-Gn; EBG00000012666.
DR   EnsemblGenomes-Gn; EBG00000012668.
DR   EnsemblGenomes-Gn; EBG00000012670.
DR   EnsemblGenomes-Gn; EBG00000012673.
DR   EnsemblGenomes-Gn; EBG00000012675.
DR   EnsemblGenomes-Gn; EBG00000012678.
DR   EnsemblGenomes-Gn; EBG00000012679.
DR   EnsemblGenomes-Gn; EBG00000012682.
DR   EnsemblGenomes-Gn; EBG00000012684.
DR   EnsemblGenomes-Gn; EBG00000012687.
DR   EnsemblGenomes-Gn; EBG00000012688.
DR   EnsemblGenomes-Gn; EBG00000012691.
DR   EnsemblGenomes-Gn; EBG00000012693.
DR   EnsemblGenomes-Gn; EBG00000012694.
DR   EnsemblGenomes-Gn; EBG00000012696.
DR   EnsemblGenomes-Gn; EBG00000012698.
DR   EnsemblGenomes-Gn; EBG00000012699.
DR   EnsemblGenomes-Gn; EBG00000012700.
DR   EnsemblGenomes-Gn; EBG00000012701.
DR   EnsemblGenomes-Gn; EBG00000012703.
DR   EnsemblGenomes-Gn; EBG00000012705.
DR   EnsemblGenomes-Gn; EBG00000012706.
DR   EnsemblGenomes-Gn; EBG00000012708.
DR   EnsemblGenomes-Gn; EBG00000012709.
DR   EnsemblGenomes-Gn; EBG00000012711.
DR   EnsemblGenomes-Gn; EBG00000012712.
DR   EnsemblGenomes-Gn; EBG00000012714.
DR   EnsemblGenomes-Gn; EBG00000012716.
DR   EnsemblGenomes-Gn; EBG00000012717.
DR   EnsemblGenomes-Gn; EBG00000012719.
DR   EnsemblGenomes-Gn; EBG00000012720.
DR   EnsemblGenomes-Gn; EBG00000012722.
DR   EnsemblGenomes-Gn; EBG00000012723.
DR   EnsemblGenomes-Gn; EBG00001449704.
DR   EnsemblGenomes-Gn; EBG00001449705.
DR   EnsemblGenomes-Gn; EBG00001449707.
DR   EnsemblGenomes-Gn; EBG00001449708.
DR   EnsemblGenomes-Gn; EBG00001449709.
DR   EnsemblGenomes-Gn; EBG00001449710.
DR   EnsemblGenomes-Gn; EBG00001449711.
DR   EnsemblGenomes-Gn; EBG00001449712.
DR   EnsemblGenomes-Gn; EBG00001449713.
DR   EnsemblGenomes-Gn; EBG00001449714.
DR   EnsemblGenomes-Gn; EBG00001449715.
DR   EnsemblGenomes-Gn; EBG00001449716.
DR   EnsemblGenomes-Gn; EBG00001449717.
DR   EnsemblGenomes-Gn; EBG00001449718.
DR   EnsemblGenomes-Gn; EBG00001449719.
DR   EnsemblGenomes-Gn; EBG00001449720.
DR   EnsemblGenomes-Gn; EBG00001449721.
DR   EnsemblGenomes-Gn; EBG00001449722.
DR   EnsemblGenomes-Gn; EBG00001449723.
DR   EnsemblGenomes-Gn; EBG00001449724.
DR   EnsemblGenomes-Gn; EBG00001449725.
DR   EnsemblGenomes-Gn; EBG00001449726.
DR   EnsemblGenomes-Gn; EBG00001449727.
DR   EnsemblGenomes-Gn; EBG00001449728.
DR   EnsemblGenomes-Gn; EBG00001449729.
DR   EnsemblGenomes-Gn; EBG00001449730.
DR   EnsemblGenomes-Gn; EBG00001449731.
DR   EnsemblGenomes-Gn; EBG00001449732.
DR   EnsemblGenomes-Gn; EBG00001449733.
DR   EnsemblGenomes-Gn; EBG00001449734.
DR   EnsemblGenomes-Gn; EBG00001449735.
DR   EnsemblGenomes-Gn; EBG00001449736.
DR   EnsemblGenomes-Gn; EBG00001449737.
DR   EnsemblGenomes-Gn; EBG00001449738.
DR   EnsemblGenomes-Gn; EBG00001449739.
DR   EnsemblGenomes-Gn; EBG00001449740.
DR   EnsemblGenomes-Gn; EBG00001449741.
DR   EnsemblGenomes-Gn; EBG00001449742.
DR   EnsemblGenomes-Gn; EBG00001449743.
DR   EnsemblGenomes-Gn; EBG00001449744.
DR   EnsemblGenomes-Gn; EBG00001449745.
DR   EnsemblGenomes-Gn; EBG00001449746.
DR   EnsemblGenomes-Gn; EBG00001449747.
DR   EnsemblGenomes-Gn; EBG00001449748.
DR   EnsemblGenomes-Gn; EBG00001449749.
DR   EnsemblGenomes-Gn; EBG00001449750.
DR   EnsemblGenomes-Gn; EBG00001449751.
DR   EnsemblGenomes-Gn; EBG00001449752.
DR   EnsemblGenomes-Gn; EBG00001449753.
DR   EnsemblGenomes-Gn; EBG00001449755.
DR   EnsemblGenomes-Gn; EBG00001449758.
DR   EnsemblGenomes-Gn; EBG00001449759.
DR   EnsemblGenomes-Gn; EBG00001449760.
DR   EnsemblGenomes-Gn; EBG00001449761.
DR   EnsemblGenomes-Gn; EBG00001449762.
DR   EnsemblGenomes-Gn; EBG00001449763.
DR   EnsemblGenomes-Gn; EBG00001449764.
DR   EnsemblGenomes-Gn; EBG00001449765.
DR   EnsemblGenomes-Gn; EBG00001449766.
DR   EnsemblGenomes-Gn; EBG00001449767.
DR   EnsemblGenomes-Gn; EBG00001449768.
DR   EnsemblGenomes-Gn; EBG00001449769.
DR   EnsemblGenomes-Gn; EBG00001449770.
DR   EnsemblGenomes-Gn; EBG00001449771.
DR   EnsemblGenomes-Gn; EBG00001449772.
DR   EnsemblGenomes-Gn; EBG00001449773.
DR   EnsemblGenomes-Gn; EBG00001449774.
DR   EnsemblGenomes-Gn; EBG00001449775.
DR   EnsemblGenomes-Gn; EBG00001449776.
DR   EnsemblGenomes-Gn; EBG00001449777.
DR   EnsemblGenomes-Gn; EBG00001449778.
DR   EnsemblGenomes-Gn; EBG00001449779.
DR   EnsemblGenomes-Gn; EBG00001449780.
DR   EnsemblGenomes-Gn; EBG00001449781.
DR   EnsemblGenomes-Gn; EBG00001449782.
DR   EnsemblGenomes-Gn; EBG00001449783.
DR   EnsemblGenomes-Gn; EBG00001449784.
DR   EnsemblGenomes-Gn; EBG00001449785.
DR   EnsemblGenomes-Gn; EBG00001449786.
DR   EnsemblGenomes-Gn; EBG00001449787.
DR   EnsemblGenomes-Gn; EBG00001449788.
DR   EnsemblGenomes-Gn; EBG00001449789.
DR   EnsemblGenomes-Gn; EBG00001449790.
DR   EnsemblGenomes-Gn; EBG00001449791.
DR   EnsemblGenomes-Gn; EBG00001449792.
DR   EnsemblGenomes-Gn; EBG00001449793.
DR   EnsemblGenomes-Gn; EBG00001449794.
DR   EnsemblGenomes-Gn; EBG00001449795.
DR   EnsemblGenomes-Gn; EBG00001449796.
DR   EnsemblGenomes-Gn; EBG00001449797.
DR   EnsemblGenomes-Gn; EBG00001449798.
DR   EnsemblGenomes-Gn; EBG00001449799.
DR   EnsemblGenomes-Gn; EBG00001449800.
DR   EnsemblGenomes-Gn; EBG00001449801.
DR   EnsemblGenomes-Gn; EBG00001449802.
DR   EnsemblGenomes-Gn; EBG00001449803.
DR   EnsemblGenomes-Gn; EBG00001449804.
DR   EnsemblGenomes-Gn; EBG00001449805.
DR   EnsemblGenomes-Gn; EBG00001449807.
DR   EnsemblGenomes-Gn; EBG00001449808.
DR   EnsemblGenomes-Gn; EBG00001449809.
DR   EnsemblGenomes-Gn; EBG00001449810.
DR   EnsemblGenomes-Gn; EBG00001449811.
DR   EnsemblGenomes-Gn; EBG00001449812.
DR   EnsemblGenomes-Gn; EBG00001449813.
DR   EnsemblGenomes-Gn; EBG00001449814.
DR   EnsemblGenomes-Gn; EBG00001449815.
DR   EnsemblGenomes-Gn; EBG00001449816.
DR   EnsemblGenomes-Gn; EBG00001449817.
DR   EnsemblGenomes-Gn; EBG00001449818.
DR   EnsemblGenomes-Gn; EBG00001449819.
DR   EnsemblGenomes-Gn; EBG00001449821.
DR   EnsemblGenomes-Gn; EBG00001449822.
DR   EnsemblGenomes-Gn; EBG00001449823.
DR   EnsemblGenomes-Gn; EBG00001449824.
DR   EnsemblGenomes-Gn; EBG00001449825.
DR   EnsemblGenomes-Gn; EBG00001449826.
DR   EnsemblGenomes-Gn; EBG00001449827.
DR   EnsemblGenomes-Gn; EBG00001449828.
DR   EnsemblGenomes-Gn; EBG00001449829.
DR   EnsemblGenomes-Gn; EBG00001449830.
DR   EnsemblGenomes-Gn; EBG00001449831.
DR   EnsemblGenomes-Gn; EBG00001449832.
DR   EnsemblGenomes-Gn; EBG00001449833.
DR   EnsemblGenomes-Gn; EBG00001449834.
DR   EnsemblGenomes-Gn; EBG00001449835.
DR   EnsemblGenomes-Gn; EBG00001449836.
DR   EnsemblGenomes-Gn; EBG00001449837.
DR   EnsemblGenomes-Gn; EBG00001449838.
DR   EnsemblGenomes-Gn; EBG00001449839.
DR   EnsemblGenomes-Gn; EBG00001449841.
DR   EnsemblGenomes-Gn; EBG00001449842.
DR   EnsemblGenomes-Gn; EBG00001449843.
DR   EnsemblGenomes-Gn; EBG00001449844.
DR   EnsemblGenomes-Gn; EBG00001449845.
DR   EnsemblGenomes-Gn; EBG00001449846.
DR   EnsemblGenomes-Gn; EBG00001449847.
DR   EnsemblGenomes-Gn; EBG00001449848.
DR   EnsemblGenomes-Tr; EBG00000012484-1.
DR   EnsemblGenomes-Tr; EBG00000012489-1.
DR   EnsemblGenomes-Tr; EBG00000012491-1.
DR   EnsemblGenomes-Tr; EBG00000012494-1.
DR   EnsemblGenomes-Tr; EBG00000012496-1.
DR   EnsemblGenomes-Tr; EBG00000012498-1.
DR   EnsemblGenomes-Tr; EBG00000012501-1.
DR   EnsemblGenomes-Tr; EBG00000012503-1.
DR   EnsemblGenomes-Tr; EBG00000012506-1.
DR   EnsemblGenomes-Tr; EBG00000012509-1.
DR   EnsemblGenomes-Tr; EBG00000012511-1.
DR   EnsemblGenomes-Tr; EBG00000012514-1.
DR   EnsemblGenomes-Tr; EBG00000012517-1.
DR   EnsemblGenomes-Tr; EBG00000012520-1.
DR   EnsemblGenomes-Tr; EBG00000012521-1.
DR   EnsemblGenomes-Tr; EBG00000012524-1.
DR   EnsemblGenomes-Tr; EBG00000012528-1.
DR   EnsemblGenomes-Tr; EBG00000012531-1.
DR   EnsemblGenomes-Tr; EBG00000012534-1.
DR   EnsemblGenomes-Tr; EBG00000012536-1.
DR   EnsemblGenomes-Tr; EBG00000012539-1.
DR   EnsemblGenomes-Tr; EBG00000012540-1.
DR   EnsemblGenomes-Tr; EBG00000012543-1.
DR   EnsemblGenomes-Tr; EBG00000012545-1.
DR   EnsemblGenomes-Tr; EBG00000012548-1.
DR   EnsemblGenomes-Tr; EBG00000012550-1.
DR   EnsemblGenomes-Tr; EBG00000012552-1.
DR   EnsemblGenomes-Tr; EBG00000012555-1.
DR   EnsemblGenomes-Tr; EBG00000012557-1.
DR   EnsemblGenomes-Tr; EBG00000012559-1.
DR   EnsemblGenomes-Tr; EBG00000012562-1.
DR   EnsemblGenomes-Tr; EBG00000012564-1.
DR   EnsemblGenomes-Tr; EBG00000012567-1.
DR   EnsemblGenomes-Tr; EBG00000012569-1.
DR   EnsemblGenomes-Tr; EBG00000012572-1.
DR   EnsemblGenomes-Tr; EBG00000012574-1.
DR   EnsemblGenomes-Tr; EBG00000012576-1.
DR   EnsemblGenomes-Tr; EBG00000012579-1.
DR   EnsemblGenomes-Tr; EBG00000012582-1.
DR   EnsemblGenomes-Tr; EBG00000012583-1.
DR   EnsemblGenomes-Tr; EBG00000012585-1.
DR   EnsemblGenomes-Tr; EBG00000012588-1.
DR   EnsemblGenomes-Tr; EBG00000012591-1.
DR   EnsemblGenomes-Tr; EBG00000012593-1.
DR   EnsemblGenomes-Tr; EBG00000012595-1.
DR   EnsemblGenomes-Tr; EBG00000012598-1.
DR   EnsemblGenomes-Tr; EBG00000012601-1.
DR   EnsemblGenomes-Tr; EBG00000012603-1.
DR   EnsemblGenomes-Tr; EBG00000012605-1.
DR   EnsemblGenomes-Tr; EBG00000012607-1.
DR   EnsemblGenomes-Tr; EBG00000012610-1.
DR   EnsemblGenomes-Tr; EBG00000012612-1.
DR   EnsemblGenomes-Tr; EBG00000012614-1.
DR   EnsemblGenomes-Tr; EBG00000012617-1.
DR   EnsemblGenomes-Tr; EBG00000012619-1.
DR   EnsemblGenomes-Tr; EBG00000012621-1.
DR   EnsemblGenomes-Tr; EBG00000012624-1.
DR   EnsemblGenomes-Tr; EBG00000012626-1.
DR   EnsemblGenomes-Tr; EBG00000012629-1.
DR   EnsemblGenomes-Tr; EBG00000012631-1.
DR   EnsemblGenomes-Tr; EBG00000012633-1.
DR   EnsemblGenomes-Tr; EBG00000012636-1.
DR   EnsemblGenomes-Tr; EBG00000012639-1.
DR   EnsemblGenomes-Tr; EBG00000012642-1.
DR   EnsemblGenomes-Tr; EBG00000012643-1.
DR   EnsemblGenomes-Tr; EBG00000012646-1.
DR   EnsemblGenomes-Tr; EBG00000012649-1.
DR   EnsemblGenomes-Tr; EBG00000012651-1.
DR   EnsemblGenomes-Tr; EBG00000012653-1.
DR   EnsemblGenomes-Tr; EBG00000012656-1.
DR   EnsemblGenomes-Tr; EBG00000012659-1.
DR   EnsemblGenomes-Tr; EBG00000012661-1.
DR   EnsemblGenomes-Tr; EBG00000012663-1.
DR   EnsemblGenomes-Tr; EBG00000012666-1.
DR   EnsemblGenomes-Tr; EBG00000012668-1.
DR   EnsemblGenomes-Tr; EBG00000012670-1.
DR   EnsemblGenomes-Tr; EBG00000012673-1.
DR   EnsemblGenomes-Tr; EBG00000012675-1.
DR   EnsemblGenomes-Tr; EBG00000012678-1.
DR   EnsemblGenomes-Tr; EBG00000012679-1.
DR   EnsemblGenomes-Tr; EBG00000012682-1.
DR   EnsemblGenomes-Tr; EBG00000012684-1.
DR   EnsemblGenomes-Tr; EBG00000012687-1.
DR   EnsemblGenomes-Tr; EBG00000012688-1.
DR   EnsemblGenomes-Tr; EBG00000012691-1.
DR   EnsemblGenomes-Tr; EBG00000012693-1.
DR   EnsemblGenomes-Tr; EBG00000012694-1.
DR   EnsemblGenomes-Tr; EBG00000012696-1.
DR   EnsemblGenomes-Tr; EBG00000012698-1.
DR   EnsemblGenomes-Tr; EBG00000012699-1.
DR   EnsemblGenomes-Tr; EBG00000012700-1.
DR   EnsemblGenomes-Tr; EBG00000012701-1.
DR   EnsemblGenomes-Tr; EBG00000012703-1.
DR   EnsemblGenomes-Tr; EBG00000012705-1.
DR   EnsemblGenomes-Tr; EBG00000012706-1.
DR   EnsemblGenomes-Tr; EBG00000012708-1.
DR   EnsemblGenomes-Tr; EBG00000012709-1.
DR   EnsemblGenomes-Tr; EBG00000012711-1.
DR   EnsemblGenomes-Tr; EBG00000012712-1.
DR   EnsemblGenomes-Tr; EBG00000012714-1.
DR   EnsemblGenomes-Tr; EBG00000012716-1.
DR   EnsemblGenomes-Tr; EBG00000012717-1.
DR   EnsemblGenomes-Tr; EBG00000012719-1.
DR   EnsemblGenomes-Tr; EBG00000012720-1.
DR   EnsemblGenomes-Tr; EBG00000012722-1.
DR   EnsemblGenomes-Tr; EBG00000012723-1.
DR   EnsemblGenomes-Tr; EBT00001603453.
DR   EnsemblGenomes-Tr; EBT00001603454.
DR   EnsemblGenomes-Tr; EBT00001603455.
DR   EnsemblGenomes-Tr; EBT00001603456.
DR   EnsemblGenomes-Tr; EBT00001603457.
DR   EnsemblGenomes-Tr; EBT00001603458.
DR   EnsemblGenomes-Tr; EBT00001603459.
DR   EnsemblGenomes-Tr; EBT00001603460.
DR   EnsemblGenomes-Tr; EBT00001603461.
DR   EnsemblGenomes-Tr; EBT00001603462.
DR   EnsemblGenomes-Tr; EBT00001603463.
DR   EnsemblGenomes-Tr; EBT00001603464.
DR   EnsemblGenomes-Tr; EBT00001603465.
DR   EnsemblGenomes-Tr; EBT00001603466.
DR   EnsemblGenomes-Tr; EBT00001603467.
DR   EnsemblGenomes-Tr; EBT00001603468.
DR   EnsemblGenomes-Tr; EBT00001603469.
DR   EnsemblGenomes-Tr; EBT00001603470.
DR   EnsemblGenomes-Tr; EBT00001603471.
DR   EnsemblGenomes-Tr; EBT00001603472.
DR   EnsemblGenomes-Tr; EBT00001603473.
DR   EnsemblGenomes-Tr; EBT00001603474.
DR   EnsemblGenomes-Tr; EBT00001603475.
DR   EnsemblGenomes-Tr; EBT00001603476.
DR   EnsemblGenomes-Tr; EBT00001603477.
DR   EnsemblGenomes-Tr; EBT00001603478.
DR   EnsemblGenomes-Tr; EBT00001603479.
DR   EnsemblGenomes-Tr; EBT00001603480.
DR   EnsemblGenomes-Tr; EBT00001603481.
DR   EnsemblGenomes-Tr; EBT00001603482.
DR   EnsemblGenomes-Tr; EBT00001603483.
DR   EnsemblGenomes-Tr; EBT00001603484.
DR   EnsemblGenomes-Tr; EBT00001603485.
DR   EnsemblGenomes-Tr; EBT00001603486.
DR   EnsemblGenomes-Tr; EBT00001603487.
DR   EnsemblGenomes-Tr; EBT00001603488.
DR   EnsemblGenomes-Tr; EBT00001603489.
DR   EnsemblGenomes-Tr; EBT00001603490.
DR   EnsemblGenomes-Tr; EBT00001603491.
DR   EnsemblGenomes-Tr; EBT00001603492.
DR   EnsemblGenomes-Tr; EBT00001603493.
DR   EnsemblGenomes-Tr; EBT00001603494.
DR   EnsemblGenomes-Tr; EBT00001603495.
DR   EnsemblGenomes-Tr; EBT00001603496.
DR   EnsemblGenomes-Tr; EBT00001603497.
DR   EnsemblGenomes-Tr; EBT00001603498.
DR   EnsemblGenomes-Tr; EBT00001603499.
DR   EnsemblGenomes-Tr; EBT00001603500.
DR   EnsemblGenomes-Tr; EBT00001603501.
DR   EnsemblGenomes-Tr; EBT00001603502.
DR   EnsemblGenomes-Tr; EBT00001603503.
DR   EnsemblGenomes-Tr; EBT00001603504.
DR   EnsemblGenomes-Tr; EBT00001603505.
DR   EnsemblGenomes-Tr; EBT00001603506.
DR   EnsemblGenomes-Tr; EBT00001603507.
DR   EnsemblGenomes-Tr; EBT00001603508.
DR   EnsemblGenomes-Tr; EBT00001603509.
DR   EnsemblGenomes-Tr; EBT00001603510.
DR   EnsemblGenomes-Tr; EBT00001603511.
DR   EnsemblGenomes-Tr; EBT00001603512.
DR   EnsemblGenomes-Tr; EBT00001603513.
DR   EnsemblGenomes-Tr; EBT00001603514.
DR   EnsemblGenomes-Tr; EBT00001603515.
DR   EnsemblGenomes-Tr; EBT00001603516.
DR   EnsemblGenomes-Tr; EBT00001603517.
DR   EnsemblGenomes-Tr; EBT00001603518.
DR   EnsemblGenomes-Tr; EBT00001603519.
DR   EnsemblGenomes-Tr; EBT00001603520.
DR   EnsemblGenomes-Tr; EBT00001603521.
DR   EnsemblGenomes-Tr; EBT00001603522.
DR   EnsemblGenomes-Tr; EBT00001603523.
DR   EnsemblGenomes-Tr; EBT00001603524.
DR   EnsemblGenomes-Tr; EBT00001603525.
DR   EnsemblGenomes-Tr; EBT00001603526.
DR   EnsemblGenomes-Tr; EBT00001603527.
DR   EnsemblGenomes-Tr; EBT00001603528.
DR   EnsemblGenomes-Tr; EBT00001603529.
DR   EnsemblGenomes-Tr; EBT00001603530.
DR   EnsemblGenomes-Tr; EBT00001603531.
DR   EnsemblGenomes-Tr; EBT00001603532.
DR   EnsemblGenomes-Tr; EBT00001603533.
DR   EnsemblGenomes-Tr; EBT00001603534.
DR   EnsemblGenomes-Tr; EBT00001603535.
DR   EnsemblGenomes-Tr; EBT00001603536.
DR   EnsemblGenomes-Tr; EBT00001603537.
DR   EnsemblGenomes-Tr; EBT00001603538.
DR   EnsemblGenomes-Tr; EBT00001603539.
DR   EnsemblGenomes-Tr; EBT00001603540.
DR   EnsemblGenomes-Tr; EBT00001603541.
DR   EnsemblGenomes-Tr; EBT00001603542.
DR   EnsemblGenomes-Tr; EBT00001603543.
DR   EnsemblGenomes-Tr; EBT00001603544.
DR   EnsemblGenomes-Tr; EBT00001603545.
DR   EnsemblGenomes-Tr; EBT00001603546.
DR   EnsemblGenomes-Tr; EBT00001603547.
DR   EnsemblGenomes-Tr; EBT00001603548.
DR   EnsemblGenomes-Tr; EBT00001603549.
DR   EnsemblGenomes-Tr; EBT00001603550.
DR   EnsemblGenomes-Tr; EBT00001603551.
DR   EnsemblGenomes-Tr; EBT00001603552.
DR   EnsemblGenomes-Tr; EBT00001603553.
DR   EnsemblGenomes-Tr; EBT00001603554.
DR   EnsemblGenomes-Tr; EBT00001603555.
DR   EnsemblGenomes-Tr; EBT00001603556.
DR   EnsemblGenomes-Tr; EBT00001603557.
DR   EnsemblGenomes-Tr; EBT00001603558.
DR   EnsemblGenomes-Tr; EBT00001603559.
DR   EnsemblGenomes-Tr; EBT00001603560.
DR   EnsemblGenomes-Tr; EBT00001603561.
DR   EnsemblGenomes-Tr; EBT00001603562.
DR   EnsemblGenomes-Tr; EBT00001603563.
DR   EnsemblGenomes-Tr; EBT00001603564.
DR   EnsemblGenomes-Tr; EBT00001603565.
DR   EnsemblGenomes-Tr; EBT00001603566.
DR   EnsemblGenomes-Tr; EBT00001603567.
DR   EnsemblGenomes-Tr; EBT00001603568.
DR   EnsemblGenomes-Tr; EBT00001603569.
DR   EnsemblGenomes-Tr; EBT00001603570.
DR   EnsemblGenomes-Tr; EBT00001603571.
DR   EnsemblGenomes-Tr; EBT00001603572.
DR   EnsemblGenomes-Tr; EBT00001603573.
DR   EnsemblGenomes-Tr; EBT00001603574.
DR   EnsemblGenomes-Tr; EBT00001603575.
DR   EnsemblGenomes-Tr; EBT00001603576.
DR   EnsemblGenomes-Tr; EBT00001603577.
DR   EnsemblGenomes-Tr; EBT00001603578.
DR   EnsemblGenomes-Tr; EBT00001603579.
DR   EnsemblGenomes-Tr; EBT00001603580.
DR   EnsemblGenomes-Tr; EBT00001603581.
DR   EnsemblGenomes-Tr; EBT00001603582.
DR   EnsemblGenomes-Tr; EBT00001603583.
DR   EnsemblGenomes-Tr; EBT00001603584.
DR   EnsemblGenomes-Tr; EBT00001603585.
DR   EnsemblGenomes-Tr; EBT00001603586.
DR   EnsemblGenomes-Tr; EBT00001603587.
DR   EnsemblGenomes-Tr; EBT00001603588.
DR   EnsemblGenomes-Tr; EBT00001603589.
DR   EnsemblGenomes-Tr; EBT00001603590.
DR   EuropePMC; PMC1168687; 15980329.
DR   EuropePMC; PMC1386717; 16423288.
DR   EuropePMC; PMC1610286; 16950908.
DR   EuropePMC; PMC1871835; 17420455.
DR   EuropePMC; PMC2242806; 18045455.
DR   EuropePMC; PMC2632007; 19074389.
DR   EuropePMC; PMC2632123; 19060158.
DR   EuropePMC; PMC3001079; 20716518.
DR   EuropePMC; PMC3368403; 22675593.
DR   EuropePMC; PMC3416434; 22610424.
DR   EuropePMC; PMC3552494; 21166891.
DR   EuropePMC; PMC3598637; 23339471.
DR   EuropePMC; PMC4051530; 24915086.
DR   EuropePMC; PMC4259227; 25484213.
DR   EuropePMC; PMC4409224; 25713075.
DR   EuropePMC; PMC4995803; 27559429.
DR   EuropePMC; PMC5135824; 27912769.
DR   EuropePMC; PMC555942; 15757509.
DR   EuropePMC; PMC60312; 11737947.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01412; BsrG.
DR   RFAM; RF01690; Bacillaceae-1.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; BA000004.
DR   SILVA-SSU; BA000004.
DR   StrainInfo; 267986; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4202352
FT                   /organism="Bacillus halodurans C-125"
FT                   /strain="C-125"
FT                   /mol_type="genomic DNA"
FT                   /note="alkaliphile"
FT                   /db_xref="taxon:272558"
FT   CDS_pept        584..1933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /product="initiation of chromosome replication"
FT                   /note="BH0001"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03720"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03720"
FT                   /db_xref="GOA:Q9RCA2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RCA2"
FT                   /protein_id="BAB03720.1"
FT                   /translation="MENIHDLWERALKSMEKKVSKPSFETWLKQTKANSIEDSTIIITA
FT                   PNEFARDWLEKHYDELISETIDDLTGVRLYPKFVIPTSQLDEPFVEQELKKPMKQPPAQ
FT                   NGEMPNNMLNDKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLM
FT                   HAIGHYVMDHNPNAKVVYLSSEKFTNEFINAIRDNKAVNFRNKYRNVDVLLIDDIQFLA
FT                   GKEQTQEEFFHTFNALHEDNKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLE
FT                   TRIAILRKKAKAENLDIPNEVMLYIANQIDTNIRELEGALIRVVAYSSLINQDMNADLA
FT                   AEALKDIIPNAKPRVLTITDIQKTVGEYFHVKLEDFKAKKRTKSVAFPRQIAMYLSREL
FT                   TDASLPKIGSEFGGRDHTTVIHAHEKISKLLSTDQELQDKIQDISDKLRS"
FT   CDS_pept        2103..3245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /product="DNA polymerase III (beta subunit)"
FT                   /note="BH0002"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03721"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03721"
FT                   /db_xref="GOA:Q9RCA1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RCA1"
FT                   /protein_id="BAB03721.1"
FT                   /translation="MHFVIDRDIFVQNVNHVSKAVSSRTTIPILTGIKIVADHEGVTLT
FT                   GSDSDISIETFIPLEEGDRQNVEVKQEGSIVLQAKVFAEIVKKLPEQEIEIHVQDSFVT
FT                   TIRSGSSVFNLNGLDPDEYPRLPVLEEDHVFRLPQKILKDIIRQTVFAVSTQETRPVLT
FT                   GVNFEIEDGILTCTATDSHRLAMRKVPVEKNDDELQFSNVVIPGKSLNELSKILDENEE
FT                   LLDIVVTENQTLFKLKNMLFFSRLLEGKYPVTKNMIPKEAKTSFAVHTKAFLQTLERAL
FT                   LLSREGKNQVINLKTLGDGVVEVTAITPEIGKVTENVATQGLEGEELRISFNGKNVIDA
FT                   LKVVDSESIHIAFTGAMSPFVLSPTDHDQSLHLFSPVRTY"
FT   CDS_pept        3429..3650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0003"
FT                   /note="BH0003"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03722"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03722"
FT                   /db_xref="GOA:Q7AJZ9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AJZ9"
FT                   /protein_id="BAB03722.1"
FT                   /translation="MSQQLPITTSYITLGQLLKEVGVIDTGGMAKWYLAEHEVLVNGES
FT                   EDRRGKKLFSGDSVTLADGTVIDLVDAE"
FT   CDS_pept        3662..4777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /product="DNA repair and genetic recombination"
FT                   /note="BH0004"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03723"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03723"
FT                   /db_xref="GOA:Q9RC99"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RC99"
FT                   /protein_id="BAB03723.1"
FT                   /translation="MHIERLTLKQFRNYDELDVSFEPNVNVIIGENAQGKTNVIEAIYF
FT                   LALAKSHRTARDKELIQWEAPFARIEGAFQKQNGPLSLHVVLSGKGKKVKVNGLEQRRL
FT                   SDYIGAVNVVMFGPEDLNLVKGSPQIRRRFLDMELGQMSPVYLHQLAMYQKILLQRNHL
FT                   LKQLFGKANSDPMLDVLTDQLIEVAVEVTKKRFEFIQLLQRWAEEIHQAISRGKEKLVI
FT                   TYEPSVHVSEQLNLSKLREGFYQAYEQKKERERQRGTTLFGPHRDDLVFFVNDKDVQTY
FT                   GSQGQQRTTALSLKLAEIELMKETVGDYPILLLDDVLSELDDYRQSHLLHAIQHRVQTF
FT                   VTTTNVDGIDHQTLQEATIYEVEQGSLKKKG"
FT   CDS_pept        4788..5057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0005"
FT                   /note="BH0005"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03724"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03724"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AJZ8"
FT                   /protein_id="BAB03724.1"
FT                   /translation="MFIHLGGDHVIRSKDVIAILDRDMEQSSGVTKEYLEHHQKNGNIV
FT                   TISSDLIKSIVVTPDTIYYSPISSVTLKRRSHAVSELDRFGEEE"
FT   CDS_pept        5130..7043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="BH0006"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03725"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03725"
FT                   /db_xref="GOA:O50627"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:O50627"
FT                   /protein_id="BAB03725.1"
FT                   /translation="MTREQQAYDESQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVWEI
FT                   VDNSIDEAMAGFCDEIGVVIEEDNSITVTDNGRGIPVGIHEKMGRPAVEVIMTVLHAGG
FT                   KFGGGGYKVSGGLHGVGASVVNALSTMLEVEVHREGKVHYQKFHRGVPAADLEVIGTTD
FT                   RTGTKIHFKPDGDIFTETTVFEYDTLASRLRELAFLNKGLRIKITDMREEEKSDEFHYE
FT                   GGIASFVEHLNRTRETLHETPIHIEGEKQGVYVEIAVQYNDGFTSNIYSFANNINTHEG
FT                   GTHESGFKTGLTRVINDYARKHNLFKESDPNLTGEDVREGLTAIISVKIPDPQFEGQTK
FT                   TKLGNSEARTITDSLFTEHFSRFLIEHPQVARKLVDKGLMASRAREAAKKARELTRRKS
FT                   ALEVSSLPGKLADCSSRDASISEIYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEK
FT                   ARLDKILANNEIRAIITALGTGIGDDFDIEKARYHKIIIMTDADVDGAHIRTLILTFFY
FT                   RYMRPLIEHGYVYIAQPPLYKVQQGKDIQYAYGDAELQEILSQLPDKAKPGIQRYKGLG
FT                   EMNPSQLWETTMDPGQRTVLQVTLEDAMKADEIFEILMGDRVEPRRDFIQENARYVKNL
FT                   DI"
FT   CDS_pept        7065..9566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="BH0007"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03726"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03726"
FT                   /db_xref="GOA:O50628"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:O50628"
FT                   /protein_id="BAB03726.1"
FT                   /translation="MAEQDQSRVKEINISQEMKTSFMDYAMSVIVSRALPDVRDGMKPV
FT                   HRRILYAMNELGMTSDKAYKKSARIVGEVIGKYHPHGDSAVYETMVRMAQDFSYRYMLV
FT                   DGHGNFGSIDGDAAAAMRYTEARMSKISMELVRDINKDTIDYQDNYDGSEKEPVVMPSR
FT                   FPNLLVNGASGIAVGMATNIPPHQLGEVIDGVLALSKNPDISVPELMEHIPGPDFPTGA
FT                   EILGRSGIRKAYQTGRGSITLRAKTEIEEHHGKQRIIVHEIPYQVNKAKLIEKIAELVR
FT                   DKKIDGITDLRDESDRNGMRIVIEVRKDANANVLLNNLYKQTALQTSFGINLLALVEGQ
FT                   PKVLNLKECLEHYLAHQVIVIRRRTAFELRKAEARAHILEGLRIALDHLDEVISLIRSS
FT                   QTTEIARNGLMERFELSYEQAQAILDMRLQRLTGLERDKIEAEYKELIERIAELKAILA
FT                   DHEKVLDIIREELLELKEKYNDERKTAISASEDMFEDEDLIPRQNVVITLTHHGYIKRL
FT                   PISTYRSQKRGGRGIQGMGTNEDDFVQHLFTTNSHHTILFFTNKGKVYRLKGYEIPELG
FT                   RTAKGIPIINLLQIEQDEYISTIIPIEEFTEDHYLFFMTKDGIAKRTQLSSFANIRRGG
FT                   LFAINLREGDELHGVRLTNGDKEVIVGTRQGMAIRFHETDVRLMGRTATGVKGISLTGD
FT                   DHVVGMDIVEDGQDVLIVTEKGFGKRTPIADYRIQTRGGKGIKTCNITEKNGPLVSLKV
FT                   VSVDHDLMIITASGIIIRLHVKDISVTGRITQGVTLIRVAEGEEVATVARVDIEDDELD
FT                   EDESIEEERDDRSEVEQGENE"
FT   CDS_pept        9763..10845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0008"
FT                   /note="BH0008"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03727"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03727"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AK03"
FT                   /protein_id="BAB03727.1"
FT                   /translation="MKVKLNQLVPGCIVLKPIMAETTTPLYKEKTVLTAEDIQTLSKFL
FT                   IDEIEVENVLANGEKFIPSDNGLGAEAAALMETGDRFKDRYMQAVANYKKVFQEWAAGT
FT                   PVEMECVRHILLPLFEEIVEKKDVLLQLHHYSTKEDYLYHHAVSVGLLSAFLGAKLGYE
FT                   KGEWLKIALAGALADCGMAKLPTSLLTKNGLYTLKEKHEMRDHPKYSYQMLKKRPEIDG
FT                   SLLSAVLQHHEREDGTGYPLGVRGQKIHFYAQILAVADVYHAMISERKYRKKKSPYMVL
FT                   EDLAKERFGKFNPRIVHVLVSQLTQLSVRTSVRLTNNRLGEIVFIDPMAPTRPMVQLQT
FT                   GEMIYLMKNYTVHIEDVLLS"
FT   CDS_pept        complement(10970..11776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0009"
FT                   /note="BH0009"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03728"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03728"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="InterPro:IPR027860"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AK02"
FT                   /protein_id="BAB03728.1"
FT                   /translation="MSEQMFEGWNGAIVVTPETVKIIYGNQHSKGEGEKEITLESIQSI
FT                   ELKKPRFLAQGYIQLILEGSKKKKGALAAMGDEHSIMINDEAQYKQFEQAKELIELFQH
FT                   EQKLVSEQNEKGEGWREDVFKGGNGTLVVTPETIKIIYSWLHTRGRGEKTINIRSISSI
FT                   QLKEPAVVAGYIQFTFQGSIENQSRSSFSAIDDQNTIAISNKHQFEDFKRAKALIESYQ
FT                   NQLYAPQIQSSSTSGADELKKYKELLDDGIISEEEFNAKKKQILGI"
FT   CDS_pept        12114..12533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0010"
FT                   /note="BH0010"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03729"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RC95"
FT                   /protein_id="BAB03729.1"
FT                   /translation="MTEKRFAGTRIEVNGIVVAKITSFTHSLEVEEADVTGLGDVDEGS
FT                   SVFRQKFIASAIGETAAMEGVVLVDDAGQSELKRVAESGQDAVVKHTDENGNGYELTGF
FT                   FTTYEEEGSVSEGVYTFSGEFRVNEKSVVSGDESA"
FT   CDS_pept        12526..12972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0011"
FT                   /note="BH0011"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03730"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03730"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGP6"
FT                   /protein_id="BAB03730.1"
FT                   /translation="MPKHTQEERLSLLDQKADELSRIQQDQLVADYDEAIAEHENGDKP
FT                   KYVKFAGEYFEISKEMPFRFATFYFRHCVRKVKGKTQMEVPEDKMFEFIELMLGKKFLE
FT                   RLEQSDAGVHFVFKHIVPDIMSMWGYDVKSDKPSGGQKKTKTRG"
FT   CDS_pept        13208..14737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0012"
FT                   /note="BH0012"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03731"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03731"
FT                   /db_xref="GOA:Q9KGP5"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGP5"
FT                   /protein_id="BAB03731.1"
FT                   /translation="MAITIGSSPGITLDFEKIQKDGKVFQDLASNLGNIKTHIQEINEN
FT                   LANGQFGTVFLGMVGTIGTLIVSFGLLVQSIEILKRVFVLLIGSIAPLTIGLIKFIAIA
FT                   GIIIAVVAGIAAGLMHLWKTNEGFRDTVLTVWETIQRVITTVLNEVVSFISEKLEMIKQ
FT                   FWNEHGDAIKQAVSNVFNAIWAVIQPIMDMILAIMQFVWPFVRELIIGVWNNIKGVIDG
FT                   ALSFIMGLIKTFTGLFTGDFSLMWEGLKQMFMGALQFIWNLIQLWFVGRVLGILKVFIG
FT                   RFIGPLKTMWSNVRGIFNTGLNAIRNFFTNIFNSIRSTVGTIMNSIRTTIQNGINAAVQ
FT                   VVMGFFSRFREAGRNIVTSIADGIRSAIGAVTGAISNVASKIRNFLPFSPAKEGPLQDI
FT                   HRLNFGGPIRDSIDGDLPEIQSSLTRALHVPEVGIGQVGSSPLLMRLIKSLDALGLNGN
FT                   HGMLAGAGSEKVVIEVPVHLEGKEVARVTAPYMDTELGKRRISTVRARGGR"
FT   CDS_pept        14738..15490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0013"
FT                   /note="BH0013"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03732"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03732"
FT                   /db_xref="InterPro:IPR006520"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="InterPro:IPR038675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGP4"
FT                   /protein_id="BAB03732.1"
FT                   /translation="MFIYDEFDFTPYLTVNSIKRPLLPPQELSTMSIYGRHGDFFFRKQ
FT                   HGAVTLVVSVTIRDQTVDGYRNRIRELAGHLNKSEPKPLIFKDEPDKFVRALMTDESDL
FT                   EELVMMGQGELSFYCPDPYFYAIEDEVFTFSGAGSYDFSREKGTTESFPLIEIRGEIGS
FT                   TGEVTIETDDTRLTFNGLLSRGDILTLDSHYLTAYIQKPDGSQVSAINELDRMDFPVLK
FT                   TGVNHMAIRATGEADVHEVQMMSRSRWL"
FT   CDS_pept        15625..17118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0014"
FT                   /note="BH0014"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03733"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03733"
FT                   /db_xref="InterPro:IPR007119"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGP3"
FT                   /protein_id="BAB03733.1"
FT                   /translation="MYSYNQLRRVTFNQLGRIAYNSRSSPRRRAVFERLAGARPVVLTQ
FT                   ERERLAVLDHANDIILEQEINGIDTVTFNIPFSDEKNQFIQNEHLIQIIDDYYIIRKIT
FT                   HSRGSQGVPITEVYAEALWYDLQFAEPMDISEWEGRAPAIVMADILRGTDWSVGRVELM
FT                   NVRNVSVEPGVTNRLAALSQLPEVYGGELHFNSEAMTVDFLAPVGRQSGAAIVYEKNIH
FT                   SIEAIYDTEDLITRIYPYGKENLSIEDINDGVPYLDIRDDPSYEFTDKLRVRILKDDRF
FT                   TNPFHLREMAEEALKVLSQPRTSYHIKAADLSEMAGMSHEQFFLGDEVRVYDKELGIDI
FT                   ATRIMAWQYNVAEPWNTEIMLESKQPTLSDLLTGIQEGTGFLQSEDTVDSSDMLELSVF
FT                   NHILNSRADDGFHYWTNSGWEIDAVNGYSGNASFKATGTTGRKVLSQTVYPAHRDHYAI
FT                   SFRSATKEFQTNDGGRVGLEIIVRYDDGTEDEPTFISLT"
FT   CDS_pept        17131..17316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0015"
FT                   /note="BH0015"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03734"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03734"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGP2"
FT                   /protein_id="BAB03734.1"
FT                   /translation="MFSERYGVIQADSSKTVSEIEVRIIAEKFSGEVHLTDVMLQGGRL
FT                   STNWTGHPSEQHWSNE"
FT   CDS_pept        17321..18169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0016"
FT                   /note="BH0016"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03735"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03735"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGP1"
FT                   /protein_id="BAB03735.1"
FT                   /translation="MYSKDQWTRFLTQDVKTNAEKRVRAIEFKLLAENFRGQINITDLQ
FT                   LQAGKFVTGTVPYTGEWLRRKSSTLDEHDSTEGVSEPIEIRGDQPRVFEGIRNRFYNIV
FT                   GRGHEALAFPNVEENRFDRPNVTTPLDLTLYTKNSFDLLRISTNQGSLLDESLQPYPDI
FT                   RDHPLNLRYSKEFYFEGGEGGSEIKLHASRNIATLNGRAANRRSRTLPIGSAELKMGQQ
FT                   RMMGLPAGSGRIRIEFYNLVEETVETEWGDIEQRQILRDTGVGYWGVAEFAHWENGRSK
FT                   L"
FT   CDS_pept        18166..21030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0017"
FT                   /note="BH0017"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03736"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGP0"
FT                   /protein_id="BAB03736.1"
FT                   /translation="MTSMQFMSWSLNEPSNAQFQQYAVETEPGVWRVDNPNAFLNWGGD
FT                   QKNFWIAFLKHHQKISSFGLHDFGVRSDGTIYSYKAGTTFTVLNDEGQVQYWIRDSLRY
FT                   LLDSYPSIEWFLQAVCMGAPVESMLDNESSQTTFIHQFRLITEQYIERFPNRIKGLEID
FT                   FEKSSSRPREFREAEKYRDFLARVKNEIAIPLGLKLRVNLHAMTGDFNPYWYQWTDYRT
FT                   LATGRDKNGNDICDEWQIMSYDFAHNNSAPGPSTPVWWLQQVLAHVNNVFRNENVWIGN
FT                   AAYGRRWPLEAKRSGTAVRYWQLLMWQNGIFKHNIGRPADTGAFTWVDQSYIPYCGFHD
FT                   DESGYQRTFLHCYDRFRVDYGKLQGAYNNQSVIFRSTYQGQRYITSFSKHQRSKFSGVE
FT                   AIVHNGTARGNYTTPTRWTPDGFSQTFTAYNTHRATYRPNHDLERCELDEEAGNVTYSF
FT                   HLNQPGKYRLIAVVYFPYLNGKIPLTINGHTYTIGDDVPDWYPFYVNPDRHFYDCGEWD
FT                   LQISNTIQVGVTEDSAAIMGFVICDHFEHGMTGGYVEYDVNLQAPYKRGTIENGIVTKE
FT                   EASFPQHVTLTGELLRRPPRPAIVWEDLFGPHARLNANGEKEVKNLVETPYYQRARMVT
FT                   PSGNQYENRQCVGTAELVGYSNGNWEPFAENYCFADARGQSAQLLLHKEFQFNPHIEAD
FT                   ATALDSGQVGIRFYAKGKGQTGNGYLFLADFQSRQYRLVYQSNGQSQTLATAPIGTLQV
FT                   GSRYTYRVRVHNGRILCLIGSNTVIDYTDQSTNRMDRGAHGIYASGCRIRCHRLHVATN
FT                   DRYEPMEKVQVIVDSQEQPIALEESRPYSYDELGYLVYSGFNPDQGLGISISNDYENLP
FT                   IATIPSWIGEKKVKIRLADAGVWLRSFYVGDSEGYSIAWNSDLEGFMTTLKMIEDYGCK
FT                   GVAMWTVGQEDPRVFTYLLGRDDR"
FT   CDS_pept        21088..22161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0018"
FT                   /note="BH0018"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03737"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03737"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGN9"
FT                   /protein_id="BAB03737.1"
FT                   /translation="MAKTPYRDLASESILSAHLSGVQHDVNKIQDVLGMKTDVKENHPL
FT                   LPVTDQEDSTLRFRIYEADIRNWTTQPEPVIYRDGTVVDPGEYELYPAYGAVVFVAQQH
FT                   TDAEVTADFTHIIGEANILDDIAQHAQEIEQIKENMQGPGSGTEEAVIRVGGVEPFYPV
FT                   AGTYLSHYRRDYNPIIESGYHTESHRPAFGILVYGNTIDAFPFPITRKTTFVRAGLCLR
FT                   NGNDTVRAKVGIYADDGTGRPSNLIFQSPEMTIAADGGWGYADLQVELQPGLYWIARHD
FT                   GADAYWNGLHQMSAIPLMRFNGETFLQNLAERPNPHTVFGGYRATNITYGNMPQTFPTS
FT                   GELFRRDYYCSPWLITG"
FT   rRNA            22819..24370
FT                   /gene="rrnA-16S"
FT                   /product="16S ribosomal RNA"
FT   rRNA            25054..27992
FT                   /gene="rrnA-23S"
FT                   /product="23S ribosomal RNA"
FT   rRNA            28401..28516
FT                   /gene="rrnA-5S"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        complement(28792..29745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0019"
FT                   /note="BH0019"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03738"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03738"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWQ9"
FT                   /protein_id="BAB03738.1"
FT                   /translation="MTEHRWEKLLPFFSATYTRKYLFERYEQQEIAQSSTMSYRTCYAF
FT                   MYHLQHGKLFLEQGANAPYEIKPVLFFYGLIQLLKVCILTVDPEYPSSSQVLAHGVTTR
FT                   KRKKNRYRFFSDEVKVQRHGLFSHVLDKMFHMKQINGEKYRMETLLLHAPILFPVLESI
FT                   YKKTLAVPCHIDEATLRIPTTLLDHYHMTETRFETYLNDYSVKKFTRQESSESGDFLMF
FT                   KASSPLNPFKCHPFLYESKSKVWLLTDREETLHLPSIAIHYLLLYNLSMLCRYETEWWG
FT                   ELFHTFDGEDLPIILRLLDGYEQLIPEWISAFLLGG"
FT   CDS_pept        29875..31332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /product="inositol-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="BH0020"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03739"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03739"
FT                   /db_xref="GOA:Q9KGN8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGN8"
FT                   /protein_id="BAB03739.1"
FT                   /translation="MWENKFQKEGLTFDDVLLVPAKSEVLPRDVSVKTKLTETLQLNIP
FT                   IISAGMDTVTEAKMAIAIAREGGLGIIHKNMSVEEQAEQVDRVKRSESGVITNPFFLTP
FT                   DRQVFDAEHLMGKYRISGVPIVDEDQKLVGILTNRDLRFIEDYSTLIDDVMTKENLVTA
FT                   PVGTTLKEAEEILQKHKIEKLPLVDESGTLKGLITIKDIEKVIEFPNSAKDSQGRLIVG
FT                   AAVGVSADTDVRVAALVEAGVDVIVIDTAHGHSKGVLEKVKAIREQYPDLTIIAGNVAT
FT                   AEATRDLIEAGANVVKVGIGPGSICTTRIVAGIGVPQITAVYDCANEARKHGVPIIADG
FT                   GIKYSGDIVKALAAGGHAVMLGSLLAGVSESPGEREIFQGRQFKVYRGMGSLGAMEKGS
FT                   KDRYFQENNQKLVPEGIEGRIPYKGPLHDTIHQLVGGIRAGMGYCGTKTIDELRENTQF
FT                   IRITGAGLRESHPHDVQITKEAPNYTL"
FT   CDS_pept        31440..32774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="BH0021"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03740"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03740"
FT                   /db_xref="GOA:Q9KGN7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGN7"
FT                   /protein_id="BAB03740.1"
FT                   /translation="MKHQTKKWFILVLAMAMVFSMFTPAMTANAAFELEAESAILVDAE
FT                   SGKILYGKNIDAVLPTASMTKMMSEYLILEAINEGEISWDQEVPISDYVRELSLYVQLS
FT                   NVPLRQDETYTVKELYESVAIYSANASTIALAELIAGSESAFVQRMNEKGEELGLEDFK
FT                   FVNSSGLNNKDLLGNHPEGTDANAENVMSARATAKLAYNLLKDYPEVLETASIPEKTFR
FT                   AGEGEEIEMENWNWMLKGIRPQHDYEGIDGLKTGYTAEAGNCFTGTAERNGMRLISVVM
FT                   RTETRDDRFKETAKLLDYGFNNFTHTEVLPAGFQPAEAQTLPVSSGKEREVSISTSEPL
FT                   HAVVRNGEEELYDPVVTIDESSLDEDGGLEAPVEAGQAVGQITLTYSGDGETAYLYEDQ
FT                   QGGTTLVTDADVERAGWFSLLMRGIGGFFSNVWSAAADTVRGWFS"
FT   CDS_pept        32914..33810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0022"
FT                   /product="superoxide-inducible protein"
FT                   /note="BH0022"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03741"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03741"
FT                   /db_xref="GOA:Q9KGN6"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGN6"
FT                   /protein_id="BAB03741.1"
FT                   /translation="MVDTGTDRVKRGMAEMQKGGVIMDVVNAEQAKIAEEAGAVAVMAL
FT                   ERVPADIRAAGGVARMADPTIVEEVMNAVSIPVMAKCRIGHIVEARVLEALGVDYIDES
FT                   EVLTPADEVYHLNKRDFTVPFVCGARDLGEAARRIGEGASMIRTKGEPGTGNIVEAVRH
FT                   MRMMQAQIRKVSNMSTDELMTEAKNIGAPYELLLSIKETGELPVVNFAAGGVATPADAA
FT                   LMMQLGADGVFVGSGIFKSETPEKFARAIVEATTHYEDYDLIAKLSKGLGTAMKGIEIS
FT                   TLDASERMQERGWEKGS"
FT   CDS_pept        33818..34408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0023"
FT                   /product="amidotransferase"
FT                   /note="BH0023"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03742"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03742"
FT                   /db_xref="GOA:Q9KGN5"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGN5"
FT                   /protein_id="BAB03742.1"
FT                   /translation="MVKIGVLALQGAVREHVRCLEAPGVEVSIVKKVEQLEDLDGLVFP
FT                   GGESTTMRRLIDKYGFFEPLKAFAAQGKPVFGTCAGLILMATRIDGEDHGHLELMDMTV
FT                   QRNAFGRQRESFETDLIVEGVGDDVRAVFIRAPLIQEVGQNVDVLSKFGDEIVVARQGH
FT                   LLGCSFHPELTDDRRFHQYFVQMVKEAKTIAQS"
FT   CDS_pept        34678..35955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="BH0024"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03743"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03743"
FT                   /db_xref="GOA:Q9KGN4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGN4"
FT                   /protein_id="BAB03743.1"
FT                   /translation="MLDIKRLRKDFAGIREKLQTRGEDISGLEKFGSLDEKRRQVIVKV
FT                   EELKSRRNQVSQEVAQLKREKKDADHLIKEMRDVSDEIKGLDETLRQLDEELDQLLLAI
FT                   PNVPHESTPVGETEDDNVEVRKWGEVPNFPFEPKAHWDLATALGIVDFERAAKVTGSRF
FT                   AFYKGAGARLERALINFMMDLHHDKHGYEEVLPPYLVNRTSMTGTGQLPKFEEDAFKIR
FT                   EEDYFLIPTAEVPVTNLHRDEILSADQLPIAYTAYSMNFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVRFVAPEDSYDELEKLTGHAEKVLQLLKLPYRVMSMCTADLGFTAAKKYDLEVW
FT                   IPSANTYREISSCSNFEDFQARRANIKFRREAKGKAEFVHTLNGSGLAVGRTVAAILEN
FT                   YQQEDGTIVIPEVLRPYMGGMEKFEA"
FT   CDS_pept        complement(36376..37278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0025"
FT                   /product="acetamidase"
FT                   /note="BH0025"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03744"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03744"
FT                   /db_xref="GOA:Q9KGN3"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="PDB:2II1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGN3"
FT                   /protein_id="BAB03744.1"
FT                   /translation="MIRLSNENTIFFMDKENVPIASCQSGDTVIFETKDCFSDQITNEE
FT                   QALTSIDFNRVNPATGPLYVEGARRGDMLEIEILDIKVGKQGVMTAAPGLGALGESLNS
FT                   PTTKLFPIEGDDVVYSTGLRLPLQPMIGVIGTAPPGEPINNGTPGPHGGNLDTKDIKPG
FT                   TTVYLPVEVDGALLALGDLHAAMGDGEILICGVEIAGTVTLKVNVKKERMFPLPALKTD
FT                   THFMTIASAETLDAAAVQATKNMATFLANRTALSIEEAGMLLSGAGDLYVSQIVNPLKT
FT                   ARFSLALHYFEKLGVDLCN"
FT   CDS_pept        complement(37372..39297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0026"
FT                   /product="nucleotidase precursor"
FT                   /note="BH0026"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03745"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03745"
FT                   /db_xref="GOA:Q9KGN2"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGN2"
FT                   /protein_id="BAB03745.1"
FT                   /translation="MKKAILSLISFFLVLTCFQTPFAEAKGKPHVTKEEYLITLLDELE
FT                   LEVAMYEGADVPFSDVSKEAIPYIEAAIRMDILDDTLGAEFGATRPISKEEAYVLLIRA
FT                   LQLEPSNLDVLKKVRDQRQITYPAEVAATLEYGLVVLEKNNKLRPKTKLTRTELTDMFE
FT                   RLDENFERLSIVHTNDLHGRILPNESNGEMGLAKIASIANSVRESNSESLLLDLGDTFH
FT                   GTNYVNFNEGEAAAEAMNLMGYDAMVAGNHDFNFGYERLVQIAEETLAFPLLSGNVLKT
FT                   ETGDTLFSTHQIVQIHNQKVALIGLTASDTPVKTHPDNIKGLTFTDEVEAAQSLVDQIA
FT                   PTVDHVFLLTHIGYGVDRQIAEQVEGIDLILGGHSHTTLESPVKVNDTYITQAYEHGKA
FT                   VGVTYVLFHQGEFASAYGQLIRDYPGLTADPEVENLLDTYKKEVEDALAEVIGTVPERL
FT                   VGAREFVRTQESNLGNLITDAMRDMTGADIAFTNGGGIRANIEAGDVTKGDVIAAFPFT
FT                   NTVIALEITGEQLFQSLEHSVRLAPAENGGFLQVSGVQMTYDQTKAPGERIIDLTVNGE
FT                   PLDKNKTYTVATNDFLAAGGDGYSWLADGTLVIDTGELLSEAASRYIASGQPIPPVEGR
FT                   IQVVGQ"
FT   CDS_pept        complement(39462..40478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0027"
FT                   /product="oligopeptide ABC transporter (ATP-binding
FT                   protein)"
FT                   /note="BH0027"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03746"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03746"
FT                   /db_xref="GOA:Q9KGN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGN1"
FT                   /protein_id="BAB03746.1"
FT                   /translation="MQKELLKVEGLKQYFPIKGGILGRTVNHVKAVDDVSFTIYEGETV
FT                   SIVGESGCGKSTTGRAILRLDEPTDGKIEFQGEDLLSLNKREMRKKRKDLQIIFQDPYA
FT                   SINPRQTIRQVLEEAMEIQKVVPRDKRGERIRELMDTVGLGSHQADRFPHEFSGGQRQR
FT                   IGIARALSVNPKLIVCDEAVSALDVSIQAQVINLLKRLQREFKLTYLFISHDLGVVRHI
FT                   SDRVIVMYLGRIVEIADKTSLFENPQHPYTKALLSAIPVPDPEKKKERIILKGDVPSPI
FT                   DPPNGCRFHTRCPFATDKCRTETPELRTADYMKDGHLAACHYMEEIESGSHQQPAQA"
FT   CDS_pept        complement(40459..41502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0028"
FT                   /product="oligopeptide ABC transporter (ATP-binding
FT                   protein)"
FT                   /note="BH0028"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03747"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03747"
FT                   /db_xref="GOA:Q9KGN0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGN0"
FT                   /protein_id="BAB03747.1"
FT                   /translation="MTTKVASKAETILEVRDLRTSFFTEAFEVKAVDGVTFSVPKGKTL
FT                   GIVGESGSGKSITSLSILKLIQEPGKVVGGEINFKGENLVTKNEAYMRKIRGNEISMIF
FT                   QEPMTSLNPVYTVGQQISESFRIHEKLGKKEALKRSVDMLKLVGIPSPEKRVHQYPHEL
FT                   SGGMRQRVMIAMALACNPELLIADEPTTALDVTIQAQILELMKDLQDRLGMSIIMITHD
FT                   LGVVAETCDYVAVMYCGKVVEYADVKTLFKNPRHPYTVGLLNSLPRHDIDLEDEELSVI
FT                   KGNVPSPADMPEGCRFAPRCPFASDICKERLPDLETDENGNQIRCWVYSEQWDGDPEVN
FT                   IYAERTS"
FT   CDS_pept        complement(41561..42505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0029"
FT                   /product="oligopeptide ABC transporter (permease)"
FT                   /note="BH0029"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03748"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03748"
FT                   /db_xref="GOA:Q9KGM9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGM9"
FT                   /protein_id="BAB03748.1"
FT                   /translation="MFVFIIRRLLQTIPVLIGVSIIVFSLLHLVPGDPAIMIAGESAPQ
FT                   QTVENIRERLGLNDPVPVQYFNYVSGVIQGDLGTSFRSGRPVADDIAQRFWVTLELSIY
FT                   SIILSVFLGLIAGIVSATKRYSFADTSLMIIALFGLSMPNFWLGLMLIQWFAIGYTPWL
FT                   PFDTAWFAPSGWGSFRQIVLPVITLGTAGAAIVARMTRSSMLEVLHQDYIRTARAKGVK
FT                   ERVVVYRHALKNALIPVVTVVGIQFGFLLGGSVLTEQVFAINGLGRLIIEAIRQRDFPV
FT                   VQGAVLVISVLFVFVNLLVDITYRFLNKRIDLD"
FT   CDS_pept        complement(42524..43429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0030"
FT                   /product="oligopeptide ABC transporter (permease)"
FT                   /note="BH0030"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03749"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03749"
FT                   /db_xref="GOA:Q9KGM8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGM8"
FT                   /protein_id="BAB03749.1"
FT                   /translation="MSAQTEQTINSEATAAPPPNPRIQSWKNFYKKLAKNKAAMVGLSL
FT                   IIFFIVVALIGPYFTTHDPYEPNVMNKLAEPSAEHWFGTDHHGRDIFTRIIHGMSITLY
FT                   VGFFSVVLGAIVGVILGVVSGYYGRLVDTVIMRIMDVLLAFPGILLALAIISILGGSIN
FT                   NVIIAVGIFSIPVFARIVRGSTLAVRKLEYIDAVKALGASDARIIFKHILPNVLSPIIV
FT                   QGTLSIATSILTASALSFLGLGAQPPIPEWGAMLSDGRNYMYDAPHVALFPGLAIVVVV
FT                   LAFNIFGDGLRDALDPKSKN"
FT   CDS_pept        43756..45372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0031"
FT                   /product="oligopeptide ABC transporter
FT                   (oligopeptide-binding protein)"
FT                   /note="BH0031"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03750"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03750"
FT                   /db_xref="GOA:Q9KGM7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGM7"
FT                   /protein_id="BAB03750.1"
FT                   /translation="MKVSKNSFLFWALALMLTVVLAACASEPNEGAADPETDEGQGTEA
FT                   PAEAGGDLVIAQLSDVVSLDPAGSNDTPSSDVQANIYETLVVTDQDMELHPGLATEWNP
FT                   IDDTTWEFKLREGVKFHDDTDFNAEVVKANLERILDPEVASPRAFLYDMITDIEVVDDY
FT                   TVHITTEFPFAPLPAHLAHNGGGMVSLEAIEADYAAMEEGKDPGSYINENPTGTGYFKF
FT                   DDRVPDQYVRLVRNDDYWDGTALLDSVTFKVVGEDLTRIAELETGDSHISNPLSPSDVS
FT                   RVEATEGMHVHRQDSMSLSYIGFNLDKEPFDDVRVRQAISMAIDKSQIIDGIYDGVGVP
FT                   AIGPLAPGTVGYDDTVSGLDHDIEKAKELLAEAGYEDGFSTTLWTNDNRERVDAATNVQ
FT                   AQLKEIGIDVEIEVLEWGTYLENTANGEHDMFVLGWSTVTGDADYGLYALFHSSQVGEP
FT                   GNRTFLKDDELDELLDKARRETDEETRLALYHDVQEKLVELAPMLYIHHQQYLLGVRDE
FT                   VKNLEQSPTQILQLKDVYIEQ"
FT   tRNA            45480..45572
FT                   /gene="trnA-Ser"
FT                   /product="transfer RNA-Ser"
FT   CDS_pept        45754..45885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0032"
FT                   /note="BH0032"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03751"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03751"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGM6"
FT                   /protein_id="BAB03751.1"
FT                   /translation="MMDEKKKQEQGLSTIEKAYVRWVSMRKFEKGPASSKRLPYNNR"
FT   CDS_pept        45912..46391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0033"
FT                   /product="Cu binding protein (Mn oxidation)"
FT                   /note="BH0033"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03752"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03752"
FT                   /db_xref="GOA:Q9KGM5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGM5"
FT                   /protein_id="BAB03752.1"
FT                   /translation="MQKDDLYYMREALVQADEAERLGEVPIGAVIVKDGVVVAKAYNLR
FT                   EINQQAIAHAELLAIEKACKALGTWRLTGCTLYVTLEPCPMCAGAIVQSRIERVVYGAT
FT                   DPKAGCAGTLMNLLNEERFNHQTIVESGVLEEECSQRLTAFFRKLRERKKRGSDT"
FT   ncRNA           46482..46753
FT                   /gene="scr"
FT                   /product="signal recognition particle (SRP)-like component"
FT                   /ncRNA_class="scRNA"
FT   CDS_pept        46908..48602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /product="DNA polymerase III gamma and tau subunits"
FT                   /EC_number="2.7.7.7"
FT                   /note="BH0034"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03753"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03753"
FT                   /db_xref="GOA:Q9KGM4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGM4"
FT                   /protein_id="BAB03753.1"
FT                   /translation="MSYQALYRVWRPQKLQDVVGQEHITKTLQNALVQEKFSHAYLFSG
FT                   PRGTGKTSAAKIIAKAINCEQAPIAEPCNECRACKGITSGSIVDVMEIDAASNNGVDEI
FT                   RDIRDHVKFAPSEVRYKVYIIDEVHMLTTGAFNALLKTLEEPPSHAIFILATTEPHKIP
FT                   LTIISRCQRFDFKRISNDALVGRMKEILTHEGIEAEDEALVLVARAAEGGMRDSLSLLD
FT                   QAISFADERVTVEDVLAITGAVSHEVLTQVVESAQKGETAEALQLVNQLLANGKDPLRF
FT                   VEDLIYYYRDLMLFKAAPEASQLLERAQINDSFKTLAGEINDASLFAAIEILNDCQQRM
FT                   RWSSHPRVALELGVVTLCQQVVQVPASPQAGAATHPNVEALQERIQQLEQAVQSLKVNG
FT                   VANVTAEEPKTKQASRRPLKQMPKSQAPTGKIKELLKEASKQQLQLVNGRWGEVMERVK
FT                   AQNVPAHAWLMDCKPAAASPKFILLAFQNEMHRDMIDTKFRPFIESVLRDIFQAPLDFQ
FT                   TLLQSQWNKVKEEYVRDQRGDGEEPSSDPLIEEAIKLVGSDLIEVKD"
FT   CDS_pept        48620..48931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0035"
FT                   /note="BH0035"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03754"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03754"
FT                   /db_xref="GOA:Q9JWQ5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWQ5"
FT                   /protein_id="BAB03754.1"
FT                   /translation="MKNMGQMMKQMQKMQKQMMKAQEELKEKTVEATAGGGMVTVVASG
FT                   DKRILDVRISEDVVDPDDVEMLQDLILAATNEALKKVDELVEQDMGKFTKGLNMPGMF"
FT   CDS_pept        48944..49540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /product="DNA repair and genetic recombination"
FT                   /note="BH00036"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03755"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03755"
FT                   /db_xref="GOA:Q9KGM3"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGM3"
FT                   /protein_id="BAB03755.1"
FT                   /translation="MQYPEPIAKLIEGFMRLPGIGPKTASRLAFFVLEMKEDDVLDFAK
FT                   ALVNVKRKLTYCSVCHNITDTDPCRICEDSKRDESVICVVQDAKDVIAMEKMKEYHGKY
FT                   HVLHGAISPMDGIGPEDIKIPELIKRLQDDTIQEVIVATNPTIEGEATAMYISRLVKPT
FT                   GIKVTRIAHGLPVGGDLEYADEVTLSKAMEGRREL"
FT   CDS_pept        49555..49770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0037"
FT                   /note="BH0037"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03756"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03756"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWR4"
FT                   /protein_id="BAB03756.1"
FT                   /translation="MFFRKKGKIRKIEDERLLAFIEKQKKQLEMQQQMVENSVDPSEEV
FT                   LYRLKLTKAKYLFLLKEARVRNTSKR"
FT   CDS_pept        49847..50122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bofA"
FT                   /product="inhibitor of the pro-sigma K processing
FT                   machinery"
FT                   /note="BH0038"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03757"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03757"
FT                   /db_xref="GOA:Q9KGM2"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGM2"
FT                   /protein_id="BAB03757.1"
FT                   /translation="MRPIDPVVVITILGGAIVVLLIVGAPIKPLRMLGQIGIKFVIGGL
FT                   LLFFVNVFGALIDLHVPINFITAAVSGFLGIPGLALLVAIQQLVLS"
FT   rRNA            50588..52139
FT                   /gene="rrnB-16S"
FT                   /product="16S ribosomal RNA"
FT   rRNA            52991..55929
FT                   /gene="rrnB-23S"
FT                   /product="23S ribosomal RNA"
FT   rRNA            56235..56350
FT                   /gene="rrnB-5S"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        56938..58194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0039"
FT                   /product="transposase (11)"
FT                   /note="BH0039"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03758"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03758"
FT                   /db_xref="GOA:Q9JWR9"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWR9"
FT                   /protein_id="BAB03758.1"
FT                   /translation="MLERILSRENLIQALERVEKNKGSYGVDEMDVKSLRLHLHENWTS
FT                   IRNEIIEGSYFPKPVRRVEIPKPNGGVRKLGIPTVMDRFLQQAIAQILTQLYDPTFSER
FT                   SFGFRPHRRGHNAVRQAKQWMKEGYRWVVDIDLEKFFDKVNHDRLMRKLSSRIQDPRVL
FT                   QLIRRYLQTGVMERGLVSPNTEGTPQGGPLSPLLSNIVLDELDNELEKRGLKFVRYADD
FT                   CNIYVRSKRAGLRIMESVTSFIENRLKLKVNREKSAVDRPWNRKFLGFSFTRGKDPKMR
FT                   VSKESVKRLKQRIRELTSRRHSMKMSDRLRRLNRYLTGWLGYYQLVDTPSILAQIDAWI
FT                   RRRLRMIRWKEWKTTSARQKNLVRLGIKKAKAWQWANSRKGYWRVAHSPIMDYALNSEY
FT                   WKGQGLMSLAERYQTRRWT"
FT   CDS_pept        58781..58981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csfB"
FT                   /product="sigma-F transcribed protein"
FT                   /note="BH0040"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03759"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03759"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGM1"
FT                   /protein_id="BAB03759.1"
FT                   /translation="MNEPKGTTVQERKRCVICEQPRPSGIQLFESFICEGCEQEIVKTE
FT                   IEDTAYYHFVRCLKKIALPKT"
FT   CDS_pept        59286..60734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0041"
FT                   /product="lysine decarboxylase"
FT                   /note="BH0041"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03760"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03760"
FT                   /db_xref="GOA:Q9KGM0"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGM0"
FT                   /protein_id="BAB03760.1"
FT                   /translation="MKKASTLPLFERLVQHDRGGPISCHVPGHKQGALFHKDACSYFQS
FT                   ILSLDVTELTGLDDLHDPRGVIAEAQALTARYVGAEATCFLVNGSTVGNLAMILGTLEP
FT                   GDTVFVQRDSHKSVMNGLAMARVHPIFLSPSYDERTQLPTGITEQTLKQALIEHPNGKA
FT                   LILTYPSYYGVARSIRPLVQMAKEAGLYVLVDEAHGAHFPVGDPFPKQALEQGADVVVQ
FT                   SAHKTLPALTMGSYLHFAHGLHSKIKDSIREQLQILQSSSPSYPILASLDAARGFLEDL
FT                   TNVKDTLDSIAEMNRRIEQVERLSVATFSPLPTDPLKTVITVEGATGFALQTELEKEGI
FT                   YSELADDRHVLLMWGLTPLQKVRQEEIIDKMCRATKRLPALEQISKGCPLSLSWQAHTS
FT                   LDLSYDEQKRYSIEEVAVEEAVGKVSGATVIPYPPGVPLLLKGEKITEPLIAQFQQLQE
FT                   AGARFQGRPSEQQGLYVFTLEAMT"
FT   CDS_pept        60731..61363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="BH0042"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03761"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03761"
FT                   /db_xref="GOA:Q9KGL9"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGL9"
FT                   /protein_id="BAB03761.1"
FT                   /translation="MTKGCFITVEGGEGAGKTSALDAIEEMLRENGLSVVRTREPGGIP
FT                   IAEQIRSIILDVDHTRMDPRTEALLYAAARRQHLVEKVLPALEAGHVVLCDRFIDSSLA
FT                   YQGYARGIGFEDILAINEFAIEGRYPDLTLLFRVDPDVGLSRIHRDQSREQNRLDQEAL
FT                   TFHQKVKEGYERIVETYPERVVEIDANQSFDQVVADAVRMIKQRLSL"
FT   CDS_pept        61382..61711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0043"
FT                   /note="BH0043"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03762"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03762"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGL8"
FT                   /protein_id="BAB03762.1"
FT                   /translation="MKLIIAVVQDKDSNRLSEALVKANYRATKLASTGGFLKAGNTTFL
FT                   IGTEDEHVEEVMSIIKDNCKSRDQLVAPISPMGGNADSYVPYPVEVQVGGATVFVLPVE
FT                   QFEQY"
FT   CDS_pept        61728..62714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /product="DNA polymerase III delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="BH0044"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03763"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03763"
FT                   /db_xref="GOA:Q9KGL7"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGL7"
FT                   /protein_id="BAB03763.1"
FT                   /translation="MTWENLAKNQPFVATMLKNSLAKGRLAHAYIFDGNRGTGKKRMAL
FT                   HLAKSFFCAQRAGVEPCQTCKECKRIEHGNHPDVHFIEPDGQSIKKHQVEHLQKEFSYR
FT                   GMESAKKVYIVNHADKMTTSAANSLLKFLEEPLADTVAILLTEQLQNMLPTIKSRSQVL
FT                   SFAPLEVQAFAKLLEEEGISESVSNLLASLTTSFEEAMAFVADEWIAQARSLVLQLMEE
FT                   LQSRPNQVLLTVQDQWLPHFDDRPKQELGLELLLLWFRDLLYTQVGKEEAFTYVGEEEA
FT                   LSRQALALSQHKVRKGMTAIIEAKRHLSANVSPQLVMEKLMLRLQEG"
FT   CDS_pept        62719..63546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0045"
FT                   /product="signal peptidase-like protein"
FT                   /note="BH0045"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03764"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03764"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGL6"
FT                   /protein_id="BAB03764.1"
FT                   /translation="MHHVVGVRFKKAGKIYYFSPGDLDIPRGESVIVETSRGVEYGNVV
FT                   IEKKTVGDNDVVLPLKQVIRVATEKDKLAVQENKEAAKKAYDVCVQKIMEHQLDMKLVD
FT                   VEYTFDRNKVLFYFTADGRIDFRELVKDLASVFRTRIELRQIGVRDEAKMLGGIGPCGR
FT                   ILCCSSFLGDFEPVSIKMAKDQNLSLNPAKISGLCGRLMCCLKYENDMYESAKQELPDL
FT                   GETIDTPHGKGKVVGLNMLERLVQVHLFEGERVLEFSLEELLERGAVSAEATE"
FT   CDS_pept        63562..63912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0046"
FT                   /note="BH0046"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03765"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03765"
FT                   /db_xref="GOA:Q9KGL5"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGL5"
FT                   /protein_id="BAB03765.1"
FT                   /translation="MNKKAIFTQVSQLEERIGELHRELGGLKEQLAYLIEENHFLTIEN
FT                   EHLRERLGEPELEETEEKEQVTKERKPFVGEGYDNLARLYQEGFHICNTHYGSLRKNGE
FT                   DCLFCLSFLNQD"
FT   CDS_pept        63977..64717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0047"
FT                   /note="BH0047"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03766"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03766"
FT                   /db_xref="GOA:Q9KGL4"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGL4"
FT                   /protein_id="BAB03766.1"
FT                   /translation="MIPTYDDERIDYTPGRTRQVIQSPNVFAFSMDAVLLARFVYLPIQ
FT                   KGDILDLCTGNGIVPLLLTERSKARMVGVEIQERLFEMAIRNSQLNDLEQQLTFMNLDL
FT                   KDLPKNMPMHSFDVVTCNPPYFANLNEDLLNDNPYLAIARHEIHCSLDDVLRVSSQMVK
FT                   NRGKVAIVHRPERITELIEGMKRYRIEPKRLQFIHPKAGAEANIVLIEGMLGGNSGVKV
FT                   LPPLTVYDGNGKYTIEFQQVFAGQ"
FT   CDS_pept        64714..64998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0048"
FT                   /note="BH0048"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03767"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03767"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="PDB:1ZG2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGL3"
FT                   /protein_id="BAB03767.1"
FT                   /translation="MNHYVYILECKDGSWYTGYTTDVDRRIKKHASGKGAKYTRGRGPF
FT                   RLVATWAFPSKEEAMRWEYEVKHLSRRKKEQLVSLKGGPYENTTKLSTT"
FT   CDS_pept        64967..65836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0049"
FT                   /note="BH0049"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03768"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03768"
FT                   /db_xref="GOA:Q9KGL2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGL2"
FT                   /protein_id="BAB03768.1"
FT                   /translation="MKTQQSYQQRDDKGTLYLVATPIGNLEDVTFRAIRTLKEADQIAA
FT                   EDTRQTKKLLNHFDIATKLVSYHEHNKETMGKRLIDDLIEGRTIALVSDAGMPAISDPG
FT                   YELVVSAIKEGIAVIPIPGANAAVTALIASGLPTESFQFIGFLPRQKKQRRQALEETKP
FT                   TKATLIFYESPHRLKDTLDDMLLILGNRHVSICRELTKTYEEFLRGTLEEAVHWAREAT
FT                   IKGEFCLIVEGNGEKVEPEEVWWESLSPVQHVEHYIALGFRSKEAIKQVATDRGVPKRD
FT                   IYNIYHQE"
FT   CDS_pept        complement(65879..66169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /product="transcriptional pleiotropic regulator of
FT                   transition state genes"
FT                   /note="BH0050"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03769"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03769"
FT                   /db_xref="GOA:Q9KGL1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGL1"
FT                   /protein_id="BAB03769.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLDIAEKDALEIYVDNDRIIL
FT                   KKYKPNMTCQVTGEVSDDNLSLAEGKIILSPQGAKDILKDLQDYVSRTTQS"
FT   CDS_pept        66365..67318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0051"
FT                   /note="BH0051"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03770"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03770"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGL0"
FT                   /protein_id="BAB03770.1"
FT                   /translation="MIEISSDLIEKLTKINDILKERSTISSLEVDKIRHSLSISGAVFR
FT                   QMEPLGSEMIARWLDNKQIGAVDGSVNQTKGSPPHVLYLFQALAKTLQGVETKKTDVYS
FT                   PLLDSPEDETEPLKWRAHILSKLELKAALDLMDQAELAILMMDGALYHYRIDAPEEWEV
FT                   LRNRALERGTLLVGVSEEITTRNIGSLSPFTTMFKHQTVYDRDLLFGVLHKRESLYIES
FT                   IQQKAGLRSVWMRASSSPAITGFDMLEEQAEEMNDVADFLATMTPEDGRGIPLFLDIVD
FT                   REVRLSDKLVEAMVDQYLETELKERYFSQKREERPY"
FT   CDS_pept        67343..69175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0052"
FT                   /note="BH0052"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03771"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03771"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGK9"
FT                   /protein_id="BAB03771.1"
FT                   /translation="MQVVGITTQHEVYVASKEHKFRMNEMVVLEDEDLFDPKGEVVETF
FT                   SYNRYIPMGFDKGIVDQQVLQTLEQLGYDIGSDDIHLAKVRLFEEAIQPIQTGASVRHP
FT                   SFAEIAPLLVKARPEDGLVLGEVKSTEYVAETLPDELKGLMKIREQEQTRKQEGVPFIF
FT                   DIRAMQQYPHIGVFGGSGSGKSFGLRVMLEELMKLEIPTLVFDPHFEMNFSAKAEGQED
FT                   APSYQSNYTVVQIGRDVGVDFSALSTRDVERLLQAAGSLSESMVNVIQSLHKRKDSYQS
FT                   FSDRVGNLADALEIGRQKVDNLLHDGGMSREEIERYHSYKKLLEQYGSLPLASVKGIQW
FT                   RLYRLNQAGLFQQSIRVIEESLHRGQLVVVQGAVWLLQVFSSYVVGALYGKRRAYKDAK
FT                   LQHEQGDFFPPFVIVTDEAHNFAPKGYEAPAKPVLKEIAQEGRKYGVFLIFATQRPTLL
FT                   DETITAQLNSKFVFRTVRGTDIQTIKEETDLTNEEGKRLPYLRSGDVFVSSAIMGRTMA
FT                   VRIRLAHSTSPHTVNPFDELQERKTQGDDELISALEPFLPLAETSVMNHMDALHKQTGK
FT                   RWDVSELKKELERLCDAGKLKKQKTPFATVYDRP"
FT   CDS_pept        69594..71576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="BH0053"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03772"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03772"
FT                   /db_xref="GOA:Q9KGK8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGK8"
FT                   /protein_id="BAB03772.1"
FT                   /translation="MSKEQKTFYLTTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYN
FT                   VMYLTGTDEHGQKIEQKAEAKGLTPKQFVDEIVSGIQDLWKKLDISYDDFIRTTEERHI
FT                   KVVQQIFEQLLDQGDIYLGDYEGWYSIPDETFYTETQLVDKEYDADGNLIGGKSPDSGH
FT                   PVEKVREQSYFFRMSKYADRLLQFYEENPQFIQPESRKNEMINNFIKPGLEDLAVSRTS
FT                   FTWGVPVPRDPKHVVYVWIDALSNYITALGYGSDQQEKYENYWPADVHLVGKEIVRFHT
FT                   IYWPIMLMALDLPLPKKVFGHGWLLMKDGKMSKSKGNVVDPVPLIDRYGLDALRYYLLR
FT                   EVPFGSDGVFTPEAFVERVNYDLANDLGNLLNRTVAMIEKYFDGKIPSYVKDGTPFDAD
FT                   LVELVYSTVKKVEDAMEEMEFSIALTAIGQLISRTNKYIDETQPWVLAKDESKREQLGA
FT                   AMYHLAESIRYVSVLLQPFMTKAPQKIWEQLGIDSSLTTWESLETFGQIPGNTNVQKGQ
FT                   PLFPRLDVEEEVAHIKSLMGGSKKPEEAPKDEKEESDEITIDDFSKVELRIAEVIDAEP
FT                   VKKADRLLKIQLDLGYEKRQVVSGIAKYYSPSDLIGKKVICVTNLKPVKLRGELSQGMI
FT                   LAGSEGDQLRLATVDGALPNGSLVK"
FT   CDS_pept        71741..72451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0054"
FT                   /note="BH0054"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03773"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03773"
FT                   /db_xref="GOA:Q9KGK7"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGK7"
FT                   /protein_id="BAB03773.1"
FT                   /translation="MIKRAQEAGVKEMVVVGFDEKTIHRALALVERYDFIYAAVGWHPV
FT                   DAIDMKDEHLVWLEELAGHPKVVALGEMGLDYHWDKSPKDVQKEVFRKQIALAKKVKLP
FT                   IVIHNRDADRDIVDVLREEDAGQVGGIMHCFGGSVEIARECMEMNFYISLGGPVTFKNA
FT                   KRPKLVAKEVPLDRLLIETDCPYLAPHPYRGKRNEPAYVKLVAEQIAELKEIPYEEVAK
FT                   VTTANARKLFDIVR"
FT   CDS_pept        72723..73973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0055"
FT                   /note="BH0055"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03774"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03774"
FT                   /db_xref="GOA:Q9KGK6"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGK6"
FT                   /protein_id="BAB03774.1"
FT                   /translation="MKGLVISIISLILFVAIIAFAVHESSKATVTVQVDGEEYVVKTHA
FT                   STVADLMAEQGWDYQEHDLIEPALDAEISGNMTVSWKKAVQVFATLDGEEKTIWTTADT
FT                   VEQLIDEIDLQVKKHDKLKPSLETAITEGLELNYESAFQVELISDGEERKVWTTSTTVA
FT                   DFLEREEIELGELDRVEPELSDEIDQETDIRVIRVEKVTDVVEESVAFATVTRKDEKLD
FT                   SGKEKVVEEGQEGKVAHHYEVILEDGEEISRELVKTETVEESKDRVVAVGTRKVQENVS
FT                   RSSGSSSSSSSSSSSSSSSKSDQSSKSESSSSSSSSSGGGKTFTVTATAYTANCSGCSG
FT                   VTATGINLNNNRNMKVIAVDPNVIPLGSRVHVEGYGTAIAGDTGGAIVGNKIDVHMPST
FT                   AEAQRWGRKTVKVTILD"
FT   CDS_pept        74135..74692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0056"
FT                   /note="BH0056"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03775"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03775"
FT                   /db_xref="GOA:Q9KGK5"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGK5"
FT                   /protein_id="BAB03775.1"
FT                   /translation="MKIKEMIVVEGRDDTIAIQRAVNADTIETNGSAVNEETLKRIALA
FT                   QQRRGVIILTDPDYPGERIRRIVSERVPGCKHAFLPKKAALSKNGDDLGVENAAPEAIR
FT                   HALEKVHEAMEDPLEVISRQDLFDAGLMAGADAKKRREQLGILLGIGYANGKTLYKRLK
FT                   AFQITKREFAEAIAQIVEEGRD"
FT   CDS_pept        74689..75558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="BH0057"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03776"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03776"
FT                   /db_xref="GOA:Q9KGK4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGK4"
FT                   /protein_id="BAB03776.1"
FT                   /translation="MTKDIATPIRTKEILAKHGFTFKKSLGQNFLIDPNVLRNIVDVAS
FT                   LTPQSGAIEIGPGIGALTEQLARQAKRVVAFEIDQRLIPVLRETLAPYENVTVINEDVL
FT                   KADVKQVIATTFEEGQDLMVVANLPYYVTTPILMKLLEAKLPVRGIVVMIQAEVADRIA
FT                   AKPGTKEYGSLSIAAQYYATAELAVKVPKTVFVPQPNVDSAVLRLTIREKPPVTVADEE
FT                   WLFAIVRASFANRRKTILNNLIHNLVGKERKDKAVQALAEAGIDPSRRGETLTIEEFAN
FT                   LSEQLQKR"
FT   CDS_pept        75613..76488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0058"
FT                   /note="BH0058"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03777"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03777"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGK3"
FT                   /protein_id="BAB03777.1"
FT                   /translation="MKPKVGDIVARKSYQCDLLFRIVALHNDFVELIGEDMRLAADAPY
FT                   HDLVLIQESERKRRKKEFLQAEEQCYKLFRQDYNLMKQRDEYEASSGYTNDAAFFEMRG
FT                   RVLHMDGDPLYLRKCTEVYDRLGVPVYGVHVSEKEMPEQIASLIEMVQPDIIVVTGHDA
FT                   YLKNRGTEKDLKAYRHTKFFAECVRIARRYVPQRDELVIFAGACQSHFETLIKAGANFA
FT                   SSPNRVNIHALDPVYIASRVSITSFMERVSLSEVLRNTITGEKGLGGIETKGVMRKGMP
FT                   LKAMEEQEDS"
FT   CDS_pept        76895..77161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0059"
FT                   /note="BH0059"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03778"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03778"
FT                   /db_xref="GOA:Q9KGK2"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGK2"
FT                   /protein_id="BAB03778.1"
FT                   /translation="MGKTLVEIKRALDANVGKRITIKANGGRRKTTERSGLLEETYPSV
FT                   FIIKLDEDQHAFERVSYSYADILTETVELTVCEDDGATTTLKL"
FT   CDS_pept        77286..77471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspF"
FT                   /product="small acid-soluble spore protein (minor
FT                   alpha/beta-type SASP)"
FT                   /note="BH0060"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03779"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03779"
FT                   /db_xref="GOA:Q9KGK1"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGK1"
FT                   /protein_id="BAB03779.1"
FT                   /translation="MSRRRGIMSDRLKEEIAKELGFYDTVQQEGWGGIRARDAGNMVKR
FT                   AIELAEQQLAERESSR"
FT   CDS_pept        77678..78541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0061"
FT                   /product="isopentenyl monophosphate kinase"
FT                   /note="BH0061"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03780"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03780"
FT                   /db_xref="GOA:Q9KGK0"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGK0"
FT                   /protein_id="BAB03780.1"
FT                   /translation="MKQSVKAPAKINLSLDVLHKRPDGYHEVDMIMTTVDLADRIDLTL
FT                   REDGLISVDVSEGFVPNDEKNLAYQAAALLKARYHVNEGVSIYITKRIPVAAGLAGGSS
FT                   DAAATLRGLNDLWQLGLSLDELAVLGAEIGSDVSFCVYGGTARATGRGEIIERIASPPP
FT                   CWVILAKPPIGVSTADVYKRLNVSAIDHPTTEHMIAAIEGKDFDGICHHLHNVLESVTL
FT                   DLYPEVRNIKEQMKRFGADGVLMSGSGPTVFGLVSKESRVQRIYNGLRGFCHQVYAVRI
FT                   IGSAGS"
FT   CDS_pept        78601..79449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /product="transcriptional repressor of the purine operon"
FT                   /note="BH0062"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03781"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03781"
FT                   /db_xref="GOA:Q9KGJ9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGJ9"
FT                   /protein_id="BAB03781.1"
FT                   /translation="MKKLKRSGRLVDMTYFLLQHPHELIPLTHFSERYQSAKSSISEDL
FT                   VIIKEIFESEGIGMLLTVPGASGGVKFIPSMGEDEARQLVGAVCEKLSISDRILPGGYL
FT                   YMMDMLGDARFMQEVGRLFSAILSHKKIDAVITVATKGIPLAYAVGQHLDVPVSIVRRD
FT                   HRVTEGSMVSINYVSGSSKRIQTMTLARRSLSPGSNVFIVDDFMKAGGTVRGMMDLLHE
FT                   FQAEVAGIGVLVESGEAEERLVDDYLSVARICQLNEREKTILVEPGNVLEYMMTLKEDQ
FT                   S"
FT   CDS_pept        79446..79820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0063"
FT                   /product="translation initiation inhibitor"
FT                   /note="BH0063"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03782"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03782"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGJ8"
FT                   /protein_id="BAB03782.1"
FT                   /translation="MKVVHTNQAPDAIGPYSQGIVVNNMFYSSGQIPLTAEGELVQGTV
FT                   EEQTHQVFKNLQAVLKEAGASLDTVVKATVFIKDMNDFPRINEVYGEYFQTHKPARSCV
FT                   EVARLPKDVLVEIEVIALVK"
FT   CDS_pept        80114..80407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /product="stage V sporulation protein G"
FT                   /note="BH0064"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03783"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03783"
FT                   /db_xref="GOA:Q9KGJ7"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGJ7"
FT                   /protein_id="BAB03783.1"
FT                   /translation="MQVTDVRLRRVNTEGRMKAIASITIDHEFVVHDIRVIDGNNGLFV
FT                   AMPSKRTPDGEFRDIAHPISSQTREKIQTAVLAEYERAGELDQVTYEEAGAS"
FT   CDS_pept        80675..82042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /note="BH0065"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03784"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03784"
FT                   /db_xref="GOA:Q9KGJ6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGJ6"
FT                   /protein_id="BAB03784.1"
FT                   /translation="MSNRFAVILAAGQGTRMKSKLYKVLHSVCGKPMVQHVVDQVSALG
FT                   FDEIVTIIGHGADAVKSQLGERVSYALQEEQLGTGHAVLQAESALGGRRGVTIVLCGDT
FT                   PLLTAETIDHVMSYHEEEQAKATVLTAELADPTGYGRIVRNDKGLVERIVEHKDATSEE
FT                   KQITEVNTGTYCFDNEALFQALKEVGNNNAQGEYYLPDVIQILQTKGEKVAAYKTAHVE
FT                   ETLGVNDRVALAQAEQVMKRRINEAWMRKGVTFIDPEQTYVSPDATIGQDTVIYPGTMV
FT                   LGQTTIGEGCVLGPHTELKDSKIGNKTAVKQSVVHNSEVGERVSIGPFSHIRPASMIHD
FT                   DVRIGNFVEVKKSTIGKESKASHLSYIGDAEVGERVNFSCGSITVNYDGKNKFLTKIED
FT                   DAFIGCNSNLIAPVTIGKGALIAAGSTITEDVPSDALSIARARQTNKEHYVTKKNN"
FT   CDS_pept        82067..83017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /product="phosphoribosyl pyrophosphate synthetase"
FT                   /EC_number="2.7.6.1"
FT                   /note="BH0066"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03785"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03785"
FT                   /db_xref="GOA:Q9KGJ5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGJ5"
FT                   /protein_id="BAB03785.1"
FT                   /translation="MANYGDPNLKVFTLNSNKGLAYEITERIGVPMGKSSVTRFSDGEV
FT                   QINIEESIRGCDVFLIQSTAAPANEHIMELLIMIDAVKRASAKTINVVIPYYGYARQDR
FT                   KARAREPITAKLVANLLETAGATRVLTLDLHATQIQGFFDIPVDQLMGVPILAEFFEKK
FT                   GLDDVVVVSPDHGGVVRARKLADRLKAPIAIIDKRRPKPNVAEVMNIVGHIEGKTAIII
FT                   DDIIDTAGTITLAANALVEHGAKEVYACCTHPVLSGPAIERIKNSKIKELVVMNTIELE
FT                   EEKLIDKITTLSVAPLMAEAIVRVHEHSSVSLLFD"
FT   CDS_pept        83118..83765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /product="50S ribosomal protein L25"
FT                   /note="BH0067"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03786"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03786"
FT                   /db_xref="GOA:Q9KGJ4"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGJ4"
FT                   /protein_id="BAB03786.1"
FT                   /translation="MAMSLKAEKRPDLRGSVTRKIRKQGYVPAVVYGNKTKSQPISVEA
FT                   VDFLKTVREVGRNGLISLEVEKGTKHQVMVHDLQMDPLKGDYLHIDFFEVDMSSEIEAN
FT                   VPVRLTGEARGVSEGGVLSQLMYEITVRSLPADIPEEITLDVSSLAIGDSIQIRDVRGN
FT                   VPVQVVNEDEETVVTVQPPATEKEEETEAAVTDSEPEVINEKEEPAEEAKEE"
FT   CDS_pept        83931..84488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVC"
FT                   /product="stage V sporulation protein C (peptidyl-tRNA
FT                   hydrolase)"
FT                   /note="BH0068"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03787"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03787"
FT                   /db_xref="GOA:Q9KGJ3"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGJ3"
FT                   /protein_id="BAB03787.1"
FT                   /translation="MKLIVGLGNPGAKYDGTRHNVGFDVVDAVARRLNIEIKQSKANGL
FT                   YGEGRIDGEKIFLLKPQTFMNRSGESVRPFLEYYNMEVEDLLVIYDDLDLPVGKIRLRQ
FT                   KGSAGGHNGMKSLIAHLGTSDFKRIRVGVDRPAPGETVVQHVLGRYRPEEKDAISEAID
FT                   LSAEAAEAFTKKPFLEVMNTFN"
FT   CDS_pept        85041..88586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /product="transcription-repair coupling factor (TRCF)"
FT                   /note="BH0069"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03788"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03788"
FT                   /db_xref="GOA:Q9KGJ2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGJ2"
FT                   /protein_id="BAB03788.1"
FT                   /translation="MLGLQRFIQEQEDTQAIVQGLEVNMKEQLVSGLSGSARPAVMAAL
FT                   YKETRRPQLVITYNLYQAQKIFEDLVELVGADHVLLYPVNDLISSEIAIASPEMKAQRI
FT                   DVLNQLVAGFSGIVVVPLAGMRRLLPPSSLWKESQIRLSVGDDIGDLESLIRRLVRNGF
FT                   TRVDMVTTPGECSVRGGIIDLYPLTEEDPIRIELFDTEIDSIRTFTIEDQRSKDSLSEV
FT                   VIGPAAEIIMDEEHFIQGASRLEDRLSQTLKKVKKKEVKEKLTEQISFDISELKQKHPF
FT                   PSMYKYISLFYDDTYSLFSYVPSNGVIFVDEMSRVKEMSESLEKEEAEWHTTLIEQGEI
FT                   VHDVTLAHSVLEQMKQGVLPIVYLSLFVRHVPSTNPQNIISFQCKSMQNFHGQMPLLQS
FT                   EVKRWISSQFATVFIAATRERAKRLNHVLAEEGIEALVVDGEAPLTPGQAQIMVGALTS
FT                   GFELTLHKLVVITEEEIFAKKVKRPQRKQKLSNAERIKNYSELKVGDLVVHTNHGIGKY
FT                   LGIETLEINGVHKDYLHIRYAGNDKLYVPVEQIDQVQKYVGAEDKDPKLYSLGKSDWKK
FT                   VKRRVQSSVEDIADDLIKLYAEREASKGFAFAPDGPEQAEFEASFPYQETEDQLRAIQE
FT                   IKEDMEKERPMDRLLCGDVGYGKTEVAIRAAFKAIMNGKQVAILVPTTILAQQHFETIQ
FT                   ERFADYPINIGVLSRFRSRKEQSQTLKGLKAGSVDLVVGTHRLLSKDVQFKDLGLLIVD
FT                   EEQRFGVTHKEKIKQLKANIDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQT
FT                   YVVEYNSPLVREAIERELSRGGQVYFLYNRVENIERMANEISMLVPDARVSFAHGQMKE
FT                   SELESIMLAFLEGESDVLVTTTIIETGVDIPNVNTLIIHGADKMGLSQLYQIRGRVGRS
FT                   NRVAYAYFTYQRDKVLSEVAEKRLQAIKEFTELGSGFKIAMRDLAIRGAGNLLGAQQHG
FT                   FIESVGFDLYSQMLKEAIEKRKGEQPKEEPRNVEIDVQVDAYIPDSYIQDAKQKIEMYK
FT                   RFRGVETIEEINDLKDEMFDRFGEYPQEVSDLLQLTTIKIIAYQEGVESIVESKGQWII
FT                   LLSPETTEGIDGAKLFEVIHKLDQQVGLGTEGERIKLTLKTKQLGTNQLLEVTETLLAS
FT                   LADVKKQPSPVNSVS"
FT   CDS_pept        88747..89286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /product="stage V sporulation protein T"
FT                   /note="BH0070"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03789"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03789"
FT                   /db_xref="GOA:Q9KGJ1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGJ1"
FT                   /protein_id="BAB03789.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYAEALYDSLNHSVLIADRDTYIAVAGSSKKDYTNKSIGDMIES
FT                   AMNDRKSIVHTDAGEYNLVGEQQEELKGCVIAPIIANGDPIGAVVIFNKDETLQGQVEQ
FT                   KLAETAASFLARQMEQ"
FT   CDS_pept        89424..91025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0071"
FT                   /note="BH0071"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03790"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03790"
FT                   /db_xref="GOA:Q9KGJ0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGJ0"
FT                   /protein_id="BAB03790.1"
FT                   /translation="MQNNETIRPFLRGALSVSVAALFAKVLSAAYRVPYQNMAGDLGFY
FT                   AYQQIYPFHGIAMILAMYGFPVYLSKVVTGYLERGEVEQAKAWVSFFFYRLILLSVVMF
FT                   STLYVFAERIALVMGDINLTAPLQTVAFSILLIPLLSVVRGVYQAHHQLEPTALSHVTE
FT                   QIIRVIGILCLVGLFMSQGGDGYDAAVGAALGSIAGSVGAIIVLLIGYRSIAWREWLSR
FT                   KNLRMLKGNRNTPWFRQSVYICLSSLVFVLVPLVDAFTMIRLLGVAGIEGTWAFIEKGI
FT                   YDRGQPLVQVGIVVATSFSLAIVPFMTKAVQGRRLREARTFTELACRFTILISGAAALG
FT                   LFIVMEPTNIMLFGNSEGTHVLQVYGFSIFFASLFVVTAALLQGSGYVHIPMIALAVSL
FT                   LVKMVANVVLIPAFTTVGAAIGTIAAYATMATINVVALSKLYGGLAHLVANAQAMLVCF
FT                   IAMAIPASVCRYLLSLVVGEGRMEALLMVLLTVAAGILGFLFAVLRSKVISEKEWDMVP
FT                   TLQKWAKRMNHLFGNT"
FT   CDS_pept        91046..92521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0072"
FT                   /note="BH0072"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03791"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03791"
FT                   /db_xref="GOA:Q9KGI9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGI9"
FT                   /protein_id="BAB03791.1"
FT                   /translation="MSHTITVIGLGAGDLEQLPLGVYRLILNQDHLYVRTKDHPVIEEL
FT                   IGEGHSFTFFDSIYEQHETFEAVYDAIVAELLEAAKSKEILYAVPGHPLVAERTVQLLL
FT                   EAEREGRVTVKILGGQSFLDPMFSALKIDPVEGCQVLDGTMLSRDEVHVTQHIVICQVY
FT                   DQMIASHVKLTLMELLPDDYEVTVATAVGTKNEKLETVPLYELDRVTTISNLTAVYVPP
FT                   VEDEVILYQDFRTLRQIIATLRGPDGCPWDKKQTHQSLKKYLLEEAYEVLEAIDEENED
FT                   HLVEELGDLLLQVLLHAQIGEDDGWFQIEDVIRSISEKMIRRHPHVFGERQVEDAEDVV
FT                   ETWDEIKKAEKGEDQASTSILGKIPKGLPSLMLAFELQKKAAKVGFDWAEVEPMWAKLD
FT                   EEMHEFKEEIQAGHSQEMAKEFGDVLFVLVNIGRFYNIYAEEALHRTNEKFKRRFQSIE
FT                   QAITAKGDTLEESSLEEMDVLWNQAKESESQGE"
FT   CDS_pept        92524..92790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0073"
FT                   /note="BH0073"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03792"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03792"
FT                   /db_xref="GOA:Q9KGI8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGI8"
FT                   /protein_id="BAB03792.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVCEQGRITVNGNVAKAGTVVKEGD
FT                   ELVIRFGQKLVTVEITNVKETVRKEEASTLYEVKKEEPISKSE"
FT   CDS_pept        92968..93279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0074"
FT                   /note="BH0074"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03793"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03793"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGI7"
FT                   /protein_id="BAB03793.1"
FT                   /translation="MDQQYDFGRPMGHERRSKEHDVTMRNRKTLDITGVKQVESFDNEE
FT                   FLLETEMGFLSIRGRNLHMKNLNVEEGLVSIEGKIFDMVYLEQGQGEKSKGFFGKLFK"
FT   CDS_pept        93276..93872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0075"
FT                   /note="BH0075"
FT                   /note="unknown conserved protein in bacilli"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03794"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03794"
FT                   /db_xref="GOA:Q9KGI6"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGI6"
FT                   /protein_id="BAB03794.1"
FT                   /translation="MSLTIQFYTMLSMAAMGVWLGAAIDTYHRFSKRRRMLFHWLEFIN
FT                   DVLFWLIQGLILFYVLLQVNQGEIRFYIFLAILCGYAAYQALFRQVYQKLLERGIQFVL
FT                   ALYRFGRKMIHIFFVSPIKWLLNLLYRLCMMIISAVLSIFYFLLNLIWKPIFWGLKVVY
FT                   RLLGIQKLINKIQSTTFFQKGKGFWKKLWKWIQKE"
FT   CDS_pept        93878..94258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /product="cell-division initiation protein (septum
FT                   formation)"
FT                   /note="BH0076"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03795"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03795"
FT                   /db_xref="GOA:Q9KGI5"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGI5"
FT                   /protein_id="BAB03795.1"
FT                   /translation="MVKKQPSRIREIDSQYIQQHEQNLEMQKRKRRGLVRRLVAIGIVS
FT                   VLLCVFAFMTLQTQAKMLEDIQQEKIALEQKLDELHAEQEFLEQEIKNYNDEEFIAEIA
FT                   RRDYYMTKPGETLFKLPKSSSD"
FT   CDS_pept        94333..94746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0077"
FT                   /note="BH0077"
FT                   /note="unknown conserved protein in bacilli"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03796"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03796"
FT                   /db_xref="GOA:Q9KGI4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGI4"
FT                   /protein_id="BAB03796.1"
FT                   /translation="MAIEVGSKLQGKVTGITKFGAFVELPGGSTGLVHISEVADHYVKD
FT                   INELLTVGQEVQVKVLNVESDGKIGLSIRKALDQPERPKRPHGGGNRGPRTNRPGPSFE
FT                   DKMARFLKDSEERLATIKRQTESKRGGRGARRG"
FT   tRNA            94883..94956
FT                   /gene="trnB-Met"
FT                   /product="transfer RNA-Met"
FT   CDS_pept        95376..97868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /product="stage II sporulation protein E"
FT                   /note="BH0078"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03797"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03797"
FT                   /db_xref="GOA:Q9KGI3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGI3"
FT                   /protein_id="BAB03797.1"
FT                   /translation="MIRKLTKEMVGFRLEWKGVERVNRFIRSVSQSLTKGGAIVFYQWG
FT                   LLLAIVGFLLGRAVILEELTPFVVPFLAAVYLLKKDKLMLAAIAMFAGAVTSFHQEVGF
FT                   VIVAMVAFLLFQKVTERFTDQRKKIVPYSVLIASVVSRLGLVYLIEGAISNYAVMMAIV
FT                   EGGLSFILTLIFLQSVPLLTAKRIQQPLRNEEIVCLVILLASVMTGTVGWFFYGLTVEH
FT                   MFARYLVLIFAFVGGAAIGSTVGVVTGLILSLASVASLYQMSLLAFSGLLGGLLKEGKK
FT                   VGVSLGLLVGTMLIGLYGEGGTNIQLTMMETAVAIAIFLITPKGWIHAIARYIPGTTEY
FT                   SKEQQQYLRKIRDITAGRVEQFSNLFQTLSTSFSTPTSAATEDAEKEWDYVLSNVTEKT
FT                   CQACFKKEKCWVRNFNTTYDAMQRLMIETEKNGEVIDKRLLVEWKQHCIKPDKVMQAIQ
FT                   QEHTQHLAHQKLRHQVMESRKLVADQLLGVSRVMGDFAKEIQKERQEHHLEEEQILEAL
FT                   RSVGLEIGHVDIFQLEKGNMEIDMSIADDSGHGQAEKIIAPMLSDMLGETIIVKHEERH
FT                   YYPNGYQHVSFGSAKQFVVETGVAHVAKGGGWISGDSYSTIELGSGKYAIAISDGMGNG
FT                   ERAHLESNDTLQLLQKILQSGIEETVAIKSINSVLSLRTTDEVFSTLDLAMIDLHDATA
FT                   KFLKIGSIPSFIKRGNKVIKMEAGNLPMGIIQEFDVDVVSEQLKAGDLLIMMSDGILEA
FT                   PRHVENREMWIKRLVSEMETDDPQELADLLLERVLRTEKGQIDDDMTIIVAKVKRNMPK
FT                   WAAIPMHKPKRILRKKAQ"
FT   CDS_pept        98027..98767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0079"
FT                   /note="BH0079"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03798"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03798"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGI2"
FT                   /protein_id="BAB03798.1"
FT                   /translation="MEKGTLKQILLLTDGCSNHGEDPVAIAALAKEQGIVVNVIGVVDD
FT                   NHLGEQGTKEVDAIAMAGGGVSQIVYAKQLSQTVQMVTRQAMTQTLHGVVNKELQQIFG
FT                   KESEMESLSPEKRGQVMEVVDELGETVSLQVLILVDTSASMKNKLPMVQDALTDLSISL
FT                   TSRMGDNQFSVYSFPGKRKDVDKQLEWTPHIHSLTNIFNKLSLGGITPTGPALRFAIEQ
FT                   FGRRGSRRRLLSNDEEQRAEESGL"
FT   CDS_pept        98730..99713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0080"
FT                   /product="serine/threonine-protein kinase"
FT                   /note="BH0080"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03799"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03799"
FT                   /db_xref="GOA:Q9KGI1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGI1"
FT                   /protein_id="BAB03799.1"
FT                   /translation="MMKNNELKSLASNLPSGTRIVGKWHKQRYRIIRKIGSGATGTVYL
FT                   AESIHGNVAVKVADSHYAITSEVNVLRHFQKVQGERLGPSLLDVDDFVTPRGTIPFYAM
FT                   EYVRGTNIVQFMAAKGEEWLGLLIVQLLGDLDRLHQAGWAFGDLKPDNLLVTGPPVRIR
FT                   WLDVGGTTLLGRSIKEFTEFYDRGYWGLGTRVAEPSYDLFAVAMIMLHCYDRKHFGKKE
FT                   DKPLQQMKRKMDSIPQLKPFRPIMLRALQSKYETAHQMREDMIQTLNHAGKETTSSVKT
FT                   RPSRAAKRASQNDRRNEKKSSYFVEIFLIASFLLFLSILYLFGQIM"
FT   CDS_pept        99747..100502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0081"
FT                   /note="BH0081"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03800"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03800"
FT                   /db_xref="GOA:Q9KGI0"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGI0"
FT                   /protein_id="BAB03800.1"
FT                   /translation="MVRADEMMDICMLAGEIMLINGAETYRVEETLERMAKAGQFRNVH
FT                   SFVTTTGIFLSFEEEGAGDVMQMIRVDDRMQDLNKVTLVNQVSREFVNGEIDAAEALTK
FT                   LQNIAKQPMNYSPLLLHTASGVAGGAFSYLFGGNLFDTLPAFIAGFVASMAVVHLQSYL
FT                   KVRFFAEFMAAFTGGAVAILLVLIGLGENVDQVIIGTLMPLVPGIPLTNAVRDLISGDL
FT                   LAGVTRGAECFVTSLSIATGIALAIALLS"
FT   CDS_pept        100518..100970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0082"
FT                   /note="BH0082"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03801"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03801"
FT                   /db_xref="GOA:Q9KGH9"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGH9"
FT                   /protein_id="BAB03801.1"
FT                   /translation="MLVIELFFVFIATVAFGILFNVPKQVLWIGGFIGANSWLVFSLLP
FT                   IYGASPIVATAAASLASAAISHLLAKYYKVPVTTFSIPGIIPLVPGSRAYFTMLAFVEG
FT                   DYLLGLELGIETMLQAGAIAAGLVFALAVFSFRKGGIGQRYETGRS"
FT   CDS_pept        100951..102339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0083"
FT                   /product="cell-cycle protein"
FT                   /note="BH0083"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03802"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03802"
FT                   /db_xref="GOA:Q9KGH8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGH8"
FT                   /protein_id="BAB03802.1"
FT                   /translation="MKQDVLNFIEEHRLFASGGLVIVAVSGGPDSMALLHFLFSHREQL
FT                   GITVMAAHGNHQLRQEADEEETFVHQFCLSHGILFTSARLPVKERMEMSGEGVQVTARE
FT                   LRYKWLEAEAKKHGAAFIATGHHGDDQIETILMKQVRGTFPLSRGGIPVRREVGDVLIV
FT                   RPFLGITKGQIEHYCKEVNIEPKRDPSNNASSYTRNRFRHTIIPFIRGENPNAHLHFRR
FT                   ISEWKEEDECFLLDLAENALADVLLHKDEHLVTIDRDAFLNVGLPLQRRMIHLILKYLY
FT                   TNDSPANGFIHIERIETLIRNDVTGTKLHLPMGITVERVYGQIRWVRASGEKQPVPVYP
FT                   VVIEGEGQVSTPFGRFCVVQLVSGPRSMSPFTFTCSASDFPLTVRSRRTGDRIVLSVGT
FT                   KKVSRLFIDKKVEREVRDRWPLVFNQSSEIVSVPGLYNHPSQKHKQDFQVTFTPKDVRL
FT                   EDYV"
FT   CDS_pept        102378..102917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprT"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="BH0084"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03803"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03803"
FT                   /db_xref="GOA:Q9KGH7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGH7"
FT                   /protein_id="BAB03803.1"
FT                   /translation="MRDEIQEILITEEEIQAKIVELGKQITEEYEGKFPLVIGVLKGAM
FT                   PFMGDLTKRIDTHLEMDFMDVSSYGKGTVSSGEVKIIKDLDTSVEGRDVLIVEDIIDSG
FT                   LTLSYLIELFHYRKAKSVKVVTLLDKPEGRKVDLVPDMAGFTVPDAFVVGYGLDYAERY
FT                   RNLPFIGILKPEVYES"
FT   CDS_pept        102986..104959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /product="cell-division protein (ATP-dependent Zn
FT                   metallopeptidase)"
FT                   /EC_number="3.4.24.-"
FT                   /note="BH0085"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03804"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03804"
FT                   /db_xref="GOA:Q9KGH6"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGH6"
FT                   /protein_id="BAB03804.1"
FT                   /translation="MNRIFRNTIFYLLIFLVIVGIVSFFTGDQTQTKQITFEEFTQHLE
FT                   AGEITSLSIKPERDVYLVRGQLRGADEDEFFETYVLPTEQMAETISEAAGLQVIPADET
FT                   SGWVTFFTGIIPFIIIFILFFFLLSQAQGGGSRVMNFGKSKAKMVNEDKKKAKFKDVAG
FT                   ADEEKQELVEVVEFLKDPRKFSAIGARIPKGVLLVGPPGTGKTLLARAVAGEAGVPFFS
FT                   ISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDEREQT
FT                   LNQLLVEMDGFSANEGIIIIAATNRADILDPALLRPGRFDRQITVGRPDVKGREEVLKV
FT                   HASNKPLADDVNLKTIATRTPGFSGADLENLLNEAALVAARQDEKKISMVHIEEAIDRV
FT                   IAGPAKKSRVISEKEKNIVAWHEAGHTVVGVKLENADMVHKVTIVPRGVAGGYAVMLPK
FT                   EDRYFMTKPELLDKIVGLLGGRVAEEIQFGEASTGAHNDFQRATSIARKMVTEYGMSEK
FT                   LGPMQFGSGSGGQVFLGRDIQNEQNYSDAIAHEIDLEVQRIIKECYERCKQILLDNKKS
FT                   LDLVAETLLDLETLDAEQIKSLIHDGKLPDNHHLAEKIAETRENGQDSEVKVNIHSKKG
FT                   EEAEGEESAPNTEDVKEDDEKK"
FT   CDS_pept        105179..105943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0086"
FT                   /note="BH0086"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03805"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03805"
FT                   /db_xref="GOA:Q9KGH5"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGH5"
FT                   /protein_id="BAB03805.1"
FT                   /translation="MILVIDVGNTNTVLGVYQDETLVHHWRLATSRQKTEDEYAMTVRS
FT                   LFDHAGLQFQDIDGIVISSVVPPMMFSLEQMCKKYFHVTPMIIGPGIKTGLNIKYDNPK
FT                   EVGADRIVNAVAAIELYGYPAIVVDFGTATTYCLINEKKQYAGGVIAPGIMISTEALYH
FT                   RASKLPRIEIAKPKQVVGTNTIDSMQSGIFYGYVSQVDGVVKRMKAQAESEPKVIATGG
FT                   LAKLIGTESETIDVIDSFLTLKGLQLIYKKNV"
FT   CDS_pept        105959..106834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0087"
FT                   /note="BH0087"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03806"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03806"
FT                   /db_xref="GOA:Q9KGH4"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGH4"
FT                   /protein_id="BAB03806.1"
FT                   /translation="MGDYLVKALGFEGKVRAYALKATEMVNEAVRRQDTWPTASAALGR
FT                   TMMAGTMMAAMLKGDAKLTVKVEGDGPIGAIIVDSQANGQTRGYVKNPHVHFELNEHGK
FT                   LDVARAVGTNGSLSVVKDIGLRDHFTGSVPLVSGELGEDFTYYFVSSEQTPSSVGVGVL
FT                   VNPDNSVLAAGGFVLQLMPGADDAIISEIEKRLQTIPPISKLVEAGMPPEEILAALLGD
FT                   DNVKILEKMPIEFACQCSKERIARAIISLGKDEIRAMIEEDGGAETTCHFCNEVYLFSK
FT                   EELETLYEEA"
FT   CDS_pept        107007..107930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /product="cysteine synthase A"
FT                   /EC_number="2.5.1.47"
FT                   /note="BH0088"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03807"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03807"
FT                   /db_xref="GOA:Q9KGH3"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGH3"
FT                   /protein_id="BAB03807.1"
FT                   /translation="MRVANSITDLIGQTPLVKLNRLVSDKHADVYLKLEFFNPGSSVKD
FT                   RIALAMIEAAEKSGALKPDDTIVEPTSGNTGIGLAMVAAAKGYKTKLVMPETMSLERRN
FT                   LLRAYGAELVLTPGPEGMGGAIRKATELAQENGYFMPQQFENEANPEIHRETTGRELLE
FT                   QVDGQLDGFVSGIGTGGTITGAGGLLKENFPNLHIAAVEPADSPVLSGGNPGPHKIQGI
FT                   GAGFVPKILDTDIYDEVIKVSTEQAFEYARRAAKEEGILGGISSGAAIYAALQVAEKLG
FT                   PGKKVVAVIPSNGERYLSTPLYQFED"
FT   CDS_pept        108136..109353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0089"
FT                   /product="transposase (01)"
FT                   /note="BH0089"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03808"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03808"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWQ0"
FT                   /protein_id="BAB03808.1"
FT                   /translation="MNFTMDLPGLKGVKVTKMEEREGFIALHVEMPRTPHRCPSCGERT
FT                   ERTHDYRIQKVQHLKLFERWVYLFYRKRRYACRCGKRFAEKACFVERYQRQTVEWNQAF
FT                   RLRLIQGKNFTDTANQFQTSVTTAMRRFDQLAAPLVKKVDHLPPRIAIDDYKGDTNAGK
FT                   YQVIIADADTRKPLDILPDRKADTLKRYLQEKGHHVKTVVMDLSYTFKSAVQKALGHPL
FT                   IIGDPFHFCRYIYWALEGVRRRVQKAFHPYHRKRCKRIKHLFQKERERLDDKQKKKVER
FT                   YLELSPDLREAYELKEHFRRWYQEAKMQGREGRMSEVKQGLYAFYRRVEASRLKEFHRA
FT                   IQTLKNWQTEILNSFAFGLNNGFIEGLNNQTKVIKRNAFGFRRYDRLRNRILLHHQFKH
FT                   QTFGVG"
FT   CDS_pept        109552..111012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /product="para-aminobenzoate synthase component I"
FT                   /EC_number="4.1.3.-"
FT                   /note="BH0090"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03809"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03809"
FT                   /db_xref="GOA:Q9KGH2"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGH2"
FT                   /protein_id="BAB03809.1"
FT                   /translation="MAGVRLLQQGKQETKRTVCATSFPMEESQFFRRYKKQSRDRERHV
FT                   LLESGRGGRYSMVGLEPVMVLEGKKDTLIVTTENEVVKRQGALLDLMRDALASYQAETL
FT                   PGAPPFQGGAIGFFSYDLVREIERLPTIAQDDLNLPDLYFLIFDDVFIYDHEKKVAWIF
FT                   VHGDASEQDLSEQKLRHYEATWKQPVSLDEEVATSYLETEGEKVHSFSEETFAKAVERV
FT                   REYIAAGDVFQVNLSVREGRPLRTTPLSIYEALRQINPSPYMSYLHTPDFQLVSGSPEL
FT                   LIKKDSRKLSTRPIAGTRSRGATADEDEALVQTLLSNEKERAEHVMLVDLERNDLGRVS
FT                   EYGSVEVNELMVVEKYSHVMHIVSNVRGVLKEGLDAFDAIRATFPGGTITGAPKVRTME
FT                   IIEELEPVRRGIYTGSIGWIGYNGDMELNIVIRTMLCKDEMAYVQAGAGVVIDSNPRYE
FT                   YKESLKKAKALWRAYDQSIDEQKQRIEK"
FT   CDS_pept        111031..111627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA/trpG"
FT                   /product="para-aminobenzoate synthetase glutamine
FT                   amidotransferase component II/anthranilate synthase
FT                   component II"
FT                   /note="BH0091"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03810"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03810"
FT                   /db_xref="GOA:Q9KGH1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGH1"
FT                   /protein_id="BAB03810.1"
FT                   /translation="MILMIDNYDSFTYNLVQYLGEMGHELVVKRNDEVSVAEIEQMSPD
FT                   FLMISPGPCSPNEAGVSLDAIRAFAGKLPIFGVCLGHQSIAQAFGGDVIRAERLMHGKT
FT                   SEVTHDGKTIFKEVANPFTATRYHSLIVKRQTLPDCFEISAETAEGEIMAIRHKELPIE
FT                   GVQFHPESIMTDAGKRLLRNFIETYGKETNDVHVR"
FT   CDS_pept        111611..112498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /product="4-amino-4-deoxychorismate lyase"
FT                   /EC_number="4.-.-.-"
FT                   /note="BH0092"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03811"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03811"
FT                   /db_xref="GOA:Q9KGH0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGH0"
FT                   /protein_id="BAB03811.1"
FT                   /translation="MYMYVNDKLVKEEEAIISPFDHGYMYGLGLFETFRLYEGHPFLLD
FT                   DHFVRLEEGLRALAIDWTYNRSHVLHQLATLCNKNGVRNAYIRWNVSAGPGPIGLYTDT
FT                   YKEPTVIIYMKSLPQGLSTRKTGTLLELRRNTPEGDRRLKSHHFLNNVLGKREVAKDPQ
FT                   TEGIFLTEDGVLAEGLTSNVFWVKNGVVYTPSVDTGILNGITRQFVLTLCDKEGIPWRE
FT                   GRYPKEALLKADGAFITNSIQEIVTLTSVGQAEFNQDEAVIMSLRKSYQKYCTKLWSKN
FT                   EIKEGKQDVNNTCK"
FT   CDS_pept        112476..113318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sul"
FT                   /product="dihydropteroate synthase (dihydropteroate
FT                   pyrophosphorylase)"
FT                   /EC_number="2.5.1.15"
FT                   /note="BH0093"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03812"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03812"
FT                   /db_xref="GOA:Q9KGG9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGG9"
FT                   /protein_id="BAB03812.1"
FT                   /translation="MSTTLANKTRLKPLQFSDRTYIMGILNVTPDSFSDGGRYVDVEAA
FT                   VRHAKQMITDGADLIDIGGESTRPGHTKVEVGEELNRVIPVIEAVSAQVDVPISIDTYK
FT                   AEVAEKAIKAGASIINDVWGAKADPSMAHVAAKYGVPIILMHNRDNEDYTDLMAEMIAD
FT                   LEESISLCKQAGVKDENIILDPGIGFAKTYEHNLEAMRRLDELTALPYPVLLGTSRKSL
FT                   IAKTLHLPVDDRVEGTGATVCYGIAKGCNIVRVHDVKEMSRMAKMMDAMMGKGRDIGG"
FT   CDS_pept        113326..113670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="BH0094"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03813"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03813"
FT                   /db_xref="GOA:Q9KGG8"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGG8"
FT                   /protein_id="BAB03813.1"
FT                   /translation="MNRMEFYGYHGVYAEENKLGQRFYVDLTLELDLKRAGESDALVHT
FT                   INYADVYKITKEVVEGESYKLVESVAETIAAKLLASFEPLQFVTVTVTKPDPPIPGHYD
FT                   SVAVEITRSK"
FT   CDS_pept        113671..114195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="BH0095"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03814"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03814"
FT                   /db_xref="GOA:Q9KGG7"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGG7"
FT                   /protein_id="BAB03814.1"
FT                   /translation="MEKQCYIALGSNIGDRSRFLEEAIQQLAEHDKVTVTCCSSIYETD
FT                   PVGYTDQSPFLNMVVEVSTSLPVEQLLEVTQKIERYCGRERHIRWGPRTLDLDILLYDQ
FT                   ENREMENLIIPHPRMWERAFVLIPLMELNPSIVAPSGKTIEQVVRELKDKEGVTLWKQE
FT                   TGASVYGRFES"
FT   CDS_pept        114147..114368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0096"
FT                   /note="BH0096"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03815"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03815"
FT                   /db_xref="GOA:Q9KGG6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGG6"
FT                   /protein_id="BAB03815.1"
FT                   /translation="METGNWGQRIRAFRKLKGYTQERFAQAIGVSVSVLGEVERGTRTP
FT                   NRQLIERVVSVLNISEDELLPQTEKEKN"
FT   CDS_pept        114382..115386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0097"
FT                   /product="transcriptional regulator involved in nitrogen
FT                   regulation (NifR3/Smm1 family)"
FT                   /note="BH0097"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03816"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03816"
FT                   /db_xref="GOA:Q9KGG5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGG5"
FT                   /protein_id="BAB03816.1"
FT                   /translation="MLKIGPIEMKNQVVLAPMAGVCNPAFRLIAKEFGAGLVCAEMVSD
FT                   KAILHKNEKSLSMLYVDEREKPLSLQIFGGEKETLVEAAKFVDKNTNADIIDINMGCPV
FT                   PKITKCDAGARWLLDPNKIYDMVSAVVDEVDKPVTVKMRIGWDEEHIYAVENAQAVERA
FT                   GGAAVAVHGRTRVQMYEGTADWNIIREVKQAVGIPVIGNGDVKTPQDAKRMLDEIGVDG
FT                   VMIGRAALGNPWMLYRTIHYLETGELLPDPTPREKMDVCMIHLDRLIKLKGENVAVREM
FT                   RKHAAWYLKGLRGNGKIRDQINQFETREDVSSTLYAYIEELEAKMAEKSASVV"
FT   CDS_pept        115500..117005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="BH0098"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03817"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03817"
FT                   /db_xref="GOA:Q9KGG4"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGG4"
FT                   /protein_id="BAB03817.1"
FT                   /translation="MSEELGLNDLLAVRREKLQNLEAEGANPFGGKFERTDTAQSMKEK
FT                   YDAKSKEELEEETHEVVLAGRVMTKRGKGKAGFAHIQDLTGQIQIYVRKDAVGDKSYDL
FT                   FTSIDIGDIVGVKGVAFKTKVGELSVKVQDFQLLTKSLRPLPDKYHGLKDVEQRYRQRY
FT                   LDLIVNPEVRDTFVLRSKILQSMRRYLDDRGYLEVETPTMHSIPGGASARPFVTHHNAL
FT                   DMTLYMRIAIELHLKRLIVGGMEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYND
FT                   IMELTELLIAHIAKDVLGTTTITYGEHEVNLEPKWRRVHMVEAIKEETGVDFWNEMSDE
FT                   EARALAKEHNVPVKETMTYGHVVNEFFEHFVEEKLIQPTFVYGHPVAISPLAKKNPDDP
FT                   RFTDRFELFIVGREHANAFSELNDPIDQRHRFEQQLVEREQGDDEAHMMDEDFVESLEY
FT                   GMPPTGGLGIGIDRLVMLLTNSPSIRDVLLFPQMRHKDSPATE"
FT   rRNA            117374..118925
FT                   /gene="rrnC-16S"
FT                   /product="16S ribosomal RNA"
FT   tRNA            119378..119454
FT                   /gene="trnC-Ile"
FT                   /product="transfer RNA-Ile"
FT   tRNA            119466..119541
FT                   /gene="trnC-Ala"
FT                   /product="transfer RNA-Ala"
FT   rRNA            119924..122862
FT                   /gene="rrnC-23S"
FT                   /product="23S ribosomal RNA"
FT   rRNA            123273..123388
FT                   /gene="rrnC-5S"
FT                   /product="5S ribosomal RNA"
FT   tRNA            123398..123473
FT                   /gene="trnD-Val"
FT                   /product="transfer RNA-Val"
FT   tRNA            123515..123587
FT                   /gene="trnD-Thr"
FT                   /product="transfer RNA-Thr"
FT   tRNA            123595..123670
FT                   /gene="trnD-Lys"
FT                   /product="transfer RNA-Lys"
FT   tRNA            123679..123764
FT                   /gene="trnD-Leu1"
FT                   /product="transfer RNA-Leu"
FT   tRNA            123771..123845
FT                   /gene="trnD-Gly"
FT                   /product="transfer RNA-Gly"
FT   tRNA            123869..123957
FT                   /gene="trnD-Leu2"
FT                   /product="transfer RNA-Leu"
FT   tRNA            123973..124049
FT                   /gene="trnD-Arg"
FT                   /product="transfer RNA-Arg"
FT   tRNA            124055..124131
FT                   /gene="trnD-Pro"
FT                   /product="transfer RNA-Pro"
FT   tRNA            124135..124210
FT                   /gene="trnD-Ala"
FT                   /product="transfer RNA-Ala"
FT   rRNA            124393..125945
FT                   /gene="rrnD-16S"
FT                   /product="16S ribosomal RNA"
FT   rRNA            126753..129691
FT                   /gene="rrnD-23S"
FT                   /product="23S ribosomal RNA"
FT   rRNA            129997..130112
FT                   /gene="rrnD-5S"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        130700..131956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0099"
FT                   /product="transposase (11)"
FT                   /note="BH0099"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03818"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03818"
FT                   /db_xref="GOA:Q9JWR9"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWR9"
FT                   /protein_id="BAB03818.1"
FT                   /translation="MLERILSRENLIQALERVEKNKGSYGVDEMDVKSLRLHLHENWTS
FT                   IRNEIIEGSYFPKPVRRVEIPKPNGGVRKLGIPTVMDRFLQQAIAQILTQLYDPTFSER
FT                   SFGFRPHRRGHNAVRQAKQWMKEGYRWVVDIDLEKFFDKVNHDRLMRKLSSRIQDPRVL
FT                   QLIRRYLQTGVMERGLVSPNTEGTPQGGPLSPLLSNIVLDELDNELEKRGLKFVRYADD
FT                   CNIYVRSKRAGLRIMESVTSFIENRLKLKVNREKSAVDRPWNRKFLGFSFTRGKDPKMR
FT                   VSKESVKRLKQRIRELTSRRHSMKMSDRLRRLNRYLTGWLGYYQLVDTPSILAQIDAWI
FT                   RRRLRMIRWKEWKTTSARQKNLVRLGIKKAKAWQWANSRKGYWRVAHSPIMDYALNSEY
FT                   WKGQGLMSLAERYQTRRWT"
FT   CDS_pept        132792..133262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /product="transcriptional repressor of class III stress
FT                   genes"
FT                   /note="BH0100"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03819"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03819"
FT                   /db_xref="GOA:Q9JWR8"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWR8"
FT                   /protein_id="BAB03819.1"
FT                   /translation="MRNISDIIEQYLKNIILQSEKELIEIKRSELAEQFQCVPSQINYV
FT                   ISTRFTIEKGYLVESKRGGGGYIRIMKAKPHENLSLFDQLAQLIGKGISQQGAEGIISR
FT                   LFEEGVISKRETRLMLSVMDRAHYHTTVNHRDEIRANLLKAMIETLKYKDER"
FT   CDS_pept        133288..133821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0101"
FT                   /note="BH0101"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03820"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03820"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWP8"
FT                   /protein_id="BAB03820.1"
FT                   /translation="MKCQECQQRPATLHFTKIINGEKTEFHICEQCAKEKGEHFPGSNS
FT                   FSIHQLLSGLLDFEQPKPQDPQAQQTIKRSLTCEKCGMTYEQFARVGRFGCASCYQTFS
FT                   PKLDPVFKRVHSGSVAHRGKVPKRIGGGIEIRRQIRALKETLKQHIEREEFEEAALVRD
FT                   QIRSLERKVSGGEG"
FT   CDS_pept        133824..134894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0102"
FT                   /product="creatine kinase"
FT                   /note="BH0102"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03821"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03821"
FT                   /db_xref="GOA:Q9KGG3"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGG3"
FT                   /protein_id="BAB03821.1"
FT                   /translation="MSLQRFISEAISPWMKKDGPDSDIVLSSRIRLARNLQSFRFPLLA
FT                   TIEESKQLVEHVKHHLAESSYHTNRFELLCMDDMKPNVKRVLVEKHLISPHLAEESKHG
FT                   AVMLSEDESISIMINEEDHLRIQCLFPGFQLSEALVLASGIDDWIEGKVDYAFDEKRGY
FT                   LTSCPTNVGTGLRASVMMHLPALVMTQQINRILPAINQLGLVVRGIYGEGSEALGNLFQ
FT                   ISNQMTLGKSEEDIVEDLRGVVMQLIQQERAARKRLLESSRLQLEDRVYRSYGILAHSR
FT                   IIESKEATQKLSDVRLGIDLGLLKGVSGNILNELMILTQPGFLQQYAGTVLTADQRDER
FT                   RAALIRARLKLEDESN"
FT   CDS_pept        134913..137354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /product="class III stress response-related ATPase"
FT                   /note="BH0103"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03822"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03822"
FT                   /db_xref="GOA:Q9KGG2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGG2"
FT                   /protein_id="BAB03822.1"
FT                   /translation="MMFGRFTERAQKVLALAQEEAIRLGHNNIGTEHILLGLIREGEGI
FT                   AAKALQALGLGPEKIQKEVETLIGKGQDGAKTIHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNETSSSSQQGGGAANANTP
FT                   TLDSLARDLTAIAREEGLDPVIGRSKEIERVIQVLSRRTKNNPVLIGEPGVGKTAIAEG
FT                   LAQAIIHNEVPETLRNKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNVILFID
FT                   ELHTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIQ
FT                   VNEPSLDESIQILKGLRDRYEAHHRVTITDEAIEEAVKLSDRYIQDRFLPDKAIDLIDE
FT                   AASKVRLRSYTAPPNLKELEQKLEETRKEKDAAVQSQEFEKAASLRDSEQRIREELDQM
FT                   KNDWKQKQGQENTQVVVDDIAQVVASWTGIPVSKLAEEETERLLKMEEILHKRVIGQEE
FT                   AVKAISKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARAVAETLFGDEDAFIRIDM
FT                   SEYMEKHATSRLVGSPPGYVGHDEGGQLTEKVRRKPYSVILLDEIEKAHPEVFNILLQV
FT                   LEDGRLTDSKGRTVDFRNTAVIMTSNVGASTLRKNKFLGFTTDSEGSEYKDMKDKVMTE
FT                   LKNSFRPEFLNRIDEIIVFHSLEKKHVREIITLMADQLKKRLEEQGVSFELTEAAKDKI
FT                   TDLGYDPEYGARPLRRALQREVEDRLSEELLKGTIQKGQRAIIDVENGELVVHSKEGAT
FT                   L"
FT   CDS_pept        137522..138895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0104"
FT                   /product="DNA repair protein"
FT                   /note="BH0104"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03823"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03823"
FT                   /db_xref="GOA:Q9KGG1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGG1"
FT                   /protein_id="BAB03823.1"
FT                   /translation="MAKKKTKFMCQECGYESAKWMGKCPGCQSWNSMVEEFTEVKAKSS
FT                   RSYVTSGAGIAKPQPITKVEREQEPRIDTSMKELNRVLGGGIVPGSLVLVGGDPGIGKS
FT                   TLLLQLSARLADLKQRVLYISGEESVKQTKIRSDRLGVLSDHLYVLAETDMEKIEQAIG
FT                   EVDPTLVIIDSIQTVYQDEITSAPGSVAQVRECTASFMRIAKTTGVAIFIVGHVTKQGA
FT                   IAGPKLLEHMVDSVLYFEGERHHTYRILRAVKNRFGSTNEMGIFEMKESGLEEVANPSE
FT                   IFLEDRSSGVAGSTVVASMEGTRPVLVELQALISPTSFGNPRRMATGVDHNRISLLMAV
FT                   LEKRVGMLLQNQDAYVNVAGGVRLDEPAIDLGIAVSIASSFRNQHTNPHEVVIGEIGLT
FT                   GEVRRVSRIDQRVNEAAKLGFKRVIIPDKNLGGWTIPSTIEVIGVSTVQDALEVTLGR"
FT   CDS_pept        138904..139977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0105"
FT                   /note="BH0105"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03824"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03824"
FT                   /db_xref="GOA:Q9KGG0"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGG0"
FT                   /protein_id="BAB03824.1"
FT                   /translation="MDSEVKERFARNILKMVAPGTALRTGIDNVLRAKTGGLIVLGYNE
FT                   NMKGIVDGGFYLDCPFSPASLYELAKMDGAIILNEDGTKILYANTQLNPDNAISSNETG
FT                   IRHRTAERVAKQTGNLVISISQRRNVITLYHGHLRYALRDIGVILTKANQAIQTLDKYK
FT                   SVLDQDITDLGALEFEELVTFHEVSQVMQRIHMVLNIKGEILNYVNELGSEGRLITMQL
FT                   NELVSNLEKEVLLLIQDYAKEDDVDPEDVLEQMMKCSNEELLDDSNILKLLGYHKAFNV
FT                   QEQQATPRGYRILHKIPRLPATIVRNLVHSFENINDMLRADLKELDEVEGIGEARAKLI
FT                   KDGLSRIQEQLFMDRNI"
FT   CDS_pept        140136..141224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0106"
FT                   /note="BH0106"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03825"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03825"
FT                   /db_xref="GOA:Q9KGF9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGF9"
FT                   /protein_id="BAB03825.1"
FT                   /translation="MLRWIVQLFFILVGGTLGFIFIPDLMAWMSIQDPTWLTNPYVGTV
FT                   MGAIILFLLTFWLCDYIVHLMRVTEEMIVKAPVTDVLFGTMGLIIGLIVAFLVGIPLGN
FT                   FSIPVVSTVLPIFITFFLGYFGFQIGFKKRDELIHLMSITRGFGKKKDEEESEARGSKL
FT                   KILDTSVIIDGRIADICKTGFLEGTLVIPGFVLEELQHIADSSDVLKRNRGRRGLDILN
FT                   KIQKELPINVEIYEGDFEDIQEVDSKLVKLAKVTEGMVVTNDFNLNKVCELQGVQVLNI
FT                   NDLANAVKPVVLPGEELNVQVIKDGKEQNQGVAYLDDGTMIVVEGGRDYIGKHVEVVVT
FT                   SVLQTSAGRMIFAKPKLLEKAL"
FT   CDS_pept        141464..142150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0107"
FT                   /note="BH0107"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03826"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03826"
FT                   /db_xref="GOA:Q9KGF8"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGF8"
FT                   /protein_id="BAB03826.1"
FT                   /translation="MEYSVVIPAAGQGKRMRAGHNKQFIELGGKPILAHTLAVFEQDDW
FT                   CTNVVIVANEQEIEEMGELANRYQISKAKKIVAGGRERQESVFAGLKALSQDGLVLIHD
FT                   GARPFVTEKEIHSLVETAAKTHAAVLAVPVKDTIKRVEGEAVLETMPREELWAVQTPQA
FT                   FDLALIKQAHQKAENEQMLGTDDASLMEWLGYSVAVVQGSYFNFKLTTPEDLLFAEAIL
FT                   AEKERR"
FT   CDS_pept        142151..142624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0108"
FT                   /note="BH0108"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03827"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03827"
FT                   /db_xref="GOA:Q9KGF7"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGF7"
FT                   /protein_id="BAB03827.1"
FT                   /translation="MIRVGQGFDVHQFAEGRLLIIGGVEIPYEKGLLGHSDADVLLHTI
FT                   ADAALGAIGEGDIGKHFPDTDPHFKDADSAKLLSAVWELVKEKGYTLGNVDCTIIAQKP
FT                   KMAPHIPAMRARIAELLEAEEAQVNVKATTTETLGFTGRGEGIASQAVILLVK"
FT   CDS_pept        142707..144164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="BH0109"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03828"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03828"
FT                   /db_xref="GOA:Q9KGF6"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGF6"
FT                   /protein_id="BAB03828.1"
FT                   /translation="MASEVRVRFAPSPTGHLHIGGARSALFNYLFAKNQGGMFVLRIED
FT                   TDQARNVGQAKEKLLDSLKWLGVEWDESIDVGGEYGPYSSMERLDIYKKHIEQLLNEGK
FT                   AYYCYMTEEELEAEREAQIARGEMPKYSGRDRDLTEEQRRAYEAKGIKPVVRFRVPEGQ
FT                   VIKIQDAVRGEVSFESDGIGDFVIARKDGVPMYNFAVVVDDHLMKISHVIRGEEHLSNT
FT                   PRQVMLYEAFGWDVPTFAHASLILNPNRQKMSKRDESIIQFVEQYKELGYMPEAIVNFL
FT                   ALLGWSPVGEEEIFSLEELAAQFSLERVSKAPAVFDTDKLAWMNNQYIKNADLDDVVAL
FT                   ALPHLQKAGKLPESLSEEQAEWAKAVISLYQEQLHYGAEIVELTELFFKTEIQYNDEAQ
FT                   EVLNEEQVPGVLSGFLQELEGLDTWDAVSIKGAIKATQKATGQKGKKLFMPIRVATTGQ
FT                   THGPELPSAIKLIGKEIVTHRLRSLLN"
FT   CDS_pept        144480..145169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="BH0110"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03829"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03829"
FT                   /db_xref="GOA:Q9KGF5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGF5"
FT                   /protein_id="BAB03829.1"
FT                   /translation="MKRIFKTLLNDIDVVFEQDPAARSRLEVIFTYSGVHAIWAHRLAH
FT                   WLWRKKLYFVARFLSQVSRLITGIEIHPGAKIGQRLFIDHGMGVVIGETCEIGDNVTIY
FT                   QGVTLGGTGKEKGKRHPTVEDHVLIASGAKVLGSFTIGKNSRIGAGSVVLNEVPPNSTV
FT                   VGIPGKVVIRDGIKVNRDLDHHLLPDPVSDKFRELEKQLEALQKEIEELRKNNLPKSAS
FT                   NHSVKEG"
FT   CDS_pept        145207..146607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="BH0111"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03830"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03830"
FT                   /db_xref="GOA:Q9KGF4"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGF4"
FT                   /protein_id="BAB03830.1"
FT                   /translation="MAIQVFNSLTRKKEPFVPLEEGKVKMYVCGPTVYNYIHIGNARPP
FT                   IVYDMIRRYLKYRGYEVLFVSNFTDVDDKIIRVANELGEDVFAVANRFIEAYKQDTSAL
FT                   GVLEADHHPRVTETMSEIISFIRVLEEKGYAYEQGGDVYFRTRKFKEYGKLSAQSIDDL
FT                   LSGARIEVDERKEDPLDFVLWKAAKEGEVSWDSPWGKGRPGWHIECSAMVKKYLGDTID
FT                   IHAGGQDLKFPHHENEIAQSECMTGKPMANYWLHNGFINLDNEKMSKSLGNVVLANEMI
FT                   RQHSAEVLRFFMLSAHYRSPINFSDELLEGAKRGLERLQTAVSSLVHRLQESADFGGTE
FT                   PWLERIDEFRGRFIEEMDDDFNSANGIAVLFDLAKEANRYLREEQTSKAVLQSFIDLFN
FT                   ELGGVLGVTLNRQEELLDEEIERLIEERNEARKAKNFQRADDIRDQLKAEGIILEDTPQ
FT                   GVRWKRGS"
FT   CDS_pept        146607..147026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0112"
FT                   /note="BH0112"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03831"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03831"
FT                   /db_xref="GOA:Q9KGF3"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGF3"
FT                   /protein_id="BAB03831.1"
FT                   /translation="MKVTEASIDFRQLNALALAYMGDSVLDMYVRFHLLAKGTVRPHRL
FT                   HGEATRYVSAKAQAAIMHEWLETNKLTEQEESIAKRGRNAKSGTIPKNTDVNTYRYATG
FT                   LEALLGYLYLTNQPDRLDELMSDYLTKIDMRKEGE"
FT   CDS_pept        147029..147778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0113"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /note="BH0113"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03832"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03832"
FT                   /db_xref="GOA:Q9KGF2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGF2"
FT                   /protein_id="BAB03832.1"
FT                   /translation="MDREFITGKNPIIEALRSGRPMNKIWIGEGSQKGQMQKVLELAKE
FT                   QGVLVQHVPKRKLDQLIGHENHQGVVASVAAYEYAEMDDLFQRAAEKGEEPFFIVLDEV
FT                   EDPHNLGSILRTADAAGVHGVIIPKRRAVGLTQTVAKASTGAIEYVPVVRVTNLARTME
FT                   DLKKRGLWFIGTDAKGSEDYRGAAYDMPIALVIGSEGKGLSRLVREKCDFLVRIPMVGQ
FT                   VTSLNASVATSLLMYEAYRKRHPLGRE"
FT   CDS_pept        147780..148292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0114"
FT                   /note="BH0114"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03833"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03833"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGF1"
FT                   /protein_id="BAB03833.1"
FT                   /translation="MREILIVDGYNMIGAWPELKELKDRDLALARDKLIDRLAEYQAYT
FT                   GCKVILVFDAHMVPGVGRTYNNHRIEVIYTRKNETADERIERLVRELKRIDTQIYVATS
FT                   DLAEQSHIFGSGALRKSARELYNEMEVTGKGIEKTVEKSNKEHNSTKIALTEELAEIFE
FT                   KWRRGDR"
FT   CDS_pept        148368..149021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /product="RNA polymerase sigma-H factor (sigma-30)"
FT                   /note="BH0115"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03834"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03834"
FT                   /db_xref="GOA:Q9KGF0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGF0"
FT                   /protein_id="BAB03834.1"
FT                   /translation="MSVDLNATASNLDFNQIEDVGLVNRVRNGDGAALEYLIHKYKNFV
FT                   RAKARSYFLIGADHEDIVQEGMIGLYKAIRDFKGDKLSSFKAFAELCITRQIITAIKTA
FT                   TRQKHIPLNSYVSLDKPLYDEESDRTLLDVVCGSRVTDPEELLINQEEFDDIEVKMGEL
FT                   LSDLERKVLMLYLDGRSYQEISAELNRHVKSIDNALQRVKRKLERYMELKGVSL"
FT   CDS_pept        149174..149323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /product="50S ribosomal protein L33"
FT                   /note="BH0116"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03835"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03835"
FT                   /db_xref="GOA:Q9KGE9"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGE9"
FT                   /protein_id="BAB03835.1"
FT                   /translation="MGVKRILACVECRSRNYSTKTNQQSHTDRLEMKKFCRTCNRHTLH
FT                   RETK"
FT   CDS_pept        149563..149757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /product="preprotein translocase subunit"
FT                   /note="BH0117"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03836"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03836"
FT                   /db_xref="GOA:Q9KGE8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGE8"
FT                   /protein_id="BAB03836.1"
FT                   /translation="MAGGVKGIGKFFGDVVAEMKRVSWPTRKELTRYTLVVLGTVAFIT
FT                   VFFAVVDYGISALVRGLIE"
FT   CDS_pept        149883..150419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /product="transcriptional antitermination factor"
FT                   /note="BH0118"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03837"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03837"
FT                   /db_xref="GOA:Q9KGE7"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGE7"
FT                   /protein_id="BAB03837.1"
FT                   /translation="MEKNWYVVHTYSGYENKVKTNLEKRVESMDMTDKIFRVMVPVEEE
FT                   TEVKNGKSKQVSRKVFPGYVLVEMVMTDDSWYVVRNTPGVTGFVGSAGAGSKPTPLLPE
FT                   EVDAILRQMGMQEERQVEIDFQLKESVKVKEGPFANFIGTIEEIQLDKRKLKVHVNMFG
FT                   RETPVELEFTQIEKI"
FT   CDS_pept        150574..150999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /product="50S ribosomal protein L11"
FT                   /note="BH0119"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03838"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03838"
FT                   /db_xref="GOA:Q9KGE6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGE6"
FT                   /protein_id="BAB03838.1"
FT                   /translation="MAKKVIKMVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TSDQAGLIIPVEITVFEDRSFTFVTKTPPAAVLLKKAAGIESGSGEPNRNKVATVKRDK
FT                   VREIAETKMPDLNAADVEAAMRMVEGTARSMGIVIED"
FT   CDS_pept        151120..151815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /product="50S ribosomal protein L1"
FT                   /note="BH0120"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03839"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03839"
FT                   /db_xref="GOA:Q9KGE5"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGE5"
FT                   /protein_id="BAB03839.1"
FT                   /translation="MAKRGKKYLEAVKLIDRDQAYQVEEALELVKKASVAKFDETVEVA
FT                   VRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGDEDCINKI
FT                   SQGWFDFDVIVATPDMMAQVGKLGRVLGPKGLMPNPKTGTVTFEVEKAVNDIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFDTAKLAENFETIIDTLVKAKPAAAKGTYLKNIAVSSTMGPGV
FT                   KVSTASFGK"
FT   CDS_pept        152084..152581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /product="50S ribosomal protein L10"
FT                   /note="BH0121"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03840"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03840"
FT                   /db_xref="GOA:Q9KGE4"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGE4"
FT                   /protein_id="BAB03840.1"
FT                   /translation="MSVLEQKKQIVTEIATKLKESQSTVVVDYRGLNVAEVTELRKQLR
FT                   EAGCEFKVYKNTMTRRAAEVAELTELNDVLVGPTAIAFHNEDAIAPAKIINSFAKEHEA
FT                   LEIKAGVIEGNVASVEEVKALAELPSREGLLSMLLSVLQAPVRNFALATKAVADQKEEQ
FT                   GA"
FT   CDS_pept        152640..153005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="BH0122"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03841"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03841"
FT                   /db_xref="GOA:Q9KGE3"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGE3"
FT                   /protein_id="BAB03841.1"
FT                   /translation="MSKDQIIEAIKEMTVLELNDLVKAIEEEFGVTAAAPVAVAGGAAA
FT                   EGGAAEKTEFDVVLESAGGSKINVIKVVREITGLGLKEAKALVDGAPAPIKEGVAKEEA
FT                   EEMKAKLEEAGASVELK"
FT   CDS_pept        153213..154430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0123"
FT                   /product="transposase (01)"
FT                   /note="BH0123"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03842"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03842"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWQ3"
FT                   /protein_id="BAB03842.1"
FT                   /translation="MNFTMDLPGLKDVKVTKMEEREGFIALHVEMPRTPHRCPSCGERT
FT                   ERIHDYRIQKVQHLKLFERWVYLFYRKRRYACRCGKRFAEKACFVERYQRQTVEWNQAF
FT                   RLRLIQGKNFTDTANQFQTSVTTAMRRFDQLAAPLVKKVDHLPPRIAIDDYKGDTNAGK
FT                   YQVIIADADTRKPLDILPDRKADTLKRYLQEKGHHVKAVVMDLSYTFKSAVQKALGHPL
FT                   IIGDPFHFCRYIYWALEGVRRRVQKAFHPYHRKRCKRIKHLFQKERERLDDKQKKKVER
FT                   YLELSPDLREAYELKEHFRQWYQEAKMQGREGRMSEVKQGLYAFYRRVEASRLKEFHRA
FT                   IQTLKNWQTEILNSFAFGLNNGFIEGLNNQTKVIKRNAFGFRRYDRLRNRILLHHQFKH
FT                   QTFGVG"
FT   CDS_pept        154630..155235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0124"
FT                   /note="BH0124"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03843"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03843"
FT                   /db_xref="GOA:Q9KGE2"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGE2"
FT                   /protein_id="BAB03843.1"
FT                   /translation="MTDHYYSANPIVGSDERSWSYTLRGHSFQFTTDRGVFSKQEVDFG
FT                   SRLLIETFQFPEIEGDVLDVGCGYGPIGISLARDGGERSVHMVDVNERAIDLAKRNATA
FT                   NHVKNVVVYRSDLFQQVQDRQFAAIVTNPPIRAGKRVVHQLFEDARDYLLSNGELWIVI
FT                   QKKQGAPSTLDKLHNLYEEVEVVTKKKGYFIIRAKRID"
FT   CDS_pept        complement(155351..155464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0125"
FT                   /note="BH0125"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03844"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03844"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGE1"
FT                   /protein_id="BAB03844.1"
FT                   /translation="MLLPFVRSLASLEPMKEEQKEKMVLSTNHNPLHHSII"
FT   CDS_pept        155663..159205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="BH0126"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03845"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03845"
FT                   /db_xref="GOA:Q9Z9M2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9M2"
FT                   /protein_id="BAB03845.1"
FT                   /translation="MTGQLIQYGRHRQRRSYARINEVLELPNLIEIQTASYQWFLDEGL
FT                   REMFQDISPIQDFTGNLVLEFIDYSLGEPKYPVDESKERDVTYAAPLRVKVRLINKETG
FT                   EVKEQEVFMGDFPLMTDTGTFIINGAERVIVSQLVRSPSVYYSEKIDKNGKKGYTATVI
FT                   PNRGAWLELETDAKDIVYVRIDRTRKIPVTVLLRALGFGSDQEIIDLLGEDEYLRNTLE
FT                   KDNTDSAEKALLEIYERLRPGEPPTVENAKSLLDSRFFDPKRYDLANVGRYKVNKKLHI
FT                   KNRLFNQRLAETLIDPETGEVIAEEGSIIDRRTLDRILPYLENNVGFRTVRMSGGVVEE
FT                   DEVRLQSVKIYAPDDQDGEHVIRVIGNGLVEKEIKHITPADIIASINYFFNLLHSVGGT
FT                   DDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDPNSITPQALINIRPVIAS
FT                   IKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCP
FT                   IETPEGPNIGLINSLSTYAKVNEFGFMETPYRRVDPETGKVTAQIDYLTADEEDNYVVA
FT                   QANMKLAEDGSFIDENIIARFRGENIVVSRDRVDYMDVSPKQVVSAATSCIPFLENDDS
FT                   NRALMGANMQRQAVPLLVPEAPIVGTGMEHVSAKDSGAAIVSKHRGIVERVTAKEIWVR
FT                   RLEEVDGKEIKGDLDKYRLQKFIRSNQGTSYNQRPIVKEGDVVEKREILADGPSMEKGE
FT                   MALGRNVLVGFMTWEGYNYEDAIILSERLVKDDVYTSIHIEEYESEARDTKLGPEEITR
FT                   DIPNVGEDALRNLDERGIIRVGAEVKDGDILVGKVTPKGVTELTAEERLLHAIFGEKAR
FT                   EVRDTSLRAPHGGDGIVLDVKIFNREDGDELPPGVNQLVRVYIVQKRKIHEGDKMAGRH
FT                   GNKGVISRILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLELHLGMAARRLGLHVA
FT                   SPVFDGASEEDVWATLEEAGMARDGKTILYDGRTGEPFDNRVSVGIMYMIKLAHMVDDK
FT                   LHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGR
FT                   VKTYEAIVKGENVPEPGVPESFKVLIKELQSLGMDVKMLSSTEEEIEMKELDDEDEQAS
FT                   DKLNLNIDSTESNV"
FT   CDS_pept        159295..162915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /product="DNA-directed RNA polymerase beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="BH0127"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03846"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03846"
FT                   /db_xref="GOA:Q9Z9M1"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9M1"
FT                   /protein_id="BAB03846.1"
FT                   /translation="MIDVNNFEYMKIGLASPNKIRSWSRGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRSLEEVIYFASYVVTDPGDTPLEKKQLLSEKEFRAYLDKYG
FT                   RSFTAQMGAEAIRKLLMDIDLDKEVDGLKEELQTAQGQRRTRAIKRLEVLEAFRNSGNE
FT                   PSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVSKGLAHNIKSAKRKVERVQPEVWD
FT                   VLEEVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIKLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTMEREGAKGEGSVFK
FT                   DTNEALIAYQNGYVHLHTRIAIPVASLGKTTFKEEQNSQLLLTTVGKLIFNEILPESFP
FT                   YVNEPTAHNLEVETPSKYMVPTSTNVKELFQERDVVAPFKKGFLGNIIAEVFKKFKITE
FT                   TSKMLDRMKDLGFKYSTKAGITVGVADIVVLPEKKEILAEAEKKVDRVLKQFRRGLITE
FT                   EERYDRVISIWSEAKDVIQDKLMGSLDKRNPIFMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PSGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   VREDDCGTDRGLEVEAIKEGNEIIEGLYDRLVGRVAFKTVRHPETGEPIVKKNELIHED
FT                   LAKQIVEAGVEQVTIRSVFTCDTRHGVCKKCYGRNLATGSDVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQELFEARNPKGQAVITEIEGEVTNINEADKREI
FT                   TVKGEMETKTYSIPYGARIKVELGEQVVPGQSLTEGSIDPKELLKVQGMTGVQEYLLRE
FT                   VQKVYRMQGVEIGDKHVEVMVRQMLRKIRVIDAGDTEVLPGSLIEIQHFNDENKKVLLS
FT                   GKRPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELVGLKENVIIG
FT                   KLVPAGTGMNRYRNLDIVSDYDQQAVGTEEAVMEEAVTTE"
FT   CDS_pept        163022..163270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0128"
FT                   /product="ribosomal protein L7AE family"
FT                   /note="BH0128"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03847"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03847"
FT                   /db_xref="GOA:Q9Z9M0"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR023460"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9M0"
FT                   /protein_id="BAB03847.1"
FT                   /translation="MSYEKVSQATDLVIGTKQTLKALEQEEVLEVVIAKDAEPRVVNKV
FT                   EAMASVKQIPIIYVDSMKKLGKACGIDVGAATVALKK"
FT   CDS_pept        163387..163806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /product="30S ribosomal protein S12"
FT                   /note="BH0129"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03848"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03848"
FT                   /db_xref="GOA:Q9Z9L9"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9L9"
FT                   /protein_id="BAB03848.1"
FT                   /translation="MPTINQLIRKGRKAKVKKSDSPALNKGYNSFKKVQTDLSSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLSNQIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVQDRMQGRSKYGTKRPKDKK"
FT   CDS_pept        163853..164323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /product="30S ribosomal protein S7"
FT                   /note="BH0130"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03849"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03849"
FT                   /db_xref="GOA:Q9Z9L8"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9L8"
FT                   /protein_id="BAB03849.1"
FT                   /translation="MPRKGPVARRDVLPDPIYNSKLVTRLINRIMVDGKRGIAQKILYN
FT                   AFELVRERSGKDPMEVFDQALKNIMPVLEVKARRVGGANYQVPVEVKPERRTTLGLRWL
FT                   VNYSRLRGEKTMEERLANEILDAANNTGAAVKKREDTHKMAEANKAFAHYRW"
FT   CDS_pept        164433..166511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fus"
FT                   /product="translation elongation factor G (EF-G)"
FT                   /note="BH0131"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03850"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03850"
FT                   /db_xref="GOA:Q9Z9L7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9L7"
FT                   /protein_id="BAB03850.1"
FT                   /translation="MAREFSLENTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKNNRINIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRVVFVNKMDKTGADFLYSVSTLHDRLQANAHPIQ
FT                   LPIGAEDNFEGIIDLVDMVAYFYEDDLGTRTEAKEIPDEYKEQAQEYHEKLVEAAAELD
FT                   EELMMKYLEGEELTKDELKAAIRKGTCNVEFYPVLCGSAFKNKGVQLMLDAVLDYLPSP
FT                   LDVPAIKGHVPDTEEEAVRKPGDDQPFAALAFKVMTDPYVGKLTFFRVYSGTLDSGSYV
FT                   KNSTKDKRERVGRILQMHANHREEISTVYSGDIAAAVGLKDTSTGDTLCDEKNLVILES
FT                   MEFPEPVIHLSVEPKSKADQDKMGLALAKLAEEDPTFKTHTDEETGQTIIAGMGELHLD
FT                   IIVDRLRREFKVEANVGAPQVSYRETIRQAAQVEGKFVRQSGGRGQYGHVWIEFSPNEE
FT                   GAGFEFVNGIVGGVVPREYIPSVQAGLEEALENGLLAGYPVIDIKAKLFDGSYHDVDSS
FT                   EMAFKIAASMALKNAKSKCNPVLLEPMMKVEVVVPEEYMGDVMGDITSRRGRVEGMEAR
FT                   GNAQVVKAFVPLAEMFGYATSLRSRTQGRGTYTMFFDHYEEVPKSISEEIIKKNSGE"
FT   CDS_pept        166636..167826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /product="translation elongation factor Tu (EF-Tu)"
FT                   /note="BH0132"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03851"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03851"
FT                   /db_xref="GOA:Q9Z9L6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9L6"
FT                   /protein_id="BAB03851.1"
FT                   /translation="MAKEKFDRSKTHANIGTIGHVDHGKTTLTAAITTVLAKRSGKGVA
FT                   MAYDAIDGAPEERERGITISTAHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGGI
FT                   LVVSAADGPMPQTREHILLSRQVGVPYLVVFLNKCDMVDDEELLELVEMEVRDLLSEYD
FT                   FPGDDVPVIRGSALKALEGDAEWEEKIIELMAAVDDYIPTPERDTEKPFMMPVEDVFSI
FT                   TGRGTVATGRVERGQLNVGDEVEIIGLEEEAKKTTVTGVEMFRKLLDYAEAGDNIGALL
FT                   RGVSREEVQRGQVLAKPGTITPHTNFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDV
FT                   TGIIQLPDGVEMVMPGDNVEMTVELIAPIAIEEGTKFSIREGGRTVGAGVVASIQK"
FT   CDS_pept        168749..169057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /product="30S ribosomal protein S10"
FT                   /note="BH0133"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03852"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03852"
FT                   /db_xref="GOA:Q9Z9L5"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9L5"
FT                   /protein_id="BAB03852.1"
FT                   /translation="MAKQKIRIRLKAYDHRVLDQSAEKIVETAKRSGANVSGPIPLPTE
FT                   KSVYTILRAVHKYKDSREQFEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL"
FT   CDS_pept        169126..169755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /product="50S ribosomal protein L3"
FT                   /note="BH0134"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03853"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03853"
FT                   /db_xref="GOA:Q9Z9L4"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9L4"
FT                   /protein_id="BAB03853.1"
FT                   /translation="MSKGILGKKVGMTQVFAENGDVIPVTVIEAAPNVVLQKKTVDSDG
FT                   YEAVQLGFDDQKQNNANKPEKGHAAKAETAPKRFIKEIRGVNLDEFEVGQEIKVDAFAE
FT                   GDIVDVTGTSKGKGFAGAIKRHNQARGPMSHGSRYHRRPGSMGPVDPNRVFKGKALPGR
FT                   MGGEQVTVQNLEIIKVDAERNLLLVKGNVPGAKKSYVTVRSAIKSK"
FT   CDS_pept        169778..170401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /product="50S ribosomal protein L4"
FT                   /note="BH0135"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03854"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03854"
FT                   /db_xref="GOA:Q9Z9L3"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9L3"
FT                   /protein_id="BAB03854.1"
FT                   /translation="MPKVALYNQAGSQVGDIELSDAVFGIEPNENVLHDAVVMQQASLR
FT                   QGTHKTKTRSEVRGGGRKPWRQKGTGRARQGSIRSPQWVGGGTVFGPTPRSYSYKLPKK
FT                   VRRLAIKSALSSKVKAEEIVVLESLALEAPKTKEMASILSGLSVDRKALVVTADYNDNV
FT                   ALSARNIPGVTFVTAEGVNVLDVIKHDKLIITKDAVEKVEEVLA"
FT   CDS_pept        170401..170691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /product="50S ribosomal protein L23"
FT                   /note="BH0136"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03855"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03855"
FT                   /db_xref="GOA:Q9Z9L2"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9L2"
FT                   /protein_id="BAB03855.1"
FT                   /translation="MSNARDVIKRPVITERSTEVMGDKKYTFEVDVRANKTQIKDAIEE
FT                   IFDVKVAKVNTMNYKGKPKRFGRYTGFTARRKKAIVTLTPDSKELDFFEGV"
FT   CDS_pept        170720..171550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /product="50S ribosomal protein L2"
FT                   /note="BH0137"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03856"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03856"
FT                   /db_xref="GOA:Q9Z9L1"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9L1"
FT                   /protein_id="BAB03856.1"
FT                   /translation="MAIKKYKPTSAGRRGMSTLDFAEITTDKPEKSLLAPLHKKGGRNN
FT                   QGKMTVRHQGGGHKRQYRIIDFKRNKDGIPGRVATIEYDPNRSANIALINYVDGEKRYI
FT                   LAPKGLKVGMTIESGPEADIKVGNALPLKNIPVGTVIHNIELKPGKGGQLVRSAGAEAQ
FT                   LLGKEGDYVLVRLNSGETRYILATCRATIGQVGNLEHELVNIGKAGRSRWLGKRPTVRG
FT                   SAMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLGYKTRKKNKASDKYIVRRRKK"
FT   CDS_pept        171611..171889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /product="30S ribosomal protein S19"
FT                   /note="BH0138"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03857"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03857"
FT                   /db_xref="GOA:Q9Z9L0"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9L0"
FT                   /protein_id="BAB03857.1"
FT                   /translation="MGRSLKKGPFVDDHLMKKIETLNESNDKKVVKTWSRRSTIFPEFV
FT                   GHTIAVYDGRKHVPVYISEDMVGHKLGEFAPTRTYKGHAADDKKTRR"
FT   CDS_pept        171922..172263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /product="50S ribosomal protein L22"
FT                   /note="BH0139"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03858"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03858"
FT                   /db_xref="GOA:Q9Z9K9"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9K9"
FT                   /protein_id="BAB03858.1"
FT                   /translation="MQAKAVAKQVRIAPRKARLVIDLIRGKQVGEAIAILKHTPKAASP
FT                   IIEKVLNSAIANAEHNYEMEPNNLVISEAFVDEGVTLKRFRPRAMGRASRINKRTSHIT
FT                   IVVTEKKEG"
FT   CDS_pept        172267..172926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /product="30S ribosomal protein S3"
FT                   /note="BH0140"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03859"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03859"
FT                   /db_xref="GOA:Q9Z9K8"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9K8"
FT                   /protein_id="BAB03859.1"
FT                   /translation="MGQKVNPVGLRVGVIRDWESKWYAEKDYADLLHEDIKIREYIENR
FT                   LKDASVSKIEIERAANRVNITISTAKPGMVIGKGGSEVEALRKALNELTGKRVHINIFE
FT                   VKQADLDAKLVAENIARQLENRISFRRAMKQAIQRTMRAGAQGIKTQVSGRLGGADIAR
FT                   AEHYSEGTVPLHTLRADIDYGTAEADTTYGKLGVKIWIYRGEVLPTKGKNKKEGGN"
FT   CDS_pept        172929..173363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /product="50S ribosomal protein L16"
FT                   /note="BH0141"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03860"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03860"
FT                   /db_xref="GOA:Q9Z9K7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9K7"
FT                   /protein_id="BAB03860.1"
FT                   /translation="MLMPKRVKFRREHRGKMRGRAKGGTEVHFGEYGLQALEASWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMF
FT                   EISGVSEEVAREALRLASHKLPVKCKFVKREEVGGDANEN"
FT   CDS_pept        173353..173556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /product="50S ribosomal protein L29"
FT                   /note="BH0142"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03861"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03861"
FT                   /db_xref="GOA:Q9Z9K6"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9K6"
FT                   /protein_id="BAB03861.1"
FT                   /translation="MKTNELRNLTTAEIEQKTKSLKEELFNLRFQLATGQLDNPTRIRE
FT                   VRKNIARAKTVLRERELGINNG"
FT   CDS_pept        173580..173840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /product="30S ribosomal protein S17"
FT                   /note="BH0143"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03862"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03862"
FT                   /db_xref="GOA:Q9Z9K5"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9K5"
FT                   /protein_id="BAB03862.1"
FT                   /translation="MERNQRKVYTGRVVSDKMDKTITVLVETYKKDRLYGKRVKYSKKF
FT                   KAHDENNSAKIGDIVRIQETRPLSKDKHFRLVEIVEEAVII"
FT   CDS_pept        173877..174245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /product="50S ribosomal protein L14"
FT                   /note="BH0144"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03863"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03863"
FT                   /db_xref="GOA:Q9Z9K4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9K4"
FT                   /protein_id="BAB03863.1"
FT                   /translation="MIQQESRLKVADNSGARELLCIKVLGGSGRKTANIGDVIVCSVKQ
FT                   ATPGGVVKKGDVVKAVIVRSKSGVRRNDGSYIKFDENAAVIVRDDKSPRGTRIFGPVAR
FT                   ELRDNQFMKIVSLAPEVL"
FT   CDS_pept        174292..174603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /product="50S ribosomal protein L24"
FT                   /note="BH0145"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03864"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03864"
FT                   /db_xref="GOA:Q9Z9K3"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9K3"
FT                   /protein_id="BAB03864.1"
FT                   /translation="MHVKKGDTVKVISGKDKGKQGVILEAYPKKDRVLVEGVNIVKKHA
FT                   KPSQENPQGGILNMEAPIHVSNVLPIDPKTGEPTRVGYKVENGKKVRIAKKSGEVLDK"
FT   CDS_pept        174630..175169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /product="50S ribosomal protein L5"
FT                   /note="BH0146"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03865"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03865"
FT                   /db_xref="GOA:Q9Z9K2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9K2"
FT                   /protein_id="BAB03865.1"
FT                   /translation="MNRLKEKYQKEIVPSLTEKFNYSSVMAVPKLEKIVVNMGVGDAVQ
FT                   NAKALDKAVEELTEITGQKPIITKAKKSIAGFKLREGMPIGAKVTLRGERMYEFLDKLI
FT                   SVSLPRVRDFRGISKKAFDGRGNYTLGVKEQLIFPEIDYDKVDKVRGMDVVIVTTASTD
FT                   EEARELLSQMGMPFQK"
FT   CDS_pept        175198..175383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /product="30S ribosomal protein S14"
FT                   /note="BH0147"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03866"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03866"
FT                   /db_xref="GOA:Q9Z9K1"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9K1"
FT                   /protein_id="BAB03866.1"
FT                   /translation="MAKKSMIAKQKRTQKYKVREYTRCERCGRPHSVMRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   CDS_pept        175413..175811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /product="30S ribosomal protein S8"
FT                   /note="BH0148"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03867"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03867"
FT                   /db_xref="GOA:Q9Z9K0"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9K0"
FT                   /protein_id="BAB03867.1"
FT                   /translation="MVMTDPISDMLTRIRNANTVRHEKLELPASKIKKEIAEILKREGF
FT                   IRDYEYIEDSKQGVIRIFLKYGSSNERVITGLKRISKPGLRVYAKAGELPRVLGGLGIA
FT                   IVSTSKGVMTDKEARQQQVGGEVLAYVW"
FT   CDS_pept        175843..176379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /product="50S ribosomal protein L6"
FT                   /note="BH0149"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03868"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03868"
FT                   /db_xref="GOA:Q9Z9J9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9J9"
FT                   /protein_id="BAB03868.1"
FT                   /translation="MSRIGNKPVEIPSGVTVTVNGADVTVKGPKGELKRTFNPEIVVKV
FT                   EDNTVVVERPSDKKEHRALHGTTRSLISNMVEGVSKGFEKSLELVGVGYRAQKSGQKLV
FT                   LNVGYSHPVEIVPEKGIEIEVPSNTKVTVKGIDKERVGAVASNIRSVRLPEPYKGKGIR
FT                   YEGEYVRRKEGKTGK"
FT   CDS_pept        176411..176773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /product="50S ribosomal protein L18"
FT                   /note="BH0150"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03869"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03869"
FT                   /db_xref="GOA:Q9Z9J8"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9J8"
FT                   /protein_id="BAB03869.1"
FT                   /translation="MITKPIKNVARKKRHAHVRRTITGTPERPRLNVFRSSKHIYAQLI
FT                   DDVNGVTVAAASSLDKELKLENGGNVEAAKKVGELVAKRALEKGYKTIVFDRGGYVYHG
FT                   RVASLADAAREAGLQF"
FT   CDS_pept        176793..177293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /product="30S ribosomal protein S5"
FT                   /note="BH0151"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03870"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03870"
FT                   /db_xref="GOA:Q9Z9J7"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9J7"
FT                   /protein_id="BAB03870.1"
FT                   /translation="MRRIDPNTLELEEKVVAINRVAKVVKGGRRFRFAALVVVGDKNGR
FT                   VGFGMGKAQEVPEAIRKAVEDAKKNLIEVPIVGTTIPHEIVGRFGAGRVLLKPASEGTG
FT                   VIAGGPVRAVLDLAGVGDILSKSLGSNNPINMVRATVKGLQELKRAEDVAKLRGKTVEE
FT                   LLG"
FT   CDS_pept        177307..177495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /product="50S ribosomal protein L30"
FT                   /note="BH0152"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03871"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03871"
FT                   /db_xref="GOA:Q9Z9J6"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9J6"
FT                   /protein_id="BAB03871.1"
FT                   /translation="MAKKLEITLTRSLIGRPQDQRVTVNTLGLRKMHQTVVQEDNAAIR
FT                   GMVNKVSHLVTVKEIEA"
FT   CDS_pept        177527..177967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /product="50S ribosomal protein L15"
FT                   /note="BH0153"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03872"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03872"
FT                   /db_xref="GOA:P38373"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38373"
FT                   /protein_id="BAB03872.1"
FT                   /translation="MKLHELKPAEGSRKVRNRVGRGIGSGNGKTAGKGHKGQNARSGGG
FT                   VRPGFEGGQNPLYRRLPKRGFTNPTRKEFAVVNLEKLNRFEDGTEVSPELLLETGVVSN
FT                   AKDGIKILGNGKLEKKLTVKANKFSASAVEAIEAAGGKTEVI"
FT   CDS_pept        177967..179259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /product="preprotein translocase subunit"
FT                   /note="BH0154"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03873"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03873"
FT                   /db_xref="GOA:P38375"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38375"
FT                   /protein_id="BAB03873.1"
FT                   /translation="MFRTISNIFRVGDLRRKVIFTLLMLIVFRIGSFIPVPGTNREVLD
FT                   FVDQANAFGFLNTFGGGALGNFSIFAMGIMPYITASIVMQLLQMDVVPKFAEWAKEGEA
FT                   GRRKLAQFTRYGTIVLGFIQALGMSVGFNNFFPGLIPNPSVSVYLFIALVLTAGTAFLM
FT                   WLGEQITAKGVGNGISIIIFAGIAAGIPNGLNLIYSTRIQDAGEQLFLNIVVILLLALA
FT                   ILAIIVGVIFVQQALRKIPVQYAKRLVGRNPVGGQSTHLPLKVNAAGVIPVIFALSLFI
FT                   FPPTVAGLFGSDHPVAAWVIETFDYTHPIGMAVYALLIIGFTYFYTFIQVNPERMAENL
FT                   KKQGGYIPGIRPGKATQTYITRILYRLTFVGSLFLAVVAILPVFFIKFADLPQAIQIGG
FT                   TGLLIVVGVALDTMKQIEAQLIKRSYKGFIK"
FT   CDS_pept        179331..179984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="BH0155"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03874"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03874"
FT                   /db_xref="GOA:P38372"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38372"
FT                   /protein_id="BAB03874.1"
FT                   /translation="MNLILMGLPGAGKGTQAEKIIEKYGIPHISTGDMFRAAMKNETEL
FT                   GLKAKSYMDAGELVPDEVTIGIVRDRLSQDDCQNGFLLDGFPRTVAQAEALEDILASLD
FT                   KKLDYVINIDVPEQLLMDRLTGRRVSPTSGRTYHVIFNPPKVEGICDVDGSELIQRDDD
FT                   KPETVKKRLEVNQKQAQPLIDFYSEKGYLQNINGDQDISRVFEDINELLKGLSS"
FT   CDS_pept        179981..180727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /note="BH0156"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03875"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03875"
FT                   /db_xref="GOA:Q9Z9J4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9J4"
FT                   /protein_id="BAB03875.1"
FT                   /translation="MIICKTERELEIMREAGRIVALTHQEIKLHIQPGITTKKLDEIAE
FT                   TFIRSHGATPSFKGYNGFTGSICASVNEELVHGIPGNRVLKEGDIISVDIGAKYNGYHG
FT                   DSAWTYAVGNISDEDQDLLDVTETSLYKGLEQAKAGARLSDISHAIQSYAEPRGYAIVR
FT                   EYVGHGVGQNLHEDPQIPHYGPPGKGPRLKPGMVLAIEPMVNAGSRYVRTLSDNWTVVT
FT                   VDGKKCAHFEHTIAITETGYEILTKA"
FT   CDS_pept        180746..181054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0157"
FT                   /note="BH0157"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03876"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03876"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGD7"
FT                   /protein_id="BAB03876.1"
FT                   /translation="MSDSGPSPEIGQIVKIVKGRDRDQFSVIIKRVDDRFVYIADGDKR
FT                   KVDRAKRKNMNHLKLIDHISPEVRHSFEETGKVTNGKLRFALKKFLEEHADLLKEGE"
FT   CDS_pept        181059..181277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /product="translation initiation factor IF-1"
FT                   /note="BH0158"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03877"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03877"
FT                   /db_xref="GOA:O50630"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:O50630"
FT                   /protein_id="BAB03877.1"
FT                   /translation="MAKEDVIEVEGTVIEPLPNAMFRVELENGHKILAHVSGKIRMHFI
FT                   RILPGDKVTVELSPYDLTRGRITYRYK"
FT   CDS_pept        181345..181458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /product="50S ribosomal protein L36"
FT                   /note="BH0159"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03878"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03878"
FT                   /db_xref="GOA:O50631"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:O50631"
FT                   /protein_id="BAB03878.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRKGTVMVICENPKHKQKQG"
FT   CDS_pept        181481..181846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /product="30S ribosomal protein S13"
FT                   /note="BH0160"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03879"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03879"
FT                   /db_xref="GOA:O50632"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:O50632"
FT                   /protein_id="BAB03879.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYIYGVGRSTAQEILAKANVSENTRV
FT                   RDLTEEELGRIRSAVEEFKVEGDLRREVSLNIKRLIEIGAYRGIRHRRGLPVRGQNTKN
FT                   NSRTRKGPRRTVANKKK"
FT   CDS_pept        181865..182254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /product="30S ribosomal protein S11"
FT                   /note="BH0161"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03880"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03880"
FT                   /db_xref="GOA:O50633"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:O50633"
FT                   /protein_id="BAB03880.1"
FT                   /translation="MAKKTNTRKRRQRKNVETGVAHIRSTFNNTIVTITDPHGNAISWA
FT                   SAGALGFKGSRKSTPFAAQMAAETAAKAAMEHGMKSIEVSVKGPGAGREAAIRSLQAVG
FT                   LEVNMIKDVTPVPHNGCRPPKRRRV"
FT   CDS_pept        182420..183364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="BH0162"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03881"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03881"
FT                   /db_xref="GOA:O50634"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:O50634"
FT                   /protein_id="BAB03881.1"
FT                   /translation="MIEIEKPVIETIEISEDAKYGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSVQIDGVLHEFSTIEGVVEDVTTIVLNLKQLALKIYSDEDKTLEIDTQGE
FT                   GVVTAGDLTHDSDVDVLNPDLHIATLTTGAHLRMRITAKRGRGYVPAEGNKSDELAIGV
FT                   IPIDSIYTPVSRVNYQVENTRVGQVTNYDKLTLDVWTDGSIRPEEAVSLGAKILTEHLN
FT                   IFVGLTDQAQNAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELTQKT
FT                   EEDMMKVRNLGRKSLEEVQEKLGELGLGLRKEE"
FT   CDS_pept        183474..183836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /product="50S ribosomal protein L17"
FT                   /note="BH0163"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03882"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03882"
FT                   /db_xref="GOA:O50635"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:O50635"
FT                   /protein_id="BAB03882.1"
FT                   /translation="MAYAKLGRDSAARKALLRDLATDLIINERIETTEAKAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAFIRREVADEETGQDAIQKLFSDIAPRYEDRQGGYTRVLKV
FT                   GPRRGDGAPMAIIELV"
FT   CDS_pept        184100..184936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0164"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="BH0164"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03883"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03883"
FT                   /db_xref="GOA:Q9Z9J3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9J3"
FT                   /protein_id="BAB03883.1"
FT                   /translation="MEKGLLLESVSYQYDANAAPVLKEIDIHVPLGEWVAVIGPNGSGK
FT                   STLAKLLNGLLLPTSGRVTFNGMSTMDEGTHWEIRQQVGLVFQNPEHQFVATTVRDDLA
FT                   FGMENRGFPREKMIQRIEEVSIQVGIDHLLDEEPHRLSGGQKQRVAIAGILAVEPSVIV
FT                   FDEATSMLDPQGRKDVLETMKQLHENGMTIISITHDVNEASQAGRVLLLEKGEVMLDGS
FT                   PAVVFHEQDKLEAAGIDRPFAYQLQLALQSRGIQLEGALLKKEELVEALWKYKSSN"
FT   CDS_pept        184948..185796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0165"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="BH0165"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03884"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03884"
FT                   /db_xref="GOA:Q9KGD6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGD6"
FT                   /protein_id="BAB03884.1"
FT                   /translation="MKGSPFEKVALSDVSFTIPSGSFTAIIGHTGSGKSTLAQHFNGLL
FT                   RPSKGTVRLGELEITADQKPPSLKEIRRKVGLVFQYPEHQLFEETVEKDICFGPMNYGV
FT                   SEARAKKRAKELLHLVGLPDTYLQASPFSLSGGQMRRVAIAGVLAMEPDVLVLDEPTAG
FT                   LDPEGQRLIMDMFYRLHQEKELTTVLVTHNMSDAAKFADQIIVMSQGNVAMTGDRQTVF
FT                   ARADELVALGLDVPETLQLLLQVKERFGLHDVPPLFSLEELADFLAKELQQKEGQPCSK
FT                   I"
FT   CDS_pept        185781..186578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0166"
FT                   /note="BH0166"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03885"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03885"
FT                   /db_xref="GOA:Q7AK00"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AK00"
FT                   /protein_id="BAB03885.1"
FT                   /translation="MFQNIIIGQYVPGNSVLHRLDPRAKLVAVFLLVLFVFFANDWISY
FT                   GVLVTFTLTVILLSRVPLSFIYRGLRPILWLVLLTVLLHLLMTKEGAVVFTIGGFTVHE
FT                   QGIINGVFLSIRLLTLVILTSLLTLTTTPIQVTDGLETLLSPLKRIGVPAHEIALMISI
FT                   ALRFIPTFMQETEKIMKAQMARGVDLTTGPIKERLNALLPLLIPLFMSAFKRAEDLALA
FT                   MEARGYRGGEGRTKLRALTWKSRDTWLLIVVCAFGVGLFLLRA"
FT   CDS_pept        186596..187387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /product="tRNA pseudouridine synthase A (pseudouridylate
FT                   synthase I)"
FT                   /EC_number="4.2.1.70"
FT                   /note="BH0167"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03886"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03886"
FT                   /db_xref="GOA:Q9Z9J0"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9J0"
FT                   /protein_id="BAB03886.1"
FT                   /translation="MKRIGLKVAYDGTDFAGYQIQPNERTVQGELESVLKNIHKGMSIR
FT                   VTASGRTDTGVHARGQIVHFDTSLSFPVDRWPIALNSQLPADICVLEAADVPADFHARY
FT                   SAKTKEYRYRVLTSAQADVFRRNYTYHVRYPLDVEAMQRAAVQLLGTHDFSSFCAAKAE
FT                   VEDKVRTIEDVALWREGDELIFSIRGNGFLYNMVRIIVGTLLEIGAGKRSAEEVAKILA
FT                   ARSREAAGKTAPGHGLISGRSNMTNGKLENNKTTNPCVTKY"
FT   CDS_pept        187536..187973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /product="50S ribosomal protein L13"
FT                   /note="BH0168"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03887"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03887"
FT                   /db_xref="GOA:Q9KGD5"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGD5"
FT                   /protein_id="BAB03887.1"
FT                   /translation="MRTTYMAKPNEVERKWYVVDAEGQTLGRLASEVASILRGKHKPTY
FT                   TPHVDTGDHVIIINAEKIHLTGNKLQDKIYYRHSGHPGGLKETRAADMRANKPEKMLEL
FT                   AIKGMLPKNTLGRKQGMKLHVYAGSEHKHQAQKPEVYELRG"
FT   CDS_pept        187989..188381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /product="30S ribosomal protein S9"
FT                   /note="BH0169"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03888"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03888"
FT                   /db_xref="GOA:Q9KGD4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGD4"
FT                   /protein_id="BAB03888.1"
FT                   /translation="MAQVQYYGTGRRKHSVARVRLVPGDGNIVINGRSLDEYFGLETLK
FT                   LIVKQPLVETGTEGQYDVRVNVDGGGFTGQAGAIRHGIARALLQVDPEYRPSLKSAGFL
FT                   TRDARMKERKKYGLKAARRAPQFSKR"
FT   CDS_pept        188623..189450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0170"
FT                   /product="amino acid ABC transporter (amino acid-binding
FT                   protein)"
FT                   /note="BH0170"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03889"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03889"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGD3"
FT                   /protein_id="BAB03889.1"
FT                   /translation="MKKILSMVALFFAFTTVLAACGAADQNNEETAGEEEAAEASDSLL
FT                   AKVQAEGKLLIGTEGTYPPFTFHDESGELTGFDVELAREVADRLGVEADFMETQWDAMF
FT                   AGLDAERFDMIANQVGIREDRLEKYDFSDHYITSTAVVVTHEDNDEINSFEDIEGKKSA
FT                   QSLTSNYADLAREYNAEIVGVDGFNQAIELLNSKRVDVTINDNLSVLDFLNNRPNAPIK
FT                   MVAEHEDAAQSGFMFRKGNEELVEAVNEALAEIIEDGTYEDISKKWFGEDVLN"
FT   CDS_pept        189437..190138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0171"
FT                   /product="amino acid ABC transporter (permease)"
FT                   /note="BH0171"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03890"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03890"
FT                   /db_xref="GOA:Q9KGD2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGD2"
FT                   /protein_id="BAB03890.1"
FT                   /translation="MYLTNIMLDPERLERWITIAQSSLLPLLKGALYYTIPLTLISFTI
FT                   GLFIAVLTALARISGVAPLKMVARVYVSIIRGTPLLVQLFIIFYGLPSIGVTIDPFPAA
FT                   VIGFSLNVGAYASEIIRAAILSIPKGQWEAAYSIGMSYPQALKRIVLPQASRVSIPPLS
FT                   NSFISLVKDTSLASLILVAEMFRRAQEIAATNYEFLLLYAQAGAIYWIICFGLSLVQGR
FT                   IENRLDRYVAK"
FT   CDS_pept        190154..190897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0172"
FT                   /product="amino acid ABC transporter (ATP-binding protein)"
FT                   /note="BH0172"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03891"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03891"
FT                   /db_xref="GOA:Q9KGD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGD1"
FT                   /protein_id="BAB03891.1"
FT                   /translation="MIAVQSLYKKFGEVEVLKGLDLTVERGKVVVVIGPSGSGKTTLLR
FT                   CLNILETPTSGSVQIENQTLDFSGKVSSKEIANFRRLTGMVFQSYNLFPHMTVLQNVME
FT                   GPMTVKKEAKAQVEEKAKQLLAKVGLADKETVYPFQLSGGQQQRVGIARALAMEPKVML
FT                   FDEPTSALDPELVGEVLRVMKELAEEGMTMIVVTHEMRFAQEVADEVIFMDDGKIVERG
FT                   TPDDIFKTPKVERTKQFLRLIHSRV"
FT   CDS_pept        191015..191254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0173"
FT                   /note="BH0173"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03892"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03892"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGD0"
FT                   /protein_id="BAB03892.1"
FT                   /translation="MKQMTFNHMKINYNPAMHVFTNDDTKGIVFVSKGLDEIHAVVEVS
FT                   ENNKFKIHPRWNVNFFVSDSEITVDLNYCEEEDE"
FT   CDS_pept        complement(191315..193378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0174"
FT                   /note="BH0174"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03893"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03893"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR021865"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGC9"
FT                   /protein_id="BAB03893.1"
FT                   /translation="MSNHEDQQCNRREIGRCSEAEGKDTVARGVASHAEGIGTRALNRA
FT                   SHTEGKETVSRGRSAHAEGRRARSRGFNSHAEGKDTVSIGRNSHAEGKDTRARGLRSHA
FT                   EGADTIANGVNSHAEGNNTAAHGASSHAEGQNSTTTAAATAAHAEGFGTNASAHSAHAE
FT                   GRETTASGEASHVEGEGNTASGRAAHAEGGAVDPQGNPAPTTADGDSAHAEGVGTIASG
FT                   FASHAEGGTLDVNTSPGPQAIGDFSHAEGLFTTASGMAAHSEGTNTTASSSHAHAEGIL
FT                   TIASGVASHAEGNRTTASGVASHAEGEMLDFIRTQAIGRAAHAEGQATIANGTASHTEG
FT                   RNTTTGAGAIAAHAEGINTTANGIASHAEGEFSIATGANAHAEGFNTRATGENSHAEGL
FT                   ITTASNLASHAEGILTTASGAASHAQGQVTIANGLRSHTEGLGTCANNKEGVHVMGLFG
FT                   GPAPADPNYSWYLVNGISQCDPNGVVAKILVDGSACFDSTVTTAGLITAAGACDFAEMF
FT                   ESSNGETIDVGYFVTFDGESEKVRKANETDTFIIGITSSNPGVLADAENPACSKYLVDE
FT                   WNRPIYEEVTLPEVKDPQGNVIAEKRTEIRKKINPDWDPSENGCSRKDQPEWIPVGLVG
FT                   KLLVRDDGTCKVGGYCKPNHEGIATASPIGYRVMKRTGKNQLLVLVDSALRL"
FT   CDS_pept        193789..194196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0175"
FT                   /note="BH0175"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03894"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03894"
FT                   /db_xref="GOA:Q9KGC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGC8"
FT                   /protein_id="BAB03894.1"
FT                   /translation="MTTYVKEELRRAFLSKITIGTAILSVVLVFSGMFEYLSWIPYGDI
FT                   SVLYIFLSGYNSGTASFLGVVFPIIACLPFAASYVEDCKSGLHKYIYLRMKKSHYMTVR
FT                   LIVNGLVGGFVLLAILKTPGYARGSRKLLAW"
FT   CDS_pept        194272..194742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0176"
FT                   /product="transposase (09)"
FT                   /note="BH0176"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03895"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03895"
FT                   /db_xref="GOA:Q9JWR7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWR7"
FT                   /protein_id="BAB03895.1"
FT                   /translation="MKDKNSLAHTTWNCKYHIVFAPKYRRQIIYGKYKKSIGQIIRELC
FT                   ERKGVTIHEANACPDHIHMLVSIPPKLSVSQFMGFLKGKSSLMIFDRHANLKYRYGNRK
FT                   FWCRGFYVDTVGRNKKQIQEYIRNQLREDYMGDQLTLFEEYDPFTGEKNEKK"
FT   CDS_pept        195284..196102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0177"
FT                   /note="BH0177"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03896"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03896"
FT                   /db_xref="GOA:Q9KGC7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGC7"
FT                   /protein_id="BAB03896.1"
FT                   /translation="MKKRRSNLELLLQCFYRKKVYLSVFIVLALYCVNLLIENASSEKN
FT                   VYDLLMQLTEFHPLTYTIIPTYLVVLTAHFSLGKMHHYLAFRCKDKRQWYNLNVSCIAI
FT                   VTTGYSVLIAFIMLMQSLFVFRFENKWSTFAVDYYTYHATFLMNYSPLVYSIATLLLLW
FT                   LLLFLLGLLFYVIFIWTKSPLVSLLFVFLLNIMNAAVTLGKIDTLTPVFFTDRVSIIQY
FT                   VYKFDLNQDSFPYSIFVYWIMLIAVIYLIGWLVIQRVDFESEKGEKHHAS"
FT   CDS_pept        196092..196877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0178"
FT                   /note="BH0178"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03897"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03897"
FT                   /db_xref="GOA:Q9KGC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGC6"
FT                   /protein_id="BAB03897.1"
FT                   /translation="MLARVIRYHLLSMLTPIKILLLVFVFMVNTLLVFSIYGDLIPEDS
FT                   IKATVFMFYVPINIRMDLFRWILVLLPILLIMGAFLSRELKERSLYLLLQMKSFRLWFH
FT                   SFMIVTFLFVLLFFTVGFVITYGMILIFPRNAWIDESLFPYFYSVNEWVLVTHQFSLLV
FT                   LSVFMLVLLKIFFVFLIDNVAVASLMTLICLTASMSIGRVYPSVLDKLPLTYGLFAYRE
FT                   LHAYPFIWSYSILFAGIIALYFLIFCLYRTRRETLFGIR"
FT   CDS_pept        196898..197560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0179"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="BH0179"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03898"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03898"
FT                   /db_xref="GOA:Q9KGC5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGC5"
FT                   /protein_id="BAB03898.1"
FT                   /translation="METIIEVQNLSKVVKGHHLLKKVQLKIDQPKVYGIVGRNGSGKSV
FT                   FFKTIAGLLVPTEGTVKVFGEDIGKGKFPKNFGALLDTPGFLGQYSGFRNLKLLSSIKN
FT                   QVTDEELKEVISFVGLNPDDPRPVRKYSLGMKQRLGIAQAIMEKPKLLILDEPMNGLDE
FT                   SGVHDMRQMILDFKKQGMTILLASHNSEDISILCDVVYQMDNGQLTLKEEHVAVSRG"
FT   CDS_pept        197998..198177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0180"
FT                   /note="BH0180"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03899"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03899"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGC4"
FT                   /protein_id="BAB03899.1"
FT                   /translation="MSTANLEERLATLKADYIKYQGDLEKVESTGGDGGPIERQLCQLE
FT                   EEIQKIREEIRSNG"
FT   CDS_pept        complement(198273..198998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0181"
FT                   /note="BH0181"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03900"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03900"
FT                   /db_xref="GOA:Q9KGC3"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGC3"
FT                   /protein_id="BAB03900.1"
FT                   /translation="MFSSEVIASFNELEMSIYNYICQHAEKVAYMRIRELADETHVSTA
FT                   TILRFCRKVDCDGFSEFKVKLKMHLEKEKKAPIKSSQHAIAEFFERAFRGDLEERISEA
FT                   AALVADAENVIFIGIGSSGILAEYGARYFSALGKLSMYIKDFSYPIHSKLRQNSVTIAL
FT                   SVSGETHFTITQVNQLKQEGSKIISITNNKFSTIAKVADVNLSYYVSEEFFEKANITTQ
FT                   VPVVYILEAMARELYKLQG"
FT   CDS_pept        199346..199531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0182"
FT                   /note="BH0182"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03901"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03901"
FT                   /db_xref="GOA:Q9KGC2"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGC2"
FT                   /protein_id="BAB03901.1"
FT                   /translation="MGYTSWGCIDLVSASTGEFSKRYGFIYVDKHDDGSGTLERKKKDS
FT                   FFWYKKVIETNGADLG"
FT   CDS_pept        199558..200886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="licH"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /note="BH0183"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03902"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03902"
FT                   /db_xref="GOA:Q9KGC1"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGC1"
FT                   /protein_id="BAB03902.1"
FT                   /translation="MTEGIKIATIGGGSSYTPELVEGFIKRYDELPVRELWLVDIEEGK
FT                   EKMEIVGNLAKRMVQKAGLPIDIHLTLDRREALKGADFVTTQFRVGLLDARAKDERIPL
FT                   KYGVLGQETNGPGGLFKGLRTIPVILDICRDMEELCPDAWLINFTNPAGMVTEAVLRYA
FT                   NIKKVVGLCNVPIGIEMGVAKLLDVDHSRIRIDFAGLNHMVYGLDVYLDGVSVKDKVIE
FT                   MITDPNNSSFVKNIEGLGWEPSFVKALGVLTCPYHMYYYKSREMVEKDLKKAKEEGTRA
FT                   EVVQRLEKELFELYKDPNLDIKPPQLEERGGAYYSDAAVRLIHSIYTDRRDIQPVNTMN
FT                   RGAIASIPDDSAVEVSCVITKDGPKPIAMGDLPVPVRGLVQQIKSFERVAAEAAVTGDY
FT                   DLTVLAMTINPLSPSDTIAKQIVDDMLEAHKEHLPQFFNEVQA"
FT   CDS_pept        complement(200995..202143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0184"
FT                   /note="BH0184"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03903"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03903"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGC0"
FT                   /protein_id="BAB03903.1"
FT                   /translation="MIIAVAKTKVQLERVQVEGIEQFHLDLLTNEESDYLLFYPADIRV
FT                   NQDATIVKAINENGEIVEEFEIVDDKFRRMFIHQKPTDMDTLYVSLFGEATSDNYYYTF
FT                   DLQRLSFEKVELDYFSSNVGVQNLEHFGEEVLFDTAVSHKTGEQNIDPDTYAFNVSLSN
FT                   ATTEQSFETELDFVPKSAPLLGFQERIIYGLSGRLNQEGHYENAGIGIVDMAKENVTYE
FT                   DFQQEGQDLYPLYANDDYAYILSEKGTLFVYDREFQYRATYPFHHLPRQDMYYLEGEGA
FT                   VFLEENKAFYLVQSEEDGFTLGLLTFGEHPTFQALEKDYIQKDATYEILYYDHVVKEIY
FT                   LREEGADAHLLIIDNGTFDVKAKIPIEDSHLLDFVLKVERSK"
FT   CDS_pept        complement(202771..204117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0185"
FT                   /note="BH0185"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03904"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03904"
FT                   /db_xref="GOA:Q9KGB9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGB9"
FT                   /protein_id="BAB03904.1"
FT                   /translation="MKQQLIKNGLVLDMKGNHKPQAKDILIEGKWIRDIRPNIEPEVDT
FT                   EIIDAEGKIVMPGFVDTHRHVWESLLRHIGTDWTLLTYLDNLYYGNLGSMLTPEDSYIA
FT                   NLWGALEAIDAGVTTVLDWSMLETPEHADASIKGLQAAGIRAVFAHGTPGYETYWSRDS
FT                   EVRHPKDAKRVKKEYFQSDDQLLTMALAIRGPEFSSWEVTLDDIQLARELDAIASMHIG
FT                   FGTWGPHDRSITRMREAGLLDSDLNLVHVNRIQPHEYEYIAESGASLSVTPEVEMMMGH
FT                   GYPATGYLHKHRGLVTLGVDVVVATAGDMFAQMKFALQAERAWQNEQRLDRGEMPEQLK
FT                   MTTNDVLTFATLNGAKALKLDDKIGTLDVGKEADLLLINPSSFNLFPLNHEPVGAVVQS
FT                   ARPENVDSVFIAGRPVKRHGKLLFDDLDGLRNKVLAASEAVFHRQAAKN"
FT   CDS_pept        complement(204332..204856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0186"
FT                   /note="BH0186"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03905"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03905"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="PDB:2RD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGB8"
FT                   /protein_id="BAB03905.1"
FT                   /translation="MNFQMNEAIQLLERTPKTLEVFLEGLSDSWHQCNEGYETWTVYEV
FT                   VVHLIEAEKTNWIPRLRFILQEGEHKPFPAFDRFSHLNQSNAVPISERFKEFQQLRKEN
FT                   LNTLRSLVQSEADLERTGAHPAFGVVKVRELLSAWVVHDLTHIAQIVRSMAKRYDTDVG
FT                   PWKEYLGILND"
FT   CDS_pept        complement(204964..206028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gutB"
FT                   /product="sorbitol dehydrogenase"
FT                   /EC_number="1.1.1.14"
FT                   /note="BH0187"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03906"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03906"
FT                   /db_xref="GOA:Q9KGB7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGB7"
FT                   /protein_id="BAB03906.1"
FT                   /translation="MKALNLYGIQDLRFEETPAPSIEHDDDIIIKVKAVGICGSDLSRY
FT                   KKLGPYVPGMTFGHEFAGEVVKIGRSVTGFSIGDRVAACPTYTCGQCRYCQLGEPTRCE
FT                   RLSVIGARHPGAYAEYVKLPAKHVIPLPNVVNYDEAALIEPASVVAHGFYRTNIKPGAS
FT                   VAIMGVGSIGLLAVQWAKIFGATTVFAIDIDEQKLNVANQLGADVLISSLQRPAHKQIL
FT                   EYTNGIGVDVAVESAGTPSTSAQVFALPKKGGEVVFLGIPYADVQIERFYFEKIVRNEL
FT                   HVYGSWNALSSPFPGKEWATTIHYMSSGQLNVAPMISYRLPLAKGPETFQQIAKGELKP
FT                   TKVLFYPEKLSERK"
FT   CDS_pept        complement(206070..206390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0188"
FT                   /note="BH0188"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03907"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03907"
FT                   /db_xref="GOA:Q9KGB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGB6"
FT                   /protein_id="BAB03907.1"
FT                   /translation="MFCQEALKYEFQTIFVNLTTERKLAIYGSHGPIAIIGASNLMLGI
FT                   DCFHCLTNLRGDPNMTEMMLEFMLGPLRAISAFYFDYQLIFNTIIISFALFNIGKLRKT
FT                   NT"
FT   CDS_pept        complement(206484..207515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0189"
FT                   /product="sorbitol dehydrogenase"
FT                   /note="BH0189"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03908"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03908"
FT                   /db_xref="GOA:Q9Z9U1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9U1"
FT                   /protein_id="BAB03908.1"
FT                   /translation="MKALVKTQHGTGHFAVQEKPEPTPGKHQVKIKVKYTGVCGSDIHT
FT                   YEGHYPVAAPVTLGHEFSGEIVELGEGVTGFNVGDRVTSETTYSICGKCSYCTSGDYNL
FT                   CSHRKGLGNQQDGSFAKYVIARQESLHHLPAGVDDRSAAMTEPLACTHHAIAKTSINKG
FT                   DLVVVTGPGPIGLLAAQVAKSHGGTVIITGLSNDQVRLKKAKEVGIDYAIDTQEVDIKE
FT                   LVSELTDGYGADVVLECSGAVPAAKQGIDLLRKKGQYAQVGLFAQPEIQFNFEKIIQKE
FT                   ISVVGSRSQKPADWEPALSLLNEKKVNAKTLVTHEYTISEWDKAYHAIKSGEAIKVLLT
FT                   PID"
FT   CDS_pept        complement(207555..208814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /product="PTS system, galactitol-specific enzyme II, C
FT                   component"
FT                   /note="BH0190"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03909"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03909"
FT                   /db_xref="GOA:Q7AK16"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AK16"
FT                   /protein_id="BAB03909.1"
FT                   /translation="METAVSYIQGFLDLGATVILPVAIFLLGLAFGQKPGKAFRSGLTI
FT                   GIAFVGIFLVVDLLVLNLGPAAQGMVDRLGVDLNVIDVGWPATSSIAWASVVAAFIIPL
FT                   GLIVNVIMLVTKTTKTMNVDIWNFWHYTFMAAVVYTVSDSIIQALIAAVMFQIVALKVA
FT                   DWTAPMVSEFYELPGVSIATGSTISYAPGIWLVKGIQKIPGIKHWNADPDTIQRRFGIF
FT                   GESIFIGLILGAAIGLLAGYNVGEVIEIGMAMAAVMVLMPRMVKILMEGLMPVSESARE
FT                   WLNKRFGDREIHIGLDAAVLLGHPSVISTALILVPLTVLLAVILPGNALLPFGDLATIP
FT                   FIVAFIVGAARGNIIHSVLAGAIMIALSLYMATDIAPVFTKMAENSNFNMPEGSALISS
FT                   IDQGGNLVNWIIWKLFALFN"
FT   CDS_pept        complement(208899..209183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /product="PTS system, galactitol-specific enzyme II, B
FT                   component"
FT                   /EC_number="2.7.1.191"
FT                   /note="BH0191"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03910"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03910"
FT                   /db_xref="GOA:Q9KGB5"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGB5"
FT                   /protein_id="BAB03910.1"
FT                   /translation="MTKKQVLVACGAGIATSTVVNNAIEELARDHSLDVQLVQIKIAEV
FT                   SAYVDTADLLVTTAMTKKEYPFPVINARSFLTGIGIEETKQQILNELKK"
FT   CDS_pept        complement(209185..209667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /product="PTS system, galactitol-specific enzyme II, A
FT                   component"
FT                   /EC_number="2.7.1.191"
FT                   /note="BH0192"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03911"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03911"
FT                   /db_xref="GOA:Q7AK15"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AK15"
FT                   /protein_id="BAB03911.1"
FT                   /translation="MSDIVFNESNILLNVEAITSEEVLTIMGKKLHHLGLVKESFVNAV
FT                   ISREKSFPTGLPTSSIAVAIPHTDPHHVKQKTICFAALKDQVDFGVMGETDVNTPVKLV
FT                   FMLAMTEAESQLSLLKHLIDLFQEEDTLMMLVNETTETKIYDIISSKLNLSDKGGE"
FT   CDS_pept        complement(209691..211742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0193"
FT                   /note="BH0193"
FT                   /note="unknown conserved protein in bacilli"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03912"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03912"
FT                   /db_xref="GOA:Q9KGB4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGB4"
FT                   /protein_id="BAB03912.1"
FT                   /translation="MKLNERSQKIFKKILNNPDINSKQLKKAFHLTRRQLSYSLTKINE
FT                   WLREHQLPEIERTRQGFFLVDQKVYSSVTGDVNNPPAPQPYLSKAEREDLLLLMLVSSD
FT                   DLSLHHFTSELAVSQNTILSDLKTVKTFLAECDLTIRYSRKFGYYLHGNEFNIRRLIFH
FT                   LTCKWLTMGDGASRIQRVAGITKEEVGELKRRIHTLEQKLNLTFTDENIQSMPYTLLLI
FT                   LKRIKLGRLINRFSIHYEELSDTKQYHATEELLSGFEEIPREERLFITLYLLTTNVYWS
FT                   KTSTEGQVPNLLPALVDMLRLFEKRACIALQEKEQLLTKLLLHVNPAYYRIKYQLTEMS
FT                   KTSTKISEEYKELHHLVKQSMKPLETLIGVEIPENESSYLTLLIGGWLTRQGDSIQKKT
FT                   KAIVVCSKGVSISRFLLSELKELFPDFIFLDSLSLREFAIYPLNYDLVFSTIPLDTTKK
FT                   LFLTSSILEREEKKRLKEQVMFYLRGYSPPDIKVDDILEIVNNYAVITNEQELANDLYR
FT                   YIYRDQKAPTKSGPINTLATLPDLITVRHITMRDAVASWEEALHIASQPLIDEQKISPT
FT                   YVEAMVDNERDPYIIISPHWAIPHAAPDKGVYDVGMSLLHLQKGVSFTADEKVHLMVVI
FT                   AAVDKQKHLKALMQLMKLAGSKEARKAIEQSTSEDEIFKIIKQYTKDD"
FT   CDS_pept        complement(211948..212844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaN"
FT                   /product="repressor in the phenylacetic acid catabolic
FT                   pathway"
FT                   /note="BH0194"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03913"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03913"
FT                   /db_xref="GOA:Q7AK09"
FT                   /db_xref="InterPro:IPR011965"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AK09"
FT                   /protein_id="BAB03913.1"
FT                   /translation="MENQPNTRSMIFTLYGDYIRHYGNVIWIGSLIRFLQEFGHNEQSV
FT                   RAAVSRMSKQGWIQSEKKGNKSYYSLTDQGRKRMAEAAQRIYKLEAPSWDEKWRLLIYS
FT                   IPEEKRSLRDELRKELVWSGFGLLANSCWITPNPLEEQVETLIEKYEISPYVHFFCADY
FT                   RGMGEPKTLIEKCWDLDEINEKYLAFIQKYSQKYVIDKNKIEKGEMSDGACFVERTLLV
FT                   HEYRKFLFIDPGLPQELLPEKWLGDSAAHLFADYYRTLAEPARRFFESVFAEGNSLVKK
FT                   DKEYNFLDHPFMSESQS"
FT   CDS_pept        complement(213030..214367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaE"
FT                   /product="phenylacetyl-CoA ligase in the phenylacetic acid
FT                   catabolic pathway"
FT                   /note="BH0195"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03914"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03914"
FT                   /db_xref="GOA:Q9KGB3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGB3"
FT                   /protein_id="BAB03914.1"
FT                   /translation="MAFYDQVETLSLEEKEKLQTYHLKSTVKLVYENVPFYRKAFQEVD
FT                   VKPEDIQSLNDVQKLPFTQKHHLRENYPFHLLAVPLNEVVRLHGSSGTSGKPTVVAYTQ
FT                   KDLEHWSSIIARSIYMAGGRKGDLLHNAYGYGLFTGGLGLHGGSEKLGCVTVPISGGNT
FT                   QRQITLIQDFKPRVICGTPSYIMNIGETMKKMGIDPASTSIQYAILGSEPWSEEMRKNL
FT                   ETMFNMKAMDIYGLSEVIGPGVGMECVECQNGLHIADDHFYPEIIDPITLECLPDGEEG
FT                   ELVFTTLQKEALPVIRYRTGDIASLTREPCECGRTTARMSRVKGRVDDMLIIRGVNVFP
FT                   SEIEQCILKMDELDCHYQLHLVKNGALDEVALHVELKDEYYTLDLHGDLNHPHASLLKG
FT                   KIQQTLKQEMLVSMDVHLKEPGTLPRFEGKAKRIVDKRKSNERISS"
FT   CDS_pept        214618..215601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaF"
FT                   /product="ring-oxidation complex protein 1 in the
FT                   phenylacetic acid catabolism pathway"
FT                   /note="BH0196"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03915"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03915"
FT                   /db_xref="GOA:Q7AK13"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011881"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AK13"
FT                   /protein_id="BAB03915.1"
FT                   /translation="MYNFVEHGGVINGQEEDQEKYAAFMEKIDSGKKIEADDWMPKDYR
FT                   ETLIKLISMHGISEIMGALPEKEWVPKAPTLYRKLGIMAKVQDEMGHGQLLLRVAEDLL
FT                   APYGKGREDLMIDLLNGDLKFHNVFHMETKTWADAGVIGWLVDGAAIISQTNMLDASYG
FT                   PYQRALQRICAEEVFHAQHGEAIIMALAEGTETQRQMLQEALNRWWPALLMFFGPESAE
FT                   TTGSSKQEVTTKYKIRKNSNEELRQAFLDKYLPRVFSLGLTVPDETLYYNEDEKRWVYQ
FT                   QPNWNEFKQIIRNNGPRSKERLRLRKLAHEKNKWVREALAAQPVTN"
FT   CDS_pept        215625..215984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0197"
FT                   /note="BH0197"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03916"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03916"
FT                   /db_xref="InterPro:IPR009359"
FT                   /db_xref="InterPro:IPR038693"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGB2"
FT                   /protein_id="BAB03916.1"
FT                   /translation="MAEKKGPGFYQEYEVFSRKSSSAPFQLQFSLLAPNEEMALMMAQE
FT                   NFMRREPVDDIWVVKRSHIRSMTSSEREQWTKRLDNKHYRTTKGYGYLRRKWREKEQVM
FT                   LDEKEILSWKEVKKS"
FT   CDS_pept        215981..216796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaG"
FT                   /product="ring-oxidation complex protein 2 in the
FT                   phenylacetic acid catabolism pathway"
FT                   /note="BH0198"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03917"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03917"
FT                   /db_xref="GOA:Q9KGB1"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011882"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGB1"
FT                   /protein_id="BAB03917.1"
FT                   /translation="MNFAMTPEEAKTNEAYCRALIELLYQLADDDYIVAYRGSEWLGLA
FT                   PHIEEDVAFSSITQNTMGHAVMFYELLEQLGEGDADTLAHERDPALRRNSVYLEKKNGS
FT                   GTYLDEPHYDWALTVIRHFFYETFKKIRLEALTQSSYVPLAKAAQRVLMEQPYHLAHWK
FT                   TWLCQLQQSTEEAKNRLMERIDEAWLEILDMLELGLKGGEMVEYQLITDEATIQQQWVK
FT                   EMNKSLFYVPSQSLQKQEGNGRNGEHTDDLQQALSTCSEVYNSDRHAVW"
FT   CDS_pept        216809..217315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaH"
FT                   /product="ring-oxidation complex protein 3 in the
FT                   phenylacetic acid catabolism pathway"
FT                   /note="BH0199"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03918"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03918"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR011883"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AK12"
FT                   /protein_id="BAB03918.1"
FT                   /translation="MEQQRREEIIATLKTVDDPELPSVSVFDLGMVHSVDVEQGLVTVK
FT                   MIPTFIGCPALDMIKKDVKRAVEVLPWVEVCEVSFSMQELWSTAAITEEGKTCLKKHGI
FT                   APPPEHYVVGEEWSVQCPYCESAYTSIENIFGPTACRSILYCRACKNPFEAMKPIIAQP
FT                   ANDKK"
FT   CDS_pept        217315..217638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0200"
FT                   /note="BH0200"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03919"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03919"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="PDB:2FTR"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGB0"
FT                   /protein_id="BAB03919.1"
FT                   /translation="MKGENMMVKLIALYEQPEDKQAFDEHYFNTHAPLTRKIPGLRDMK
FT                   VTRIVGSPMGESKFYLMCEMYYDDHESLQQAMRTDEGKASGKDAMKFAGKLLTLMIGEE
FT                   MDE"
FT   CDS_pept        217631..218404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0201"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="BH0201"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03920"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03920"
FT                   /db_xref="GOA:Q7AK11"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AK11"
FT                   /protein_id="BAB03920.1"
FT                   /translation="MSSDFIQSWTEGAVGVIQLNRPKVANALNRQMVQEIVEQAERYDR
FT                   DQEIRVILVKGSERAFAAGADIREMEGETPIRFELADPFADWDRFTRIHKPMVAAVSGF
FT                   ALGGGFELALHCDLIVAATNARFGFPEVSLGVLPGAGGTQLLTRAVGRKKALEWIWTGK
FT                   HISAQEALQIGIINKIVEPELVEEEAFRLARTIVKQAPIAVRLIKEAVHQAEDVTLADG
FT                   MMLERKNFYLAFATKDQKEGMKAFLEKRPPIFKGE"
FT   CDS_pept        218407..219189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0202"
FT                   /product="enoyl-CoA hydratase"
FT                   /note="BH0202"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03921"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03921"
FT                   /db_xref="GOA:Q7AK10"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AK10"
FT                   /protein_id="BAB03921.1"
FT                   /translation="MCEEFKDIIYEEKGQVAWVTLNRPATYNAFTPVMNREVTVALKKA
FT                   NQSDAIRAIVLTGTGRAFCSGEDLDGVTVDTDHGAILRARYHPMMQGMKQVEKPIIAAV
FT                   NGTAAGAGMSLALAADFRLVHENAKFVSAFLGVGLIPDSGFLYQLPRMIGYAKALELAV
FT                   LGKPLSAEDAQRCGLVTEVFAADEWEDGVASFSMKLAALPTKAIGLIKRLMIDGMNEGF
FT                   LEVLEKEAQAQRIAGQSADHREGLEAFKQSRPPMFTGL"
FT   CDS_pept        219271..220743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gbsA"
FT                   /product="glycine betaine aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="BH0203"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03922"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03922"
FT                   /db_xref="GOA:Q9KGA9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGA9"
FT                   /protein_id="BAB03922.1"
FT                   /translation="MKRDHYRMVINGERVDSDETFETFNPAKGEILATVAKASREHAEK
FT                   AVQAARHAFDHGKWRKYPVGKRARVLNQIAAIMRERFQELVEIEVLNSGKAISAAQAQI
FT                   NQAIEDFEFYAGAIVGHRGTVNNVPNGFLNYTQKEPVGVCAQIIPWNYPLMMAAWKVAP
FT                   ALAAGCSVVVKPASLTPITAILLNEICHEAGVPEGVVNTVAGAGSVVGDYLVGHEDVNK
FT                   VAFTGSTPIGKDIMEKASHTLKRVTLELGGKSPNLVFADADMEAAVAGSLFGIYFNTGQ
FT                   SCEARSRLFVHEEIYDEFIEEFITRAKKLQLGDPFDKGTHVGSIISRDQLEIIDSYVRS
FT                   AEEEGATIALGGKERRVEGFENGHWYEPTVITNVTPDMKAVQEEIFGPVVVVETFQDER
FT                   EVIKRANDTKFGLGSAIWTKDQGRATRVAHQLEAGIVMVNCPFSAFPGTPFGGYKESGF
FT                   GRELCVETLDLYMEDKSILSYYGPKPINPFGV"
FT   CDS_pept        220760..221608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hbd"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="BH0204"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03923"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03923"
FT                   /db_xref="GOA:Q9KGA8"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGA8"
FT                   /protein_id="BAB03923.1"
FT                   /translation="MVKQVTVVGAGVMGRGIAYVFALAGFQTTLTDISEEQLNRAQQYV
FT                   EETAEKGVAKGKVTEEQKAAIVHGLNVTTHLKDAVKQADLIVEAVPEKRELKQAVLEVA
FT                   DEYSPPHAVIASNTSTISPTELGSYTKRSNQTAVMHFFNPVPLMPLVEIVKGLETSQQT
FT                   VDTIREVSEQIGKETVEVNEFPGFVTSRISALIGNEALHMLQEGVASAEDIDKAVRLGL
FT                   NFPMGPLELADLVGLDARLNNLRYLHETLGEKYRPAPLLEKLVKAGRLGRKTKQGIYKY
FT                   D"
FT   CDS_pept        221623..222825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0205"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="BH0205"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03924"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03924"
FT                   /db_xref="GOA:Q9KGA7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGA7"
FT                   /protein_id="BAB03924.1"
FT                   /translation="MEEVVIIDAVRTPIGRYNGALRDVRPDDLGAIVLRALKERNPQVP
FT                   IDEVEEVVFGNANGAGEDNRNVARMSTLLAGYPVQVAATTLNRLCGSGLDAVAYAARMI
FT                   AVGEGEIVIAGGTESMTRAPYVMEKPGQSYMRGDQTLYDTTIGWRFVHPVMEETYGVDS
FT                   MPETAENVAKTYSISRLAQDHFAYVSQMRAKEAMECGRLDEELVPVEIEDKKNGKYEVR
FT                   TDEHPRPTSTMEKLNSLSPLFENGTVTAGNASGINDGAAAVLLMSRKKANELGLTPLAS
FT                   YIGAATAGVEPRIMGIGPVYATNKLLNRIGWTVNGLDLIELNEAFAAQALACIHELGLN
FT                   QEVVNVNGGAIAYGHPLGASGARILTTLLYEMRRRGSRKGLATMCIGVGQGISVAVERI
FT                   D"
FT   CDS_pept        complement(222884..223309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0206"
FT                   /note="BH0206"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03925"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03925"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGA6"
FT                   /protein_id="BAB03925.1"
FT                   /translation="MAQQQPTVNLNDVVKNHASPPPCDSLLKIDIIEAVKGQATAIWQP
FT                   DASFVNGVGVVMGGFVSSAADVAMAYAVASILNEKQTFGSIHLHTTFHRPVFPGRVTVI
FT                   ANVKKQGRSVSYVEAELFQRDRLVATSVSSVIIKEIN"
FT   CDS_pept        complement(223362..224141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0207"
FT                   /product="RNA-binding protein/enoyl-CoA hydratase"
FT                   /note="BH0207"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03926"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03926"
FT                   /db_xref="GOA:Q9KGA5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGA5"
FT                   /protein_id="BAB03926.1"
FT                   /translation="MDSTVLQTIKNHVAIITFNRPDQLNCFNYQMLLDLEQVIQEVKAN
FT                   PAIRTVIFTGAGGKSFSAGADLKERRTLDENQVRRNVNKIRSVFNQIEELPQPTIAAIN
FT                   GYALGGGFELALACDFRLAVPEAKMGLTEVTWAIIPGAGGTQRLPRLIGSQRAKEMILT
FT                   GRKVAAEEAQRLGIILEVCDSKHLLTEAVRLAEKMSVNGPLAVIQAKYAIHYGCQTDLH
FT                   TGLAIEAKAYETIIPTEDRLEALQAFKEKRPPQFKGK"
FT   CDS_pept        complement(224153..225532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0208"
FT                   /note="BH0208"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03927"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03927"
FT                   /db_xref="GOA:Q9KGA4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KGA4"
FT                   /protein_id="BAB03927.1"
FT                   /translation="MARNAKEHPSIKWGPFHARFPGVHLRLQPSLMIQGAFMLLATCGA
FT                   VTPLVMQYFQVSFEVAWTVSLIMLFWVIAQTILFGDAYAAGAITAALPLTIVFLNTLTP
FT                   GAEAVEGMVALFLVVIALFLFLGVTKLGAAFNHFFPTAIKAGVIMGAAIAALQSEIERL
FT                   PTMPITLISAWVIIMLLMFSIPFAKLPDTKAKVMAGSNALLVSFIAAGLIGWLSGELTF
FT                   TIEWGFFIPPIGETLATLSIWAVGLPSWEMILTVLPIGIIIYVFGFSDLLVANTLLKGA
FT                   DEARTDENINIDPTRSHYIVAIRNLGQLMTAGPLLWVHGPIWTGVQIFLIDRYKKGRAV
FT                   MDSIYSGPMNFYLLAIPFGLLMPVIGIITPLFPVALSISLLLTAFACAYISMSMVNTNV
FT                   SRGIALTIGFLTATLGPAWGMGVGIVLHLMLIGLKKEELTEKEVEGIKDDLLSRKTEHV
FT                   G"
FT   CDS_pept        complement(225823..226071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0209"
FT                   /product="ferredoxin [4Fe-4S]"
FT                   /note="BH0209"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03928"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03928"
FT                   /db_xref="GOA:Q9KGA3"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGA3"
FT                   /protein_id="BAB03928.1"
FT                   /translation="MPIFTIVDQDTCIACGACGASAPDIFDYDDEGLAFYIADHNQGNT
FT                   PIDPSLLNDLEDAVEGCPTGSIKLAEEAFNGELDKGQ"
FT   CDS_pept        complement(226276..227223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0210"
FT                   /note="BH02210"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03929"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03929"
FT                   /db_xref="GOA:Q9KGA2"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGA2"
FT                   /protein_id="BAB03929.1"
FT                   /translation="MNHLLQTLGITRPFIQGGMGNVSHVSLAVAVSKAGGLGTIGVGTM
FT                   EIEKMEQMIKEMHEKTPHPFAVNVPINVRPDLEAVISLIKDLHVPVVSLSAGNPAPFIP
FT                   FFKDAGTKVICVVANVKQALKAEQHGADVIVAEGFEAAGLNSSEELTTFTLIPQIAKAV
FT                   TVPLIAAGGVGNGAGLLAALSLGAQGVQMGTRLIATKEAQVHDSYKQALKEASANDTII
FT                   VGRSYGHRRRLLNTPYAQELLALELKGMSREDYFKKTDETHHIKGAIEGKLSEGHINAG
FT                   QITALIDDIPTVQELFDEMIREARAQQEKLATLL"
FT   CDS_pept        227291..227818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0211"
FT                   /product="ferripyochelin binding protein"
FT                   /note="BH0211"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03930"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03930"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGA1"
FT                   /protein_id="BAB03930.1"
FT                   /translation="MIFRYKDFSPKVDTTAFIAESATVIGNVEIGAYTTVLFNAVIRGD
FT                   EGLIKIGRRCNIQENVMCHLYEQYPLVLEDEVSLGHHAIVHGCTLKQGVLIGMGATVLD
FT                   GAEIGEYSIVGAGSVVPPGKVIPPRSLVLGSPGKVVREVTEQDLAMIEETVETYVRNGQ
FT                   EFKRSDVLERIR"
FT   CDS_pept        227903..228343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0212"
FT                   /product="transcriptional regulator (Lrp/AsnC family)"
FT                   /note="BH0212"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03931"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03931"
FT                   /db_xref="GOA:Q9KGA0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KGA0"
FT                   /protein_id="BAB03931.1"
FT                   /translation="MDRSDIELLKVLQDNGRITLSELSKRLNLSRPSVTERLNRLKERG
FT                   VIEGISARLSYPKIGKSVTVFIQVSEVTVPYATFEKFVEENPHIIECHRITGSISYMMK
FT                   AVVRDMQHLQSLIDELVPYGTLNTSLVIKSPVPYKKVEPVEE"
FT   CDS_pept        228600..229703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0213"
FT                   /product="pyruvate dehydrogenase E1 (lipoamide) alpha
FT                   subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="BH0213"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03932"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03932"
FT                   /db_xref="GOA:Q9KG99"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG99"
FT                   /protein_id="BAB03932.1"
FT                   /translation="MAIENKGIQRELKHEENLFQVLTPKGECQYEGSEFLDKTFVLSMY
FT                   KQMINCREFDEKALKLQRQGRIGTYASFKGQEACQIGGALALRPTDWLFPTYRDHAAIS
FT                   THGQPWHRIFLYWMGHMDGSLSPDDRNILPPAVPIATQMLHAVGTAWADKLKGNPHVSL
FT                   VFFGDGATSEGDFHEALNFAGVYQTPTIFFCQNNGYAISVPFEKQSASKTIKQRSVAYD
FT                   MRGERVDGNDIFAVYLTVKRAIEQARKGRGPTLIEAVTTRFGSHTTADDAKKYRDQEEI
FT                   ERTWKEMQDPLTRLKAYIQAKGWLSEEEEAQMKAKIRETIDEELSMAEQYPKPSISQMF
FT                   EHVYENQPWYVKEQEQELAELLGKEKR"
FT   CDS_pept        229705..230691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0214"
FT                   /product="pyruvate dehydrogenase E1 (lipoamide) beta
FT                   subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="BH0214"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03933"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03933"
FT                   /db_xref="GOA:Q9KG98"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG98"
FT                   /protein_id="BAB03933.1"
FT                   /translation="MGSQQQTMLQAINQTLDDLLATNDDVMLLGEDIGINGGVFRATDG
FT                   LYEKYGKDRVVDTPLAESGIIGSAIGLAMNGKRPIVEIQFLAFIYPGFEQLISHAARMR
FT                   YRTRGQYNVPMVIRTPYGAGIRGPELHSESVEAFFAHTPGLKVVAPSNPYDAKGLLTAA
FT                   TSDPDPVIFLEDTKLYRAFKEDVPNTLYEIPLGQAKVVQEGEDVTVIAWGGMVREALQA
FT                   AKEAEKAHGWSCEIIDLRTIAPIDRETIIESVKKTGRAIIIHEAHKTAGLGGEITALIN
FT                   EEALIYLKAPVKRIAGFDIPVPQFLSENQYLPTIERMFRGIEETVSF"
FT   CDS_pept        230718..231962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0215"
FT                   /product="pyruvate dehydrogenase E2 (dihydrolipoamide
FT                   acetyltransferase)"
FT                   /EC_number="2.3.1.12"
FT                   /note="BH0215"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03934"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03934"
FT                   /db_xref="GOA:Q9KG97"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG97"
FT                   /protein_id="BAB03934.1"
FT                   /translation="MVEFRLPDVGEGMHEGEIISWFVQEGDHVKQDEPVVEVQTDKMNA
FT                   ELTAPVSGKIKRVYYKVGEVAEVGSLLFTIDENLSTFKSETHERTKRENSTEQTRPISN
FT                   ISLTSQQKAPVRKGLATPYVRQLAREMNINLEDVVGTGPGGRVLEQDLQNDTNLQKVKT
FT                   VPSGVANVQESIERTGSSAEKRIPLKGIRKAIAEKMIKSVATIPHVTHVDEIEMDALKE
FT                   LREQLKHYSEQKGIKLTFLPFFIKAIVSALKEFEYFNASIDEETNEIVLKKDYHIGIAT
FT                   DTEKGLIVPVIQNADQKSLLELAGEITQLSTQARKGTLNVQQMTGSTFTISNVGPIGGL
FT                   HATPIINYPEVAILALHKMEPRNVVREWESVIKLMMNMSLSFDHRLVDGATAVRFTNRM
FT                   KELIENPNLLLMELR"
FT   CDS_pept        231963..233384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0216"
FT                   /product="pyruvate dehydrogenase E3 (dihydrolipoamide
FT                   dehydrogenase)"
FT                   /EC_number="1.8.1.4"
FT                   /note="BH0216"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03935"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03935"
FT                   /db_xref="GOA:Q9KG96"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG96"
FT                   /protein_id="BAB03935.1"
FT                   /translation="MVVGEVAVEVDTVVVGGGPGGYTAAIRLGQLGKSVVLIEKNQLGG
FT                   VCLNRGCIPSKALIQMAEKFDELTHLKEMGVELPGKPASIDLHKWQKWKQEITTKLNTG
FT                   IHQLCQQNGVTVVTGEAHFLSSHRVGVETGNAFDVYKFEHAIVATGSSPRSLPFAEVDH
FT                   TYILDSTSALELTEVPRSLSIVGGGYIGMELGLAFAKLGSAVTIVEMSPHILPATAPHI
FT                   SREVLNKAEKLGVTIKSSTSVEHLTVNDGYVELIVQSNGEQETLQSEKALMTVGRSPNT
FT                   KGLGLEQVGVFFNEDGTLPINEECRTNIDHIFAIGDVTEGPALAHKASKQGIVAAEVIG
FT                   GLPSAIDSSYIPYVVFTDPQIAGVGLTAKQAQEQGHRVKTARFPFQANGLALVASKPDG
FT                   FAEVIVDEESHLLLGFHIVGADASNLIGEGVLALELGARVEDVALTVHPHPTFSEGWLG
FT                   AAEAALGHAIHVVNK"
FT   CDS_pept        233412..234785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0217"
FT                   /product="sodium-dependent transporter"
FT                   /note="BH0217"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03936"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03936"
FT                   /db_xref="GOA:Q9KG95"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG95"
FT                   /protein_id="BAB03936.1"
FT                   /translation="MKQQWSSKLAFILAAAGSAVGLGAIWKFPYVTGTSGGGAFFLIFI
FT                   LFTLLIGLPLLIGEFVIGRSTQKNAIESYRAIAPNSSWGGVGKLGIFTCFLLLSFYSVI
FT                   GGWIIIYFLKAITGQLSGLDEGRYGEIFAETISNPILAISSQFAFLAIVMYVVSRGVKK
FT                   GIERASVIMMPALFVLFLAIVIRGLTLDGATEGLAFFLVPDFSTITSETLLYAMGQSFF
FT                   ALSVGVSVMVTYSSYLSRDESIVQSALSIVMLTFVVAFLAGVAIFPAVFSFGMSPDEGP
FT                   VLLFNVLPSVFDQMPYGAFFLVTFLLLFLFATLTSAFSMLEVVVAAITKGDVSQRPKVT
FT                   WLIGLAIFAVGIPSALSYGVWSDVLLFGRTVFDTADFLVSNILMPIGALLIAIFVPLKI
FT                   SKERLYEEIKAGASIGKRLFAIWFILIRYVAPIVIAIVFLDVIGALSFISAVAGAVFN"
FT   CDS_pept        234809..235948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdh"
FT                   /product="phenylalanine dehydrogenase"
FT                   /EC_number="1.4.1.-"
FT                   /note="BH0218"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03937"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03937"
FT                   /db_xref="GOA:Q9KG94"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG94"
FT                   /protein_id="BAB03937.1"
FT                   /translation="MLTKTPTVTSTLDIFTEMAEHEQVLFCHDPSSGLRAIIAIHDTTL
FT                   GPALGGCRMYPYQTTEDALRDVLRLSKGMTQKCAAADVDFGGGKAVIIGDPAKDKSANL
FT                   FRAFGQFVESLNGRFYTGTDMGTTMEDFVHALKETNGIVGIPKEYGGSGDSSVPTAKGV
FT                   INSLKAISQVVLKDKQFSGRTYAIQGLGKVGFKVAEELLKEGNDLYVSDLQESLPLRLQ
FT                   QLGQRLGRHVEILHGDEIYEAAADVFVPCAQGAILNDATIARLKVKAIAGAANNQLEAE
FT                   RHGQMLHDQGIWFAPDYIVNSGGLIQVADELYGSNEKRVLSKTNAIYDTILEIFHQAER
FT                   HHITTLQAANQLCERRIRERARRNNFFVNRIRPKWNLRK"
FT   CDS_pept        complement(236008..237657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0219"
FT                   /product="L-lactate permease"
FT                   /note="BH0219"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03938"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03938"
FT                   /db_xref="GOA:Q9KG93"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG93"
FT                   /protein_id="BAB03938.1"
FT                   /translation="MVTVIALTPILSVMLFLVLLRMPAMKAMPISLLVTAILAFAYWKV
FT                   PVVHISASIIEGIMIGVSILYIVFGAILLLNTLQASGAIDSIRSFLMNVTPDRRIQVIL
FT                   IAWLFGAFIEGAAGFGTPAAIAAPLLVAVGFPPLAAVVLALIADSSPVSFGAVGTPIVV
FT                   GVQQGLQEGAELAAVTTPYLSEMSMTDYLRQLAAQVMQIDVIVGTLMPLILILVLTRFF
FT                   GETKSWKKGFEVWKFALFAGFSFTVPALIVAFLLGPEFPSIVGGAVGLLLVLTAIQKGW
FT                   FMPKETWDFPPQDQWSPEWLGSLTVKLEDRPKPMSLLLAWVPYLLLGLLLVLTRLDVLP
FT                   VKQWLMSVRIGWDHILGTTISATFQPFYLPGTVFILVVLITFFLHKIRKDAFASAISTS
FT                   CKTLIGTAVTLFTAVPMVRLFINSGVNNAGLESMPVELANQAAELLGGSWPLVAPFIGA
FT                   LGSFISGSATFSNMMFSLFQFSVADQIGADPTQVVALQVMGANAGNMICVVNVVAAASV
FT                   VGLVGKEGLIIRMTLIPMMIYAGLAGVIGLLM"
FT   CDS_pept        237936..240041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0220"
FT                   /note="BH0220"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03939"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03939"
FT                   /db_xref="GOA:Q9KG92"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG92"
FT                   /protein_id="BAB03939.1"
FT                   /translation="MSLDQRSTFILTQLLHARSYLPIQELTQKLNVSRRTVYNDLEKIN
FT                   SWLEEQGLKAVYKVRSQGLILDERAKEEIPTKLRSLKSWHYEYSAQERKAWVVIYLLTR
FT                   LEPLFLEHLMDRTGVSRNTTIDDIKCLKDELNNFHLALEFERKDGYTISGDETDKRKAL
FT                   VYYLSQALPQQNWETELSPIRIFLRTKRDNGRIFTIEELQKVYDVISESEKVLKIQYTD
FT                   DVLHSLSLRFLLFMKRVAKGKFIKVHPLEKQVLKGTKEYEAAKVMSFKLEQAFGVHYPD
FT                   EEVLYLTTHILSSKINYANGEIESRKESQELTHIVTSMVNDFQKYACVVFEEKELLEKN
FT                   LFFHIKPAFYRIKYGLEVENNIAESIKTSYPELFLLTRKVVHYLERYVGKSVNDNEVAF
FT                   ITMHFVGWMRREGTIPTKRKKALIVCANGVGTSQFLKNQLEGLFPAVDIIKTCSIREYE
FT                   KTPVEVDFIISTTSIPEKNVPIFIVNPILTETEKERLLKSVHVALDELGAMKGYSIEGL
FT                   MDVIKRHGNVDDEKALYQDLRRFFTQPTPIGPKQEKPDLNQLLTEDMIQLREQVTHWQE
FT                   AIQLAAKPLLLKGMVTESYVKKMIKNIEKFGPYMIIAPHFAIPHAKPEDGVRQLGMSLL
FT                   WLKKPVTFSSQKGHDVHVIVVLASVDSNKHLKALSQLTHLMSKKETMETLMTVHSKQTV
FT                   MQMIDAT"
FT   CDS_pept        240066..240509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0221"
FT                   /note="BH0221"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03940"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03940"
FT                   /db_xref="GOA:Q9KG91"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG91"
FT                   /protein_id="BAB03940.1"
FT                   /translation="MKFLEEPLVAFDLEASSPEEAIRKTGKLLVGNQLVEDEYVEAMVR
FT                   SYQKNGPYFVVAPNIALPHARPEDGVKEAAVAFVRLKRPISFGHSSNDPVRFVFALAAA
FT                   SSGEHLQVLQKLMQLLGNRENIARLANVSDYKGIDQLLGGDAS"
FT   CDS_pept        240506..240775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0222"
FT                   /note="BH0222"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03941"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03941"
FT                   /db_xref="GOA:Q9KG90"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG90"
FT                   /protein_id="BAB03941.1"
FT                   /translation="MKILCVCGLGQGTSLILKMNVETVLSQLGIAADVDNTDVSSASSE
FT                   QSDFIITSKELAESLASHPSKIVIVNNYFDMEEIKQALEENLSS"
FT   CDS_pept        240795..242093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0223"
FT                   /note="BH0223"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03942"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03942"
FT                   /db_xref="GOA:Q9KG89"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG89"
FT                   /protein_id="BAB03942.1"
FT                   /translation="MFQMVEWVASNVFGEPAILLGFIVLLGLVLQKKGFSKTVSGTFKA
FT                   IIGFLIIDAGAGVIVGALNVFEPMWKEVFNLQDQPLGQFMGQEGFNAQYGSAVTLAFFF
FT                   GFVINVLLARFTKMKFIYLTGHMMFWTATIFAGIIIHTVGDVPYWKLVTFLAIFLGVYW
FT                   TVQPAIIQPFMRKVMGHDNIALGHTSASVALIAALLGKVVGNKENDTEKIQLPKGLEFL
FT                   RDSNVITALTMGILFLVGAIILALKDTQGAQELIAQSGEQSFFIYAIIQSFMFAGGIAV
FT                   VLLGVKMFIGEVVPAFNGIATKLVPGARPALDAPVVFPMAPNAVILGFLGAFVGALIWL
FT                   VVIGNTVAYIFVPTMIVLFFHSATAGVFGNATGGVRGAVLGGFMTSTVVAWGQFIMVKF
FT                   LISSTNPDTAMWAADSDMFILGPIVRFLAQLLL"
FT   CDS_pept        242716..243972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0224"
FT                   /product="transposase (11)"
FT                   /note="BH0224"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03943"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03943"
FT                   /db_xref="GOA:Q9KG88"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG88"
FT                   /protein_id="BAB03943.1"
FT                   /translation="MLERILSRENLIQALERVEKNKGSYGVDEMDVKSLRLHLHENWTS
FT                   IRNEIIEGSYFPKPVRRVEIPKPNGGVRKLGIPTVMDRFLQQAIAQILTQLYDPTFSER
FT                   SFGFRPHRRGHNAVRQAKQWMKEGYRWVVDIDLEKFFDKVNHDRLMRKLSSRIQDPRVL
FT                   QLIRRYLQTGVMERGLVSPNTEGTPQGGPLSPLLSNIVLDELDNELEKRGLKFVRYADD
FT                   CNIYVRSKRAGLRIMESVTSFIENRLKLKVNREKSAVDRPWNRKFLGFSFTRGKDPKMR
FT                   VSKESVKRLKQRIRELTSRRHSMKMSDRLRRLNRYLTGWLGYYQVVDTPSILAQIDAWI
FT                   RRRLRMIRWKEWKTTSARQKNLVRLGIKKAKAWQWANSRKGYWRVAHSPIMDYALNSEY
FT                   WKGQGLMSLAERYQTRRWT"
FT   CDS_pept        244078..245073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0225"
FT                   /note="BH0225"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03944"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03944"
FT                   /db_xref="GOA:Q9KG87"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG87"
FT                   /protein_id="BAB03944.1"
FT                   /translation="MSFIRTLRGDINPEELGFTYSHEHIVCRPDYWVQRQEGDLLLDDK
FT                   EKSKRDVEDFKRHGGNSIVDATAVDYGRDVGAVKAISDELDVHIIGTAGFNKSFLWNAK
FT                   IKEELKPIIGGQYDTFAEWIDGSTIHDLTEFVVREVEEGLEGTPWKAGQVKFGTGYNRI
FT                   SPLEEKTLRAVARAHHETKAPIHSHTEVGTMALEQIELLKSEGINLEHVSIGHMDRNPD
FT                   PYYHEQIAKTGAFLSFDGIGKIKYAPESTRIHCILELVKKGYDQQILISGDTARKTYYK
FT                   HYDYGLGLEYIIAKWIPRFISEANHRGFDGEALIHTFFVENPARCFAFKL"
FT   CDS_pept        245092..245841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0226"
FT                   /product="creatinine amidohydrolase"
FT                   /note="BH0226"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03945"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03945"
FT                   /db_xref="GOA:Q9KG86"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG86"
FT                   /protein_id="BAB03945.1"
FT                   /translation="MKFAAENSFEVKQKISEKQIAILPIGAIEAHGPHLPLETDNLLAE
FT                   RLSILVAKRVGAFVLPTLPYGQVWSLKNFPGSITVSNESLVNMLVDLGESLYNQGFSIF
FT                   SMVNGHLGNSVALKEAARKLYERYPDLQVLYFFYPGMSEVVSSIRETPSSHNTYFHACE
FT                   IETSLMLYLAPEYVDMERAICDIPVIPLSADATPTPWEEFTDTAVLGDATLATKEKGEK
FT                   VISVVLDNIVQVIEEVRRGVATYKSND"
FT   CDS_pept        246020..246772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0227"
FT                   /note="BH0227"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03946"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03946"
FT                   /db_xref="GOA:Q9KG85"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR022951"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KG85"
FT                   /protein_id="BAB03946.1"
FT                   /translation="MITSYFNKIEEILQIVLQKEENLLKQAAEKVAESIQNGGIIQLFG
FT                   CGHSHLLTEEVFYRAGGLVPIKPILVEPLMLHEGAVRSSKLERQNDYADWFLQDQDLQA
FT                   NDVLIVLSTSGRNPVPVDVAAYGKEKGAFVIGVTSLEYSKSQPSRHKSGKHLYNSVDLV
FT                   INNHSVKGDAVLSYEKVQVPFAPTSTVVGATILNSMFAEAIKRMADNGYEPPIFLSGNI
FT                   DGADDHNQLLIERYQKRIPLLALDGDEA"
FT   CDS_pept        complement(247163..247474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0228"
FT                   /note="BH0228"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03947"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03947"
FT                   /db_xref="InterPro:IPR007380"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG84"
FT                   /protein_id="BAB03947.1"
FT                   /translation="MHADRKQLLKELILDLHQGVTFDEVIARFQQTFGTITTEEIVQLE
FT                   QALMQEEGITPEEVQKLRSVHAALFKGSIEDIHSTPAEKQLGHPVQTFKRKIKPLVIY"
FT   CDS_pept        complement(247866..248336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0229"
FT                   /note="BH0229"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03948"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03948"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG83"
FT                   /protein_id="BAB03948.1"
FT                   /translation="MERFRYVFFLKNTPIFLGVSLPIIKKLMKHGKLIRLTSQTDSGSF
FT                   LHSQSIYIVLKGSLLLVNQVHHAKTTKTIASWGEGDVFPFDEKGAIFASPHMSIQSASH
FT                   TILLEIPFSNFKHMMTYSSQLQMNFLVLLQKNISLFYQLFLRYLHPSSENGE"
FT   CDS_pept        248485..249204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0230"
FT                   /note="BH0230"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03949"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03949"
FT                   /db_xref="GOA:Q9KG82"
FT                   /db_xref="InterPro:IPR025576"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG82"
FT                   /protein_id="BAB03949.1"
FT                   /translation="MNMLIPKQHGAWAMLVIPYVLGMVKGGAVWWHLPLAVGWLFLYLV
FT                   AYPVTMLVKKRRMDVYKKWAVRYGVIAACFLLPVVWMHPPLLLLGSLLFPFFLVMMMYA
FT                   RKNDDRAFLNDLVAVVIFSAGGLASYWLGAERLDEWALFIFGQTMLFFVGSAFYVKSMI
FT                   REKNNRWFARYSWVYHVLAPCLSLAMGAGWAVLALIPSSIRAWVLYSKKLSVMKIGIYE
FT                   VINASFFLLVISSFLLW"
FT   CDS_pept        complement(249218..249931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fnr"
FT                   /product="transcriptional regulator of anaerobic genes"
FT                   /note="BH0231"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03950"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03950"
FT                   /db_xref="GOA:Q9KG81"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG81"
FT                   /protein_id="BAB03950.1"
FT                   /translation="MNVPVRSSDKDLLSDDLHHLLQQLSTRKKIWKDTYLFQEGMEAEE
FT                   LYLIQSGLVQIEKLTADGKEMTLRMCKANDIVGELTLFSEEAKYMLSAKVLSDGEVFVI
FT                   NKNKLEKELVENGALTFEFMKWMSTHLRKIQSKIRDLLLNGKKGALYSTLIRLANSYGI
FT                   QRVDGILINIVLTNQELANFCAAARESVNRMLGELRKLGVISIEPSGKIVIHELDFLKN
FT                   EIDCENCPIDICNID"
FT   CDS_pept        complement(250072..250683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0232"
FT                   /note="BH0232"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03951"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03951"
FT                   /db_xref="GOA:Q9KG80"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG80"
FT                   /protein_id="BAB03951.1"
FT                   /translation="MKEQMKAVYRNRLLWFFSLFYFITFGAFVAFTIYLPNFLVNHYGL
FT                   TPVDSGLRTAGFIALATFIRPVGGWLADRMNPLILLMYVFAGFTLSSIVLAFSPGIEMY
FT                   TVGVLTVAVCAGVGNGKIFKLVPLYFSQQAGIVNGIVAAMGGLGGFFPPLILAMVYQAT
FT                   GQYAIGFMALSEVALASFVLVVWMYFQDLRNTGNVLNKSM"
FT   CDS_pept        250821..250979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0233"
FT                   /note="BH0233"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03952"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03952"
FT                   /db_xref="InterPro:IPR018680"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG79"
FT                   /protein_id="BAB03952.1"
FT                   /translation="MVGKIAAMQTLEFVTGKLGPYFYNQGIKASRKVVEEKAASMEEEL
FT                   FALEKRL"
FT   CDS_pept        251043..251240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0234"
FT                   /note="BH0234"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03953"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03953"
FT                   /db_xref="GOA:Q9KG78"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KG78"
FT                   /protein_id="BAB03953.1"
FT                   /translation="MMERIQELLEQIVKWLIFTILLVASISLIVVYQQGYIAEALVARA
FT                   TPLAIVVGLSAIAAAIIVKK"
FT   CDS_pept        251420..251617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0235"
FT                   /note="BH0235"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03954"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03954"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG77"
FT                   /protein_id="BAB03954.1"
FT                   /translation="MEFLKQFPIFQEMTDDEFERLTRIAMKRSYEPKAFVFMEGEEREA
FT                   VFFIQSRLVKAYKIDEAGNG"
FT   CDS_pept        252130..255192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0236"
FT                   /note="BH0236"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03955"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03955"
FT                   /db_xref="GOA:Q9KG76"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR040451"
FT                   /db_xref="InterPro:IPR040720"
FT                   /db_xref="PDB:1W9S"
FT                   /db_xref="PDB:1W9T"
FT                   /db_xref="PDB:1W9W"
FT                   /db_xref="PDB:5T49"
FT                   /db_xref="PDB:5T4A"
FT                   /db_xref="PDB:5T4C"
FT                   /db_xref="PDB:5T4G"
FT                   /db_xref="PDB:5T7A"
FT                   /db_xref="PDB:5UPI"
FT                   /db_xref="PDB:5UPM"
FT                   /db_xref="PDB:5UPN"
FT                   /db_xref="PDB:5UPO"
FT                   /db_xref="PDB:5V1W"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG76"
FT                   /protein_id="BAB03955.1"
FT                   /translation="MKGKNVQLLFALVVIILLFPTGASASPHAVSVGKGSYATEFPEID
FT                   FGGINDPGFRDQQGEPPATIYRSDRVTGPMQTNSWWGSLAVDRFSMNQYPHPFSVRHRA
FT                   EGLHVFYDAPHNMVVHENREAGTWHIHGAIGTDFTIKHSGTANFEQAVVDDYNDWYVRG
FT                   LLENGAHQMAITYGVGSPYIFVEYEDGSAVLDFDIAPDVWEMNGHVIGFSTHDHKHYAA
FT                   FAPPGQNWSGIGSKTLTNNADYIAIAKLPEKDGNMLAKFEQYAYSVVRDAVADWTYDEA
FT                   TGTVTTTFEVTTEAKVQGAPDGTIFALYPHQYRHLASSSENQLLQNYQYEIIRGTMIGL
FT                   EGKRFTTELTYPGVLPSLPDLGDYDRERLIGYLHDATSDYPTGSDTYELGKYIGKLATL
FT                   APIADQMGEYELAEQFRGELKDILEDWLQATNASGQLKGKNLFYYNENWGTILGYHAAH
FT                   SSATRINDHHFHYGYFVKAAAEIARADQEWAKSENWGGMIDLLIRDFMADRDDDLFPYL
FT                   RMFDPYSGNSWADGLATFDAGNNQESSSEAMHAWTNVILWAEATGNKALRDRAIYLYTT
FT                   EMSAINEYFFDVHQEIFPEEYGPEIVTINWGGKMDHATWWNSGKVEKYAINWLPFHGGS
FT                   LYLGHHPDYVDRAYEELRRDIGSTDWNLWSNLVWMYRAFTNPDDALQQMEASIDDYGLF
FT                   DPGNEKIIERGSTKAQTYHWIHNLAELGRVDPTVTANHPIYAVFNKNGNRTYIVYNFSD
FT                   SPITVQFSDGHSIQVEPHSFNIGNGDGPTNPDPSEPDLKNPYERIQAEAYDAMSGIQTE
FT                   GTDDDGGGDNIGWINDGDWVKYERVHFERDASSIEVRVASDTPGGRIEIRTGSPTGTLL
FT                   GDVQVPNTGGWQQWQTVTGNVQIQPGTYDVYLVFKGSPEYDLMNVNWFVFRANGQGNGD
FT                   SHTHPDYTAGIRGITGNEVTIFFAPTTEARYVDVHLKVNNGQQLNYRMTERNGEWERVV
FT                   ENLSSGDVLEYSFTYEKLGPQYTTEWFTYSR"
FT   CDS_pept        255327..256490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0237"
FT                   /product="multidrug-efflux transporter"
FT                   /note="BH0237"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03956"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03956"
FT                   /db_xref="GOA:Q9KG75"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG75"
FT                   /protein_id="BAB03956.1"
FT                   /translation="MTKFIYIILVVAFIDTFIQLPIITPYALSLGASETLVGGIVAIYS
FT                   LANMVGNIIGGHWVDRFGRKRMLYMGMLAVGGVLLLYPLAQTGGQLFFARLLHGLAGGV
FT                   LIPAAFALIGDQAKARQSRKPMAFAGASIGIAAITGPAIGGILAAQSRTEYVFILVAIL
FT                   FFLSVGLTIKFVPESMKATSRQRVSWGHVGPLLKNVSLMQACLAAFALMVSNGTLAFAL
FT                   PLLVTQLGLTSAATGMLLSIYGITALFIFITPLNKVYERLYPGRLVVLGLGLIGVSLML
FT                   LSFIHTLSLAVVLMVTYGIGFAFVFPSMNQMVSTASQDEDRGKAYGIFYAVFSLGVVAG
FT                   SFISGVVTELLGVPFIVSGCLMLGCSVLLVWLSQKRITESYAVKRGA"
FT   CDS_pept        256658..257095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0238"
FT                   /note="BH0238"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03957"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03957"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG74"
FT                   /protein_id="BAB03957.1"
FT                   /translation="MTVITTFTQKRREKQWKFERKMLRELTLQQIKKDIQTHFQDIIPF
FT                   HFLTHPFLMDPCTDMAIDAYLLGAEFGRFGYYGEPAEKAKVRCEEELSDLSHYVFDLLQ
FT                   GWYTNSEFILDSLHVASQAFVDHWWRKGFEEGTKRYKLRLH"
FT   CDS_pept        257164..257880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /product="germination specific N-acetylmuramoyl-L-alanine
FT                   amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="BH0239"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03958"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03958"
FT                   /db_xref="GOA:Q9KG73"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG73"
FT                   /protein_id="BAB03958.1"
FT                   /translation="MIKWLKGGVFALGLVALLFIIQYQFISNDSSSTWNLPLSGKVIIL
FT                   DPGHGGIDGGATSRAGALEKDITLAVSLELRDYLQEAGALVLMTREEDRDLADATTAKV
FT                   RQRKVQDLKRRVEIVNGSGADMFVSIHLNAIASPRWSGAQTFYNRAIPENEPLARFVQD
FT                   QLKRNLENTSRYAKPINNVFLLKHAEIPGLLVEAGFLSNPSEAELLETEDYQQKVAASI
FT                   YQGIMRYYTNEDAPEQ"
FT   CDS_pept        257959..259011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0240"
FT                   /product="ATP-binding Mrp protein (Mrp/Nbp35 family)"
FT                   /note="BH0240"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03959"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03959"
FT                   /db_xref="GOA:Q9KG72"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG72"
FT                   /protein_id="BAB03959.1"
FT                   /translation="MLTEEKVLAALNRVKDRDLNKSIVETGGIRELKISGANVSVKVAL
FT                   AQTGTREQMEIQQEIVNVLKGEGAESVGLRFDQLDETEIEKLGGLPKQEFHGPPLLHPN
FT                   TSTTFIAVTSGKGGVGKSTVSVNLATTLARLGKKVGIIDADIYGFSVPDMMGIEERPKV
FT                   VGEQIFPVERFGVKVISMGFFVEDNAPVIWRGPMLGKMLNNFFAEVEWGDLDYLILDLP
FT                   PGTGDVALDIHTMLPHSKEILVTTPHATAAFVAARAGAMALKTHHEIIGVVENMAYFES
FT                   KITGEKEYVFGQGGGERLAEELKTEVLGRIPLGQPEIDEDDFAPSVYGATHPIGEIYTA
FT                   IAKRVIDKTT"
FT   CDS_pept        complement(259113..259751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerD"
FT                   /product="spore germination protein"
FT                   /note="BH0241"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03960"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03960"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG71"
FT                   /protein_id="BAB03960.1"
FT                   /translation="MRKGALLICIALLSIIIGCAPQAQGGNQPPDYESTKKMMVDMLQT
FT                   EEGKQAIKELMADEEVRRTVVMDNAFVKKAIQDTLTSEAGKQFWQETMQDPEFAKTFAE
FT                   SMQAENEKLLKGLMKDPEYQQMMVEVLQNPEMEQMFLDLMKTKEYRQQVMTIMNEAFES
FT                   PYFMAKLNEIFVKVAEEQMKKQQEQQEQQQEQEGGQGDAGGGGGGGGGS"
FT   CDS_pept        259897..260481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaA"
FT                   /product="activation of the KinB signalling pathway of
FT                   sporulation"
FT                   /note="BH0242"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03961"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03961"
FT                   /db_xref="GOA:Q9KG70"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG70"
FT                   /protein_id="BAB03961.1"
FT                   /translation="MNTRKVVQLFFTTLIIGSLSGTIVGLLLDLDLYTSGSVANLIVGI
FT                   IWIAGISAAFSLIAQMGFFAYLTLHRFGLGIFKSVKLWNWVQVILIAFVVFDLIYLRYI
FT                   AFAQEGETIFHYMVMPLALLVYGAIIAYLKAKDTNKGAFIPALFFMVVITSIEWVPALT
FT                   VNDPKWLWVYFAPLIAANTWQILILHRLQQQ"
FT   CDS_pept        complement(260519..261280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0243"
FT                   /note="BH0243"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03962"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03962"
FT                   /db_xref="GOA:Q9JWQ7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014132"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWQ7"
FT                   /protein_id="BAB03962.1"
FT                   /translation="MKFFWVLRAKKIKQLTIILLTAFFCASLLYLERSHLMVFSTPEGP
FT                   QAFHKAETDEKVAALTFNISWGEQRVKPIIDVLQSKKVEEATFFISASWAERHPELVEL
FT                   IQEAGYHIGSHGYQYKNYTTWEDEKIRKDLRQSQQVISSITGEKPTLLRPPNGDFDKRV
FT                   LNLAESYDYTVVHWSINSRDYENPGVDAIVRQVVDHISPGDIVLMHASDSAKQTHKALP
FT                   IIIDQLKGKGYHFRSIEELMADAHPTHDEIK"
FT   CDS_pept        261429..261662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0244"
FT                   /note="BH0244"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03963"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03963"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG69"
FT                   /protein_id="BAB03963.1"
FT                   /translation="MLGCLFNEKEAQEIEYLLKREMEELLLDLSDPRIDEVVKRAMEEK
FT                   YQIVYGIYKRFVPPNERMRYMLKRYKRKGNDF"
FT   rRNA            261929..263480
FT                   /gene="rrnE-16S"
FT                   /product="16S ribosomal RNA"
FT   rRNA            264163..267101
FT                   /gene="rrnE-23S"
FT                   /product="23S ribosomal RNA"
FT   rRNA            267406..267521
FT                   /gene="rrnE-5S"
FT                   /product="5S ribosomal RNA"
FT   tRNA            267531..267605
FT                   /gene="trnE-Asn"
FT                   /product="transfer RNA-Asn"
FT   tRNA            267613..267685
FT                   /gene="trnE-Thr"
FT                   /product="transfer RNA-Thr"
FT   CDS_pept        267850..269175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0245"
FT                   /product="transposase (01)"
FT                   /note="BH0245"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03964"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03964"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG68"
FT                   /protein_id="BAB03964.1"
FT                   /translation="MLGFLHKRGQKKCTQAPLSIILELPRNKERIGAACTMNFTMNLPG
FT                   LKGVKVTKMEEREDFIALHVEMPRTPHRCPSCGERTERTHDYRIQKVQHLKLFERWVYL
FT                   FYRKRRYACRCGKRFAEKACFVERYQRQTVEWNQAFRLRLIQGKNFTDTANQFQTSVTT
FT                   AMRRFDQLAAPLVKKVDHLPPRIAIDDYKGDTNAGKYQVIIADADTRKPLDILPDRKAD
FT                   TLKRYLQEKGHHVKTVVMDLSYTFKSAVQKALGHPLIIGDPFHFCRYIYWALEGVRRRV
FT                   QKAFHPYHRKRCKRIKHLFQKEREGLDDKQKKKMERYLELSPDLREAYELKEHFRQWYQ
FT                   EAKMQGREGRMSEVKQGLYAFYRRVEASPLKEFHRAIQTLKNWQTEILNSFAFGLNNGF
FT                   IEGLNNQTKVIKRNAFGFRRYDRLRSRILLHHQFKHQTFGVG"
FT   CDS_pept        269541..269855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0246"
FT                   /note="BH0246"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03965"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03965"
FT                   /db_xref="GOA:Q9KG67"
FT                   /db_xref="InterPro:IPR019715"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG67"
FT                   /protein_id="BAB03965.1"
FT                   /translation="MIEKRGVSFMEKPKKHEVEDALMHIVDRVERVEESQKESATRLND
FT                   LERNEALQDKDIKNLTVSLDKIQENTLWLRRTVTNAMITGSVGFFATLVTGIIIWAISK
FT                   "
FT   CDS_pept        complement(269907..270599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0247"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="BH0247"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03966"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03966"
FT                   /db_xref="GOA:Q9KG66"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG66"
FT                   /protein_id="BAB03966.1"
FT                   /translation="MLQLSNLEVAYDESTVIRDVSLSVQPGKVVCLLGRNGVGKSTIMK
FT                   TIIGLLQVKRGSIQLEGEDVTKKSPTYRARRGIGYVPQGRDIFPFLTVHENLLLGLEAC
FT                   DTKEQKIDESLYAYFPILKEMKNRRGGDLSGGQQQQLALARALVANPKFLLLDEPTEGV
FT                   QPNIVYDIQKVIMDVKKQSKDQAILLVEQSIDFAKQVGDYFYVVDKGRIAYEGDSLIEA
FT                   EIKQYLSV"
FT   CDS_pept        complement(270583..271386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0248"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="BH0248"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03967"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03967"
FT                   /db_xref="GOA:Q9KG65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017781"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG65"
FT                   /protein_id="BAB03967.1"
FT                   /translation="MNQTALNEPSEKKPIVLKSVKLSVQFGGFFAIRDFSFTIPEGELH
FT                   FLVGPNGAGKTTFLDAICGKAPVSKGSLLFHGDLELSKLKEFERVRHGIGRKFQAPSIF
FT                   PKLTVFENLELSMKQDKRLFPILFSKMKAEERDRMDDMLAFIGLSDERHRIAQTLSHGQ
FT                   KQWLEIGMVMMQEPKLLLLDEPIAGMTETEEEKTGELLLSLKSRCSIIVVEHDMGFVRS
FT                   YADRVTVMHEGQLLCNGTIDEVHHNEQVIEVYLGRKEGSPHATAL"
FT   CDS_pept        complement(271325..272428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0249"
FT                   /product="ABC transporter (permease)"
FT                   /note="BH0249"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03968"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03968"
FT                   /db_xref="GOA:Q9KG64"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017778"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG64"
FT                   /protein_id="BAB03968.1"
FT                   /translation="MTLQLIGTRLFTRQWLMFLIIVLLLVLPFFLSDFRTNLLGRYIAF
FT                   AILVLGLDLLWGYTGVLSLGHGIFFGLGAYIMAMYLSLEGMTGAVPDFMLWNGITGLPL
FT                   LWQVFSNPFIAIIGAVTIPMLIASLLAFFTFRNRIKDVYFTILTQALVLVMVTLIVSQQ
FT                   SITGGTNGLTGFSTIFGYSLSSASTQQVLYYLTLGCLILVFLLCAALVNSRFGRALVAI
FT                   RDGENRLRFSGYDTSMFKVAIFTLSAGIAGLAGMLYVLQVGMITPSMIGIIPSIEMILW
FT                   VAIGGRGTLIGPVIGALVTNSAKTFFSESHPEAWLYLLGTVFVVIVLFLPGGIMSLLRK
FT                   WRKRGERNESDGVKRTEREETHRSQVS"
FT   CDS_pept        complement(272462..273355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0250"
FT                   /product="ABC transporter (permease)"
FT                   /note="BH0250"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03969"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03969"
FT                   /db_xref="GOA:Q9KG63"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017779"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG63"
FT                   /protein_id="BAB03969.1"
FT                   /translation="MIVQLFNGISLGSILLLIALGLAITFGMMRVINMAHGELIMVGAY
FT                   ATYVVQLLFSQYVPPAYFDLYFLLAVPLSFVISALIGILIELTVIRHLYGRPLDSLLAT
FT                   FGVGLILQQTARTIFGAPNVGVQSPSFLRGGLEIAGVTLPFSRLFIITLVLVSFCLLAW
FT                   FFYKTRNGRKIRGVMQNRSMATCLGISTRKVDVMTFAIGSGCAGLAGAALTLLGPIGPT
FT                   IGTYYIVDAFMVVVVGGVGMLVGTVAGALGIGMFNTLFEYWTNASLGKVLVFACIILFL
FT                   QWRPQGLFSLPTRSLD"
FT   CDS_pept        complement(273416..274675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0251"
FT                   /product="ABC transporter (substrate-binding protein)"
FT                   /note="BH0251"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03970"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03970"
FT                   /db_xref="InterPro:IPR017777"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG62"
FT                   /protein_id="BAB03970.1"
FT                   /translation="MESSLRKTVFMMAFSLLILAACGEQTAQQQEQSAEQTEVEVGSDQ
FT                   IAVGILHSLSGTMAMSETSVRDAELLAIEEINEAGGVLGKELVPIIEDGASEPNIFAER
FT                   ATKLLQQDEVAVIFGGWTSASRKAMLPVVEENNGLLFYPVQYEGMEASPNIFYAGAAPN
FT                   QQIVPAVEWLLENRGTEFFLLGSDYVFPRLANAIIKAQLESHGATLVDEQYTPLGHTDY
FT                   NTIISRIRESEPTVIFNTLNGDSNVAFFKQLADAGITADDVTVMSVSVAEEEIRGIGAD
FT                   VLAGHLASWNYFQTTDTPENDTFVTAYIKSFGDDRVTGDPIEAGYLMVHLWAQAVEAAG
FT                   TTDIEAVREAASTIEFSAPGGLVKVDGDNQHLYKTVRIGEVQADGQFEEVWNSGEPVKP
FT                   DPFLEDYEWAEGISSAAAGN"
FT   CDS_pept        274912..275214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureA"
FT                   /product="urease gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="BH0252"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03971"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03971"
FT                   /db_xref="GOA:Q9KG61"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KG61"
FT                   /protein_id="BAB03971.1"
FT                   /translation="MRLSPVEKEKLFLFMAGELAKQRMDRGLKLNYPEAVAILSCYVLE
FT                   GAREGKSVSELMKDGKHVLSTEDVMEGVPEMLEEIQVEATFPDGVKLVTIHEPIQ"
FT   CDS_pept        275229..275603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureB"
FT                   /product="urease beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="BH0253"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03972"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03972"
FT                   /db_xref="GOA:Q9KG60"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KG60"
FT                   /protein_id="BAB03972.1"
FT                   /translation="MIPGEVIPANGEVVLNKGRRMVKVLVAHTGDRPIQVGSHFHFAEV
FT                   NRSLHFDRQEAFGMRLNIAAGTAVRFEPGEEKEVDLVEIGGKRQIYGLNGWTDGAIDDE
FT                   NLPSFLASYQVSEDKEDEEK"
FT   CDS_pept        275600..277315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureC"
FT                   /product="urease alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="BH0254"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03973"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03973"
FT                   /db_xref="GOA:Q9KG59"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KG59"
FT                   /protein_id="BAB03973.1"
FT                   /translation="MKLTRAQHASLYGPTVGDKVRLADTDLLLEIEKDYTVYGDECKFG
FT                   GGKVLRDGMGQSAVYTRDEGVLDLIITNATIIDYTGIVKADIGIKDGHIVGIGKGGNPD
FT                   IMDGVESHMIVGASTEAIAGEGLIVTAGGIDAHIHFISPQQIDVAIASGITTMLGGGTG
FT                   PATGTKATTCTPGKWNIERMLEAADAFPVNLGFLGKGNASTPAPLREQIEAGAIGLKLH
FT                   EDWGTTPAAIRTCLSVADRMDVQVAIHTDTLNEAGFVEDTIKAIGDRVIHTYHTEGAGG
FT                   GHAPDIMKVAGLPNVLPSSTNPTRPFTVNTIDEHLDMLMVCHHLDPNVPEDVAFADSRI
FT                   RPETIAAEDILQDLGVISMISSDSQAMGRVGEVIIRTWQTADKMKKQRGALAEDQGKGN
FT                   DNVRIKRYVSKYTINPAITHGIDDYVGSVEVGKLADLVLWDPRFFGVKPELILKGGLIA
FT                   YSQMGDPNASIPTPQPVFSRPMFGSFGRARGTTSITFLSKAAMDLGVHEALGLQKKIAH
FT                   VKNCRSISKRSMKYNDATPNIEIDPETYEVKVDGEMITCKPFEEVALAQRYFLF"
FT   CDS_pept        277337..277783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureE"
FT                   /product="urease accessory protein"
FT                   /note="BH0255"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03974"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03974"
FT                   /db_xref="GOA:Q9KG58"
FT                   /db_xref="InterPro:IPR004029"
FT                   /db_xref="InterPro:IPR007864"
FT                   /db_xref="InterPro:IPR012406"
FT                   /db_xref="InterPro:IPR036118"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KG58"
FT                   /protein_id="BAB03974.1"
FT                   /translation="MYVHSVIGNIEAKTPTKTIEWIELDWDELNKRILRKTTDHGREVA
FT                   IVMEEQGLTFGDILYEGEDVAIAVRTKLEPAFVIRPKTMKEMGKTAFELGNRHTPCLVE
FT                   NDEIYVRYDSTLAALFNEIGVNYEQTEKRFKQPFKYKGHHHHHD"
FT   CDS_pept        277716..278471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureF"
FT                   /product="urease accessory protein"
FT                   /note="BH0256"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03975"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03975"
FT                   /db_xref="GOA:Q9KG57"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG57"
FT                   /protein_id="BAB03975.1"
FT                   /translation="MNKRRNGLSSRSSTKGITTITIDPLMLVEMMHIHDSAFPIGGYTH
FT                   SFGLETYIQRDIVKDENSLIQWCRTYLYDNLGYGDGILLKETLEVLKKSGSLAAIIEVD
FT                   RLAHAQKLARESREGSLKMGRQFLQTVLPLQEDESLSQWAQLIRAKEAHGHYATTYGVF
FT                   SYTRAYPDQMTMIAFLYSSVANLVHNAVRAIPLGQSTGVRVIHQLHEDCLYVAQQVVAR
FT                   SLNDLSNHAIGIELASMEHEHLHSRLFIS"
FT   CDS_pept        278495..279121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureG"
FT                   /product="urease accessory protein"
FT                   /note="BH0257"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03976"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03976"
FT                   /db_xref="GOA:Q9KG56"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KG56"
FT                   /protein_id="BAB03976.1"
FT                   /translation="MKPIRIGIGGPVGSGKTHLVEQLTRAMHESYELAVITNDIYTKED
FT                   AQFLVKHGILPEDRIIGVETGGCPHTAIREDASMNFEAIHELKQRFTNLDIIFVESGGD
FT                   NLSATFSPELVDGFIYVIDVAEGQDIPRKGGPGVTRSDLLVINKIDLAPYVEVDLDIME
FT                   EDAKQARGERPFVFTDQKRGKGIETIIDWIKRELLLEDMVKEPSV"
FT   CDS_pept        279118..279933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureD"
FT                   /product="urease accessory protein"
FT                   /note="BH0258"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03977"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03977"
FT                   /db_xref="GOA:Q9KG55"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KG55"
FT                   /protein_id="BAB03977.1"
FT                   /translation="MRASSHLPQLHGRLDLTFERRRGTTRLVASEQTPPLNVSRVLRTE
FT                   EVDLATVYLVETSGGVVSGDSQTIAIYVGEGARVELIPQSATKVYPSRKQGESSTQQVW
FT                   LRVDEGAAAFWKPESIIPFRKASFLQSTRFHLHSSSTFFYGDMLTPGRVHHNERFQYEQ
FT                   VDSLVEIYLDETLVVHDRVHLQPKDQLQTIGRLDGYSYYGAVWMHAPILKGAHLEQWME
FT                   NGGQNDRFAYTCVAEGLIHVRWLSESSWRLRAALNDLYTAFRTFALKGE"
FT   CDS_pept        279936..280934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0259"
FT                   /note="BH0259"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03978"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03978"
FT                   /db_xref="GOA:Q9KG54"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG54"
FT                   /protein_id="BAB03978.1"
FT                   /translation="MRRWLVIWASMMFLCACGTQETDSSPLVGEQESKHRVNDQKQLTE
FT                   TGEPLLIYTTVFVLEDFIKKIGGDHVEVKNLIPIGVDAHTYEPSVREMIAVAESDGFFY
FT                   SGGGMEGFIESMMHSLRDEKVPMFEASEGVEFIGGGHDHHHHGEEDHHHDHHHGDRDPH
FT                   VWIDPIRAIQLARNVKAGLQQLKPEASEAFEKNFEQLVEQLEALDQSFLAMTESAERTM
FT                   FLVAHAGYTYWEERYGLEQVAITGFSPANEPSLHQVKELIEFAEAHGLSHIGFERNYKI
FT                   PIAETLMEELGGEAVYFNNLENVVQADRDKGFDYFDLMEQNVKTLEQLLNE"
FT   CDS_pept        281210..281320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0260"
FT                   /note="BH0260"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03979"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KG53"
FT                   /protein_id="BAB03979.1"
FT                   /translation="MKILVNESWEQQRKKIQQLLSDEKTGKESMVSVKWT"
FT   CDS_pept        complement(281609..281836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0261"
FT                   /note="BH0261"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03980"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KG52"
FT                   /protein_id="BAB03980.1"
FT                   /translation="MTEKGYPSADAYEKELLSLLETVRYQAKQDTTLQIAERMLDYGVD
FT                   VQLTAAVTGLTRDEILSGKRGKIPLQVKVK"
FT   tRNA            282063..282137
FT                   /gene="trnF-Glu"
FT                   /product="transfer RNA-Glu"
FT   tRNA            282231..282306
FT                   /gene="trnF-Val"
FT                   /product="transfer RNA-Val"
FT   tRNA            282562..282634
FT                   /gene="trnF-Thr"
FT                   /product="transfer RNA-Thr"
FT   tRNA            282656..282740
FT                   /gene="trnF-Tyr"
FT                   /product="transfer RNA-Tyr"
FT   tRNA            282749..282823
FT                   /gene="trnF-Gln"
FT                   /product="transfer RNA-Gln"
FT   tRNA            282887..282962
FT                   /gene="trnF-Lys"
FT                   /product="transfer RNA-Lys"
FT   tRNA            282970..283044
FT                   /gene="trnF-Gly"
FT                   /product="transfer RNA-Gly"
FT   tRNA            283049..283124
FT                   /gene="trnF-Ala"
FT                   /product="transfer RNA-Ala"
FT   CDS_pept        complement(283175..283333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0262"
FT                   /note="BH0262"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03981"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03981"
FT                   /db_xref="GOA:Q9KG51"
FT                   /db_xref="InterPro:IPR018540"
FT                   /db_xref="InterPro:IPR037208"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KG51"
FT                   /protein_id="BAB03981.1"
FT                   /translation="MEKTQQQLIHEIEHIRKFLIDLGEDYPLHSHIVVSCSQKLDLLLN
FT                   EFERTKE"
FT   CDS_pept        283538..284101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigW"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /note="BH0263"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03982"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03982"
FT                   /db_xref="GOA:Q9KG50"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG50"
FT                   /protein_id="BAB03982.1"
FT                   /translation="MDSIDKRLVREVRAGDEQAFAELVELYKDKVYQVAYRMVGNVHEA
FT                   QDVAQEAFLRAYTNIDTYDIQRKFSTWLFRIATNVAIDRLRKRKPDFHLEDPVQGADGL
FT                   TIESQLAADEEPVDDQVIQMETRDWIQQEIQALPPKYRMAVLLKYMEDLSLKEISDILD
FT                   LPVSTVKTRIHRGREALRKRMRHV"
FT   CDS_pept        284117..284758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0264"
FT                   /note="BH0264"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03983"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03983"
FT                   /db_xref="GOA:Q9KG49"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KG49"
FT                   /protein_id="BAB03983.1"
FT                   /translation="MSCEQHYRTLIDKYIDGEATAEERQELNEHLETCDACFEYMLEVR
FT                   KVVAFVQSASHVQAPEGFTENVMKNLPKRKQTNRFKVWMRRYPLAVAAAVFVLLMSTSL
FT                   FSMWSSDGEHVTVTGTGNVSIDQESGRVIVPEGEVIQGDLVVRNGELIIEGEVQGNVLL
FT                   VNSSQYLASPGSVSGEIDEVNQILDWIWYHTKKFLTKVIDISDEKNSPSS"
FT   CDS_pept        285128..285952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0265"
FT                   /note="BH0265"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03984"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03984"
FT                   /db_xref="GOA:Q9KG48"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG48"
FT                   /protein_id="BAB03984.1"
FT                   /translation="MFFGENLPWLNYLTQILDILVVTYVIYKAIMIIRGTRAVQLLKGI
FT                   TVILIVYAISIFFNLRTLGWIVNQAITYGLLAVIIIFQPELRRALEQLGRGRFFASRTA
FT                   NEEETMKKTIDAIVKASTYMGKRRIGALISMERETGMTDYVETGIPMNANLTSELLINT
FT                   FIPNTPLHDGAVIINNDTILAAACYLPLSENPFISKELGTRHRAALGVSEVTDCLTIVV
FT                   SEETGHISLTKNGELHRDLDEEQLRSLLEAELISEAKMVTTSRWQWGGKKNG"
FT   CDS_pept        285945..287201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0266"
FT                   /note="BH0266"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03985"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03985"
FT                   /db_xref="GOA:Q9KG47"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="PDB:2KQ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG47"
FT                   /protein_id="BAB03985.1"
FT                   /translation="MDKLFNSPWFVKIISFFLAIMLFIMVNVDNLNNQPSILPTFDHGN
FT                   LSLGELELTVLYDEERYDIVEQTETVQVDLEGPRGVLTVFRFARPSYEVFVDLTEAGEG
FT                   SHTVDVEHRGFPGDLAVTVEPRMARVQLEERQTVSVPVTVEMINEEEIEPGFSPGTPVV
FT                   SPVNIEVTAGRSKVEQVASAVVYVDMTGAEGEIEQDLEVQLLNAAGEPLDFDREPQTVN
FT                   VRIPVESPSVELPVRVTRAGELPDGLSIESVEIEPNTVTVYGPQDVLDELSVIEGEDLS
FT                   VDLSAIEDTETITLDVPVPEGAESVSPAQIEVTLHIEEEDELEMAEVPIDIVGIADNME
FT                   VVFTDGSPSVVALSVFGASKHLQNLEVGDIDIYVDVNGLSEGVHEVPLEFEGPSFLRYK
FT                   ADASTTELRLTAQSNDERR"
FT   CDS_pept        287215..288558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0267"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="BH0267"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03986"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03986"
FT                   /db_xref="GOA:Q9KG46"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KG46"
FT                   /protein_id="BAB03986.1"
FT                   /translation="MGKYFGTDGVRGVANTELTPELAFKLGRIGGYVLTKDKENPKVLI
FT                   GRDTRISGEMLEGALVAGLLSIGVEVMRLGVISTPGVAFLTKAVSASAGVMISASHNPV
FT                   ADNGIKFFGPDGFKLLDEQEKEIETLLDQEDALPRPTGADLGQANDYFEGAQKYLQFLK
FT                   QTVDEDFTGIHIALDCANGAASSLAPHLFADLEADISTMGTSPNGKNINDGVGSTHPEA
FT                   LAAFVNAKNADIGLAFDGDADRLIAVDEKGNIVDGDKILYICAKYMKEKGLLKQQTLVT
FT                   TVMSNLGLYKALEALQIDTKQTAVGDRYVMEEMRKGGYNLGGEQSGHIIFLDHITTGDG
FT                   MLSALQLVNIMKQTGKKLSELAEEWETFPQTLVNIRVTDKHAVTDNEKVPAVIKEVEQE
FT                   MNGEGRVLVRPSGTEPLVRIMVEAKTEELCDAFVNKIADVVKAELGQE"
FT   CDS_pept        289008..290810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /product="L-glutamine-D-fructose-6-phosphate
FT                   amidotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /note="BH0268"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03987"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03987"
FT                   /db_xref="GOA:Q9KG45"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KG45"
FT                   /protein_id="BAB03987.1"
FT                   /translation="MCGIVGYIGTEDAKEILLKGLEKLEYRGYDSAGIAVATEEGVHIF
FT                   KEKGRIATLREVVDQGVKSTVGIGHTRWATHGEPSKVNAHPHQSESSRFTIVHNGVIEN
FT                   YEQLKRDYLQAVTLQSDTDTEVVVQLVERFVHEGQSVEAAFRHTLSLLKGSYAIALLDK
FT                   KDTDTIYVGKNKSPLLVGVQDGVNVVASDAMAMLQVTDQFLEIMDEEIVIVTKDDVTIK
FT                   TLDGTAVSREPYTAELDASDIEKGTYPHFMLKEIDEQPFVIRNIIQKYQNEDGSVRLDE
FT                   DIRQAVMEADRIYIIAAGTSYHAGLVGKQLIENFAKQPVEVHIASEFLYNMPLLSKRPL
FT                   FIFISQSGETADSRGVLVEVKKLGYKALTITNVPGSTLSREADFTLHTHAGPEIAVAST
FT                   KAYTAQMAVLTLLAADTAKAKGIDLGFDPIQELSIVANAMETLCNQKETLEKIARDYLA
FT                   VTRNCFFIGRATDYFVCLEGALKLKEISYIQAEGFAGGELKHGTIALIEEGTPIVALAT
FT                   QEHVNLSIRGNVKEVAARGAFPCIISMEGLNEEDDTFVLPKVHSHLTPLVSVIPLQLIA
FT                   YYAALHRGCDVDKPRNLAKSVTVE"
FT   CDS_pept        291039..291509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0269"
FT                   /product="transposase (09)"
FT                   /note="BH0269"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03988"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03988"
FT                   /db_xref="GOA:Q9JWR7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWR7"
FT                   /protein_id="BAB03988.1"
FT                   /translation="MKDKNSLAHTTWNCKYHIVFAPKYRRQIIYGKYKKSIGQIIRELC
FT                   ERKGVTIHEANACPDHIHMLVSIPPKLSVSQFMGFLKGKSSLMIFDRHANLKYRYGNRK
FT                   FWCRGFYVDTVGRNKKQIQEYIRNQLREDYMGDQLTLFEEYDPFTGEKNEKK"
FT   CDS_pept        291658..292983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0270"
FT                   /product="transposase (01)"
FT                   /note="BH0270"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03989"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03989"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG44"
FT                   /protein_id="BAB03989.1"
FT                   /translation="MLGFLHKRGQKKCTQAPLSIILELPRNKERIGAACTMNFTMNLPG
FT                   LKGVKVTKMEEREDFIALHVEMPRTPHRCPSCGERTERIHDYRIQKVQHLKLFERWVYL
FT                   FYRKRRYACRCGKRFAEKACFVERYQRQTVEWNQAFRLRLIQGKNFTDTANQFQTSVTT
FT                   AMRRFDQLAAPLVKKVDHLPPRIAIDDYKGDTNAGKYQVIIADADTRKPLDILPDRKAD
FT                   TLKRYLQEKGHHVKAVVMDLSYTFKSAVQKALGHPLIIGDPFHFCRYIYWALEGVRRRV
FT                   QKAFHPYHRKRCKRIKHLFQKERERLDDKQKKKMERYLELSPDLREAYELKEHFRRWYQ
FT                   EAKMQGREGRMSEVKQGLYAFYRRVEASPLKEFHRAIQTLKNWQTEILNSFAFGLNNGF
FT                   IEGLNNQTKVIKRNAFGFRRYDRLRNRILLHHQFKHQTFGVG"
FT   CDS_pept        293244..293936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0271"
FT                   /product="two-component response regulator"
FT                   /note="BH0271"
FT                   /note="incomplete"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03990"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03990"
FT                   /db_xref="GOA:Q9KG43"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG43"
FT                   /protein_id="BAB03990.1"
FT                   /translation="MYRILIVEDERSITHTLKKRLEKYGYECHTIEDFKRVLDVFQETE
FT                   PHLVIMDINLPYFDGYYWSRKIRQISTCPIMILSARMSELDQVYGIENGADDFITKPFV
FT                   MDVVLAKINGQIRRTYGEYAKNTERRIVQLGNTTLNLDTVRLSTPKQEEVLTVKELQLC
FT                   TMFFEDFPNVVTRQRLLSVIWDEEGFVEENTLTVNIKRLRKKLENVQSSLELKTIRGIG
FT                   YQLTVKDE"
FT   CDS_pept        293933..294928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0272"
FT                   /note="BH0272"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03991"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03991"
FT                   /db_xref="GOA:Q9KG42"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG42"
FT                   /protein_id="BAB03991.1"
FT                   /translation="MKLFIKDHLSFILLYLITFICLPFIIEQLDGFENHYDYFSFLAIT
FT                   LLMSLLVIRYLRRKKMYTHLKKENLDQADFLIYRPHAPIEKAYANQLKEFSSLLLKEQD
FT                   TYQNFLQEQQLLISHAVHQMKTPISVMQLLVQSNQTNDVKSLGEWQKVKAECDKIYFSL
FT                   NQLLSYSRSTQLLSDLKIEAMPLKKIIQEVINDLKDYFIEEELFPKVTIAEEVILYSDR
FT                   KWMKVVVYQLLSNAIKYGEKHSTVHIYYRNGQLSIHNRGETIPKSEINRLFNLFYTGSK
FT                   GRKRSEATGIGLYLVKRILVTLDHPFELTSHHQETTFTIELSKSISTAAD"
FT   CDS_pept        295044..295805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0273"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="BH0273"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03992"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03992"
FT                   /db_xref="GOA:Q9KG41"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG41"
FT                   /protein_id="BAB03992.1"
FT                   /translation="MSDIILNVQQLHKDYVGEVNYKALKGIDFQLKRNEFVSVMGPSGS
FT                   GKTTFLNCISTIDRPTNGSITINQKNPYELNDEDLAKFRRSELGFVFQDFNLVHTLTVE
FT                   ENILLPLTLDAVNAKEMTSRLAEVVEFLGIEEIMKKRTFEISGGQKQRVAIARAVIHQP
FT                   SLLLADEPTGNLDSKAANSVMTLFQSIHETFQTSLLMVTHDPYVASFAERVIFMQDGML
FT                   YNEIQRGDHKKQFYQEIVDTLTFLGGGYHEL"
FT   CDS_pept        295795..296016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0274"
FT                   /note="BH0274"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03993"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03993"
FT                   /db_xref="GOA:Q9KG40"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG40"
FT                   /protein_id="BAB03993.1"
FT                   /translation="MSFNHIVIQNIVRDKWTYISYFLSSVFSILVFFFFLITAFHPMMD
FT                   AIDANSSLGIAMILCSMIVYIFSFIFII"
FT   CDS_pept        complement(296088..297443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0275"
FT                   /product="transposase (07)"
FT                   /note="BH0275"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03994"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03994"
FT                   /db_xref="GOA:Q9JWQ1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWQ1"
FT                   /protein_id="BAB03994.1"
FT                   /translation="MTIIRQMSLFSMQELYEMEPTQRYDAIFSAIDLSSIVHEVTKKSH
FT                   LGAPEALNYPAMVISILIRLVEGIPTMKHLIKRLNEDLAFKRNCGFLVSDSVPSEASYS
FT                   RLLTKLENSNILAEVQEKVILQAIAEGFITDDTVAIDATHFEARDQAPPKEEKPKEEPQ
FT                   KRGRKTKKEREQWLIEQAEKEANLPLFEKKIEAQLEVSLAQLRREIPQDPKWGIKKNSE
FT                   GKNVFWYGYKGHLAVGTSSQYILQSLFSSGNLNDGKAAIPLLKGIHERLPLNSLRYQTM
FT                   DAGYDFEPIYEQVYRMGQQSVIAYNKRNERERVGFDEHFAPTCVREHSYRYDSFDPKYE
FT                   TLKYTRPKECHDCPLANDGLCQKVYKVKITTDLRKYTAPARGSNVWKSIFKQRTAVERV
FT                   NAYLKELFQLNNVRHRSGKRAKVHFDLVTLVYNASKLAVDRIRTSHQQQQAA"
FT   CDS_pept        297582..299207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0276"
FT                   /note="BH0276"
FT                   /note="unknown conserved protein in bacilli"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03995"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03995"
FT                   /db_xref="GOA:Q9KG39"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG39"
FT                   /protein_id="BAB03995.1"
FT                   /translation="MLAFLKKKTKSLGVFIISGASTKQVRKMVFRENMLIAFAAIITAI
FT                   VVGLIVSPLFLMVVKNILEAESFGMYVPVQAIATTFILFSVLFFIVSKITTRFIKKEEA
FT                   VQLLKADVTQEKLILPTPWRFLLSILVSAVCLLPFKVNPDIIESLGILYFVILFISLLI
FT                   TFYLVLTQGTWFTIRGLQKSSSYYRKTNMLFVSNLQAKGKSHAHIIYLLSILLLAVFVT
FT                   TSVLYSSYYNVEENTEAVYPYSFQYISHPDNPIEKVQQDIEFIESTLEQTVGDFDAYQS
FT                   AFKTDEGRRIGFMSNTNFNALGTHQAITLNDNEYYVVAGNVGMIPNTDTIQDYVDDPLQ
FT                   YVGLEEGMILTTGFRAVYYVIPDAIYEALNYPEYHVFAYELKDWTEKRDVAEKIESQIM
FT                   TEPDERYVTSKISLYHDELFVKRIMFFIGFMLSLLFLSAAMSILYFYLQTSLAGEKEKY
FT                   LGIRKIGLSMKEMSVIVTRELSILIFVPFTIATILLFIVLFSIRDALSPAFFQMTTVGV
FT                   GIILLLFTLSFLIIRKAYLKKLVE"
FT   CDS_pept        299527..300042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0277"
FT                   /note="BH0277"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03996"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03996"
FT                   /db_xref="GOA:Q9KG38"
FT                   /db_xref="InterPro:IPR023774"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KG38"
FT                   /protein_id="BAB03996.1"
FT                   /translation="MDNRYPIGQFNCPSEVQEKDIQMWIKEITTLPSRLHALTVSLDEL
FT                   ELTKTYRENSWNVRQLIHHISDSHLNGYMRMKLALTEDNPVVKTYEESEWAKLIDYELP
FT                   IRVSLQLLESLHERWTYLLKNLTATQLQRTYQYPDGSIMRIEQSIALYAWHGNHHLAHI
FT                   QQALIRTK"
FT   CDS_pept        complement(300527..300715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0278"
FT                   /note="BH0278"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03997"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03997"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG37"
FT                   /protein_id="BAB03997.1"
FT                   /translation="MRKMGLTLVLASIFVLVACNADENETESVDQNAEVEEVTEDELEQ
FT                   DQEEFEDVVEETDDEEE"
FT   CDS_pept        300898..301263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0279"
FT                   /note="BH0279"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03998"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03998"
FT                   /db_xref="InterPro:IPR006540"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG36"
FT                   /protein_id="BAB03998.1"
FT                   /translation="MKKIFFSVAAATFLALASQQALAAEPETVSEQEGVSNADVTPFET
FT                   VDAQSTVWIWSRGITNVTDTRKTAYSNYYHRDSPHRSAAQLGNDRAVSPLGGPGATTYA
FT                   SIRGNKNLPATFYRFTY"
FT   CDS_pept        301434..303575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0280"
FT                   /note="BH0280"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB03999"
FT                   /db_xref="EnsemblGenomes-Tr:BAB03999"
FT                   /db_xref="GOA:Q9KG35"
FT                   /db_xref="InterPro:IPR006541"
FT                   /db_xref="InterPro:IPR016976"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG35"
FT                   /protein_id="BAB03999.1"
FT                   /translation="MHAWSAAAYADFAVTIPRIDLLGPDIVLSVLEEAATHHQVNLLRD
FT                   VQLLGEGDKIALTTFALLTEKSPFLEAIPLRHGSRLTSEDTRDGDLILSSRRTKEDVEE
FT                   IKGTIQTLSQTHTRTVRPLHQFPNYVSPYATYQVEQAGTVTKEQFSATLADLFNHYLED
FT                   YVEELEPLTADDFAVQTEPSHVSTTFDPTFPKTLAWTLWGITGLMLMFYIMRNGKTVAI
FT                   YSMHGFSLFKIWRRLIGNACGVVFAVYLLFLPLLAFALFGWQPRYLFAAMVTGSWPFLL
FT                   LLAISFLFVFYSSRSSLIESIKNNTKTKLFLIVSQVAKVVALVSVIVFLLQIADRLTIM
FT                   EEVRNSMTDWAFGKDYGEFYPHSIGYDQEEMNQESGLWQTDISLTESLYPVLNAAGALY
FT                   IDAVLYEEEWLRMATEYSQEHIRSIRVNPNYLQAFPLVDENNKRIAIQEEETNRVLLVP
FT                   EQYKDQKEDIIAYFKEDYAYWATMPEYQAESYSHLQEQTFDIIWLASSQEVFSFNLYVF
FT                   PNEGNLIVDPIIQVLTENNSYPMERDFFRGSVGNDPLKVKLLDQNTAKTYEHYLPLLRD
FT                   LQLDDNAKHLVTVNEQAQKDISEIQRALTLDTILFVLTATIALFMIVQSSHLLFAQHKK
FT                   RFLLRRLFGHSLFRAYRNVLFWTLATWVVILGIALYRHSGTQYLAIVVLVLFLTEVVVT
FT                   SVVLMRLEQKNKVSVLKGE"
FT   CDS_pept        303579..304220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0281"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="BH0281"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04000"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04000"
FT                   /db_xref="GOA:Q9KG34"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR019895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG34"
FT                   /protein_id="BAB04000.1"
FT                   /translation="MAAAIVELTDISKSFHSETVLRDFNLTIDRGEMIAITGPSGSGKT
FT                   TILNIIGLLEKEDRGTVRLFGKNKPAYHSKQALQFRKSKIAYLFQNFALMDDETVSKNL
FT                   DVPLELINGSRTVKQQKKKEVLEKVGLFNKLNKKVHSLSGGEQQRVAIARLLLRPCDLL
FT                   LADEPTGSLDMANRNVILDLLCQLNKEGMTIVIVTHDPEVADRCDRVITL"
FT   CDS_pept        complement(304454..304741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0282"
FT                   /note="BH0282"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04001"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04001"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG33"
FT                   /protein_id="BAB04001.1"
FT                   /translation="MKIEHVAIWVKDLEAMKTFYVTYFNGHANSKYHNKDKKFESYFLT
FT                   FDGGARLEIMCQSGIDKPDQDDRMGWAHIAFSLGSKEAVNQMTGRLHNDG"
FT   CDS_pept        complement(304840..305637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0283"
FT                   /note="BH0283"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04002"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04002"
FT                   /db_xref="GOA:Q9KG32"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KG32"
FT                   /protein_id="BAB04002.1"
FT                   /translation="MMTTPIYVVDAFTNQAFKGNPAAVCVLPTSRDDIWMQHVASEMNL
FT                   SETAFLHPYQDGYSLRWFTPNTEVDLCGHATLASAHILWELDHISAEQPITFYTKSGIL
FT                   TASKRGEWIELDFPSEQPKQENVYPNELIDGLGIQPLYVGRNRFDYLIEIDSEQRLKEL
FT                   NPNFSLLEQIDTRGIIVTSKSTSTEYDFISRCFFPAVGVNEDPVTGSAHCCLGPYWQEK
FT                   LNKNEFLAYQASKRGGMLKIKLQHDRVFLLGQAVTVLRSELLL"
FT   CDS_pept        306123..307196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0284"
FT                   /product="nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /note="BH0284"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04003"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04003"
FT                   /db_xref="GOA:Q9KG31"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KG31"
FT                   /protein_id="BAB04003.1"
FT                   /translation="MQKVKEMIGSINELDTKAQQQMEQHLNTLTKPLGSLGLLESLAIK
FT                   IAGITGHTQPEIDPATVIVMVADHGVAAEGVSAYPSEVTQQMVHNFITGGAAINVLSRV
FT                   SNASVQIVDIGVNGTLQLPGLINKNVRHGTNNMAQGPSMEREEAIAAIEVGIEVAQAAI
FT                   QNGAKLLALGEMGIGNTTASSAMLAALEQVPVEQIVGFGTGLSHEGKEKKVAVIKRAIE
FT                   VNQPNAADPIDVLAKVGGLEIAGLAGIVLGAAAWRIPVLVDGFITAVAALTAVRIAPLC
FT                   VHYLIASHQSVEPGHVCVNKLLGLTPLVNLNLRLGEGSGTAIALPIVRSAIRIAHEMAT
FT                   FEQAGVSGAIEDVGKEK"
FT   CDS_pept        complement(307327..307866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0285"
FT                   /note="BH0285"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04004"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04004"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG30"
FT                   /protein_id="BAB04004.1"
FT                   /translation="MKSIYVIRHCEAEGQPPESPLTNKGLKQAIDLAAFFDNIKVERII
FT                   SSPYKRAIQTIQPLAKKLNVEIEINSQLTERVLSTNHLSDWFEKLRTTFEDFEIKFEGG
FT                   ESSQDAVKRILNVVEDSFTGEFENTLIVTHGNLMSLLLNHYNKEFGFDEWLNLSNPDVY
FT                   LLKIDNNEITSERLWS"
FT   CDS_pept        308253..309032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0286"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="BH0286"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04005"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04005"
FT                   /db_xref="GOA:Q9KG29"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG29"
FT                   /protein_id="BAB04005.1"
FT                   /translation="MASHGKLLEVQDLQKNYGKKNNLTKALKGVNFDILPGEFLGIMGP
FT                   SGSGKTTLLNCIATIIKPTSGRVLLHGKNISAFDSKDLAKYRGSRIGYLFQDFELLDNL
FT                   TGQENILLPLAIHGVDFTKARVKLDELASILDIADILHKFPSQMSGGQKQRVAAARCLI
FT                   SDPDIVLADEPTGALDTRSARTLMTKLESINRSSGRTILMVSHDPNAASFCSRILFIQD
FT                   GVIFHELRRKQEESREKFYERILTVLAQLGGGSANVL"
FT   CDS_pept        309022..311190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0287"
FT                   /note="BH0287"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04006"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04006"
FT                   /db_xref="GOA:Q9KG28"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG28"
FT                   /protein_id="BAB04006.1"
FT                   /translation="MFSKLIYRHAKRSRKENLIYFATLITAVASFYIILSLGKQDIILF
FT                   LREFESDAIDKLLALMPIVYLFALFLLFFLILFANQYQLNRRSKEFGLYLMLGMRKERL
FT                   VLQLIAEGFITSIFALVGGILIGGFLAEIISLTVSKLVGQGIIGHQMTLSLSAIFFTII
FT                   GFLFIQFVALVILGGRLFKQEVHQLLYEQMDKKTDMGHVKGNIIHLLIGVALLGMAYWS
FT                   VLAHFEELAGLLMFIALALGSLGTIFFMRGFAKILGFLAGLSERKSTKGLHTFTIRQFQ
FT                   ENIANRSTSVAVTSILITLSIILIADGASTILNSGSDLYNRESSVYDFTVNGESERVEE
FT                   FLTSENMVSYVEDLNLLEIGRMKGQGERLEDGMALSLVDWSKLREQIIMALPTSDQEQV
FT                   LSGEMQSYTISSENPEALNLFGVLEIDASAPYLIPESSYNGLLEAVGEQPLNLQSDEMA
FT                   LYFNPDFMPMDDLDRMPVLDQILEQAANEGQRLIRMDDQTVSIRPSTPMRGLVADRSVE
FT                   IHSAFIVPDPMFEQFVNTETYRSYWNFRIPQKVQEQHGLMKPMMEAKNVLTSAGFEFES
FT                   YLQNFGRKLFYVVAGSYTVLYMGFLFLIIACTVLALQFLTQMKQTGRRYLTLSMLGAKR
FT                   HQMKQSMQKQVLWTFLLPVSLACVSGVVGIKAMISFVMIHIEHQPLLYPIALAFACIII
FT                   VIVAIYGVAVARSADHEIDKLRWKRTID"
FT   CDS_pept        311225..311902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0288"
FT                   /product="two-component response regulator"
FT                   /note="BH0288"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04007"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04007"
FT                   /db_xref="GOA:Q9KG27"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG27"
FT                   /protein_id="BAB04007.1"
FT                   /translation="MTRIIVVEDDSWMREELIDVLQKEGFEAVAVTDFHDIAFQIATLA
FT                   PDLVLLDINLPEQSGFDICKTLKSKGIGPILILTSRDKLQDELHGLHLGADDYLIKPCN
FT                   RDRLLARIQNLLRRFKGQPDLIDGGKFSLDPNTFTLYKGSESLRLSENEGKLLLALVEN
FT                   KPGIVSKSTLSERLWGTDEYIDENALQVNLTRLRKTLRPLNLEDEIETIRGQGYRLRGQ
FT                   LKP"
FT   CDS_pept        311899..312939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0289"
FT                   /note="BH0289"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04008"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04008"
FT                   /db_xref="GOA:Q9KG26"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG26"
FT                   /protein_id="BAB04008.1"
FT                   /translation="MRGIKQIYDCLYAYKLGFLLLIITNLLFIFFAWLAYPETFKVLVG
FT                   LMIVFTLATLSLSIFIIVRKQNIIEAAFQEFLLEPNEMNEERLCRVSPKTHWSCIRDMG
FT                   SSIRSYQAELNEQVMELADYENYIEGWVHEIKKPLSLMTLVLDNRRDEMSSLVRHRMLH
FT                   IRDQMLGDVERILYFARLGAAHKDYMFEPINILAFCKQTVEHHQTLLDESGFQVQFIGE
FT                   EMEIFSDRKGLAFIVEQILANSTKYAAANQDKPIIKFEAHYDKGKDQRILTIRDNGPGV
FT                   SEEDLPFIFDKGFTGRRGAYTRQATGMGLFLVSKMAYDLAIQVDAKSELGSGLTISLIF
FT                   PRVNEA"
FT   CDS_pept        313335..314240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0290"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="BH0290"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04009"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04009"
FT                   /db_xref="GOA:Q9KG25"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG25"
FT                   /protein_id="BAB04009.1"
FT                   /translation="MKLEIKSVTKKYKEKTAVHDFSMDLLSGECVGLIGPNGAGKTTLI
FT                   KMITNILDPTRGDILLNGKRISEMKREIGYLPQYPDFYQWMTASETLLFMGQLSGISKK
FT                   KLTKSIPEILSKVGLRGEENSKVSTFSGGMKQRLGIAQALLHKPSFIVMDEPVSALDPI
FT                   GRREVLNIIEEIKKDSTILLSTHILADAEEICERLVMIKNGEKIEDTTMMELLNRNSKN
FT                   KIRVEITDESKDWIEVVKKLNYVQDVEVTGNKVNVEVKNIELHKNMLLANALKHDVNIV
FT                   KFELDHDTLEELFLKLVVGE"
FT   CDS_pept        314237..315019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0291"
FT                   /note="BH0291"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04010"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04010"
FT                   /db_xref="GOA:Q9KG24"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG24"
FT                   /protein_id="BAB04010.1"
FT                   /translation="MNQLTILAKKEMVQFVREFKVVWLPLVFIFLGITQPVVTYYLPSI
FT                   LDALGGGQGITIDSSMTAQHGSEVLASTLGSQFDQLGIMIMVLSMMGIVQSDKANGMLA
FT                   FILTRPVTVGTYVSGKVLSTFMFIASSVTLGYIASYMYTYFLFTSIPFTDLMVTLLFYL
FT                   LWVAFIVSFTTMVSTMFNSQGVIACISIVVLLGCRMIVGLNPILDHLNPASMSKHAMEV
FT                   LVSGTFNSSVIGSIVATLLLSALAIHISNMWISRRNKV"
FT   CDS_pept        315455..315988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0292"
FT                   /note="BH0292"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04011"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04011"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG23"
FT                   /protein_id="BAB04011.1"
FT                   /translation="MDYHSKQLSISIEQSKLLGSALRVKILHALEDVPKTAKQVADQLG
FT                   QTPGNIHYHIQRLYEGQLIDLIETKEIGGIVEKYYRAKSTWFNLKSDSKSVSGDASATR
FT                   ITTRLLLTTEQLEQFQSDLRDVLDQWGRKSPQDDWEGLLEYAVDISLREVNHEEPIMKE
FT                   NDEESSDEGKCIED"
FT   CDS_pept        316031..317287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0293"
FT                   /note="BH0293"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04012"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04012"
FT                   /db_xref="GOA:Q9KG22"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG22"
FT                   /protein_id="BAB04012.1"
FT                   /translation="MSLELSKEIEQPQSQGLSSLLRNQKFLLLWVASIFSGLSFSIYFL
FT                   TKSWYVVDELGLKTFLGVVLMAMTVPRVLLMMIGGVLADRFRRSTIMFCSLITRSVLLF
FT                   GMFILQFLGVINIWTLIGFAFCIGILDAFFWPANYAILPSIVKKDHLTRANSFLQSTNH
FT                   LTLIIGPMIAGWLITITAYEWIFVTIMCLLIIGAILIFRVKEPFDKPETKRLPSPLKDL
FT                   TEGYSYLRHSPVLLSLMWMSVFVNFFITGPGTMAIPLIVEERLKGDPLELSYLESTIAG
FT                   GLILGAIMIGIINLRSKRGLLIIIRLTVMGVAIALLGQVVSLWQAIFVLAILGMGISIG
FT                   DIPARAVVQEKTDFDKIGRVMGMMSTASSGLIPLSYGMTSVALSLNLSISSILLYCGSF
FT                   VILFSFFVLWKFDKLRSLE"
FT   CDS_pept        complement(317511..318014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0294"
FT                   /note="BH0294"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04013"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04013"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG21"
FT                   /protein_id="BAB04013.1"
FT                   /translation="MIRSYFLKPQYDVGLSVADSTFDQYFFPTNHIEEARKWLPLGQPI
FT                   FLGTFRMFIEDEPLFDRVYIDSIDSFWFGMLSALEALQTETEASFPFTYQPFDFQLKRN
FT                   EQTLTLLLSHDSSELERCAVPLSTMNMLLTGAEEFFQDCHAIGLTVIDAEYQEITQRIE
FT                   RLKK"
FT   CDS_pept        complement(318033..318620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0295"
FT                   /note="BH0295"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04014"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04014"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG20"
FT                   /protein_id="BAB04014.1"
FT                   /translation="MQRRQRSVYAVFTVLFAFLLLAPHFGQGHVQASTYSWNIYSQYIE
FT                   YQPTGERFYHKSCGQVNNATQGYFRLPNTYSSTNIAQYDVGNGRSVELDFGSCSTYGMT
FT                   HILARHAPELFIGNPTQVQSFFNPGHPLGYYESIIGQIISNNRTQILNNGFTSNGTVVY
FT                   GNTPHGQVRLVIKGGKVITMYPNGWGLGERKY"
FT   CDS_pept        319027..320919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0296"
FT                   /product="PTS system, beta-glucoside-specific enzyme II,
FT                   ABC component"
FT                   /note="BH0296"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04015"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04015"
FT                   /db_xref="GOA:Q9KG19"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG19"
FT                   /protein_id="BAB04015.1"
FT                   /translation="MNYEQVAKQIIDHVGGEENVKSLVHCATRLRFSLIDHSKADKEQL
FT                   LKTDGVIAVKENGGQFQVVIGNRVPEVYAAIGKISTILDDTTSTKKGGDTGNSGNFVSR
FT                   LIDVVASIFTPLLGVMAGAGILKGLLAIATNVGWLDSGETTYIILHAASDSMFYFLPIL
FT                   LAVTAARKFETNPFGAATIAGALIYPSIVELHDSAIDVTFFGIPVVLMNYTSTVFPILL
FT                   AVFAMSYVEKFCNKKIHEAVKNFVTPLILLVVIVPVTLIILGPIGVYLGNGIASVIQEI
FT                   FTFSPVLAGAIVAGIWQVLVIFGIHWGIIPIILNNLSVRGEDVIKAVAAPAVFSQAGAA
FT                   LGVMLRTKNKKLKALAGSTSITALFGITEPAVYGVTLPLKKPFIMAVISAAVGGAIVGH
FT                   YGSVAVAPGAPGLLTIPIFYPEDGRGFVAFVIAIIISFVLAAVLTYIVGFKDPVDDEDT
FT                   LSNESGSENEVKREDDKKEPSASEEIKSPLKGEVVPLTEVQDHVFSSGAMGKGVAVRPK
FT                   EGRLVAPINGTVTSLFETKHAIGITSDNGTEIFIHVGIDTVQLKGEHFTSFIEQGDEVA
FT                   AGDVLLEFDVERITAAGYDVITPVLITNAKQFSNVQTTDKREVTSEDLLIHVIK"
FT   CDS_pept        321047..321880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="licT"
FT                   /product="transcription antiterminator (BigG family)"
FT                   /note="BH0297"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04016"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04016"
FT                   /db_xref="GOA:Q9KG18"
FT                   /db_xref="InterPro:IPR001550"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG18"
FT                   /protein_id="BAB04016.1"
FT                   /translation="MKVVKVYNNNVVSVLNEQKQELIVTGRGIGFQKKRGDELEEEKID
FT                   KVFSLKDRAVSEKFKSLLYEVPMEYMEVTEEIISYAKEKLAKDLNDSIYISLTDHINFA
FT                   LERFQNGITISHGLLWELRRLYKEEFAIGMEALRIIKDRLGIELPEDEAGFITTHIINA
FT                   ELNEGMPNISNITKVVHDLLNIVRYHFKMEYDEDSLTFFRFVTHLKFFAQRLLSGTSLN
FT                   SKDDFLLQIVKENHSEAYDCTLKIGEFLKAQYHYELTKEEQLYLTIHIERVVNRK"
FT   CDS_pept        321985..322152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0298"
FT                   /note="BH0298"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04017"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04017"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG17"
FT                   /protein_id="BAB04017.1"
FT                   /translation="MSDDKKRQKTVFRDNQEVVPEGSLPGDREDRSDKMGRSNSEELRY
FT                   KNADHIYDEY"
FT   CDS_pept        322341..323258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0299"
FT                   /note="BH0299"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04018"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04018"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG16"
FT                   /protein_id="BAB04018.1"
FT                   /translation="MNISFIASNTLHELAAFLEKLNNIREHHVGFCGEKGSEIKATLER
FT                   DFSDIGVSKSFIVGYDGMEIKGAVGLDVDTKEESAEVWGPFVDEDDPEMWLDTATILWQ
FT                   QLIDSLTVPVSTFQFFINQHNVNAKKFILKLNGMEKGDHDILTCDRTQFYPPLNHDVRL
FT                   FTNNHTQSFKKLHDSLFPQTYYDAEEILKKINEPTNKLLIIEKEQIVIGYAYVEVEPEH
FT                   GEGQIEYIGIAPDYRRQGLATQLLTNALHVLFSYPTVEDITLCVSKQNTKAIRLYQAAG
FT                   FKKERQLTYFELNVDGLDNRRGRG"
FT   CDS_pept        323261..323557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0300"
FT                   /note="BH0300"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04019"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04019"
FT                   /db_xref="GOA:Q9KG15"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG15"
FT                   /protein_id="BAB04019.1"
FT                   /translation="MKAKSIYLSLTGSFILLATIVLVRLVYIEAQKPRHLSTPSSDPNP
FT                   YLIVLIPITLWSVGAIIWELTKKDMPRFLGFLCVGIGLLVQVCFVGCSLIALL"
FT   CDS_pept        323907..324896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0301"
FT                   /note="BH0301"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04020"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04020"
FT                   /db_xref="GOA:Q9KG14"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG14"
FT                   /protein_id="BAB04020.1"
FT                   /translation="MVAKMIHELIEDALPNVSIESKRSVRKALINRKLSVNSLTISAND
FT                   IFECVIEFATQEEVEQELVSWVKKEVQLDEDLVEEYMITLLTRTKKGESELAVSSDRFS
FT                   HEMATEPAIQVDEASQWMPKKKQRSNRLYLVGTISILLLCLIGLPSILSDNVMGNTSDY
FT                   EVDKIVKSTVYETKVRMVNGLPTNLQYQPIDDVKLRGWLEERDSLLAEEPYFSTILEVA
FT                   DEFNIHPLLLFAITGQEQGFVPSSHTHADEMANNPFNVFHSWEDFNSTILESSQIAART
FT                   IVNLSKDRPEDVDPIQWINRKYAEDPNWWKGVSAIFNQLESAVQETEE"
FT   CDS_pept        324899..325066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0302"
FT                   /note="BH0302"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04021"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04021"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG13"
FT                   /protein_id="BAB04021.1"
FT                   /translation="MENGWRERKALGDRKQTTFVWRLASEAERMFFSYAWILRFISSII
FT                   ESIFENDYHY"
FT   CDS_pept        325134..325688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0303"
FT                   /note="BH0303"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04022"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04022"
FT                   /db_xref="GOA:Q9KG12"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG12"
FT                   /protein_id="BAB04022.1"
FT                   /translation="MYIQSHLANVIKERRSIKNGYLDQEVPLELVEQLLEVAVWAPTHG
FT                   LREPWRFIFVSSEQKETFVAQLVQTFPKEMQENRRNYFSQPAAFLIVVMQEDPRQKQWE
FT                   EDFGAVSSLIQNFQLLAWEQKLGVVWKTNPHIYDPKVRDLVGVAPGEKIVGFLHLGYFD
FT                   EVPKAMPRTSVKEKLTVYDGK"
FT   CDS_pept        complement(325741..326106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0304"
FT                   /note="BH0304"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04023"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04023"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG11"
FT                   /protein_id="BAB04023.1"
FT                   /translation="MTTPFTINHIEIPAPDLAKGIQFYSTLFNWEFEVLSENEYAFFKI
FT                   GDTGTGGGLDATLQPANEKQGVQFVISVDDIPTKLKKIEESGGAITKEKTEIPGGLGFY
FT                   ACFVDPNGNHVQMHCME"
FT   CDS_pept        326360..327214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0305"
FT                   /note="BH0305"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04024"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04024"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG10"
FT                   /protein_id="BAB04024.1"
FT                   /translation="MKLLVTGATGQLGSLVVEALLKTVPAENVAVSVRDPKKAEHLKAQ
FT                   GVDVRQGDFTQPESLVSAFAGVDKILIISSAPGDRVAQHKAAIQAAKENNVRFIAYTSI
FT                   ANAQDNPFFIAEDHRETEKAIVESGIPYSFLRNNWYLENEVGTIQAVASGAPWLTSAGS
FT                   GKVGWAPRRDYADAAAAVLTGEGHEHTTYELSGHPLTQEELAQVVSDALGRDVEVQQVD
FT                   DATYEQAMSGAGIPEEVLPFIVGIQQGIREGYLNVVSGDFEKVLGRPLTPLKDAVREIL
FT                   NEK"
FT   CDS_pept        327296..327727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0306"
FT                   /note="BH0306"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04025"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04025"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG09"
FT                   /protein_id="BAB04025.1"
FT                   /translation="MKQISSRFSIAVHILTFIASVREGCTGDFIAGSVNSNPVIVRNIM
FT                   GMLKKADLIGVRPGVGGAYLKKDADEITLLDVYRAVDVIGDDQLFGFHNPKIECEVGRI
FT                   IENTLREELKQAQEAMEQRLQLVTIQQLLDQPEVNMLQT"
FT   CDS_pept        327857..328069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0307"
FT                   /note="BH0307"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04026"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04026"
FT                   /db_xref="GOA:Q9KG08"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG08"
FT                   /protein_id="BAB04026.1"
FT                   /translation="MTAIKEFISSFLLVISWLFFAMSAYLFYWVIVFTLAAIIPFLAML
FT                   SVGLCCFYISKKLDSGRESKPANGT"
FT   CDS_pept        328100..328645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0308"
FT                   /note="BH0308"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04027"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04027"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG07"
FT                   /protein_id="BAB04027.1"
FT                   /translation="MIKLIKEMDDKLAYWEVWEDWEDEKALIVHYGFVGETGETEEVEL
FT                   ESYAQGEEVMEALAEEQLKEGFQSLDEEALIELVVQYSYEESEIEATLEKRQFVEELMD
FT                   QCLGWTGNGMCDGGDIGRGTANIFNYVIDVEKALNTILKELTKHQLLANVKLAYLNEAD
FT                   EYVPLYPEGTDFVLIPQG"
FT   CDS_pept        complement(328708..329724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0309"
FT                   /note="BH0309"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04028"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04028"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG06"
FT                   /protein_id="BAB04028.1"
FT                   /translation="MTKQTYYLFMILMIFSLAGCNQDVKQVIIEIPYKEYNHPVVLGDN
FT                   MFVNVNRDANNLFDVDALIQYNMKTGEEKILYESEYEESAMQSTQVNEDWLVWVDSSVD
FT                   GYYEKILAMNLANGEIQTLAETNPEYLTLLTPSLYKEYVAWTELNDEMQVEVKLHNLET
FT                   NETISVGNINEYSLYHAFVHLHDNKLLWTDSDNGNGYYYLYDLESKSTDKYQAPKRYPG
FT                   YATYSNGKIFAIHFDNNDWTMQDFGYLDLKTNEYHSLEHGQYISTFDSSNDRLAILDDE
FT                   HHFYFYEFQDDELVPLEVTIMEEINPMHIFFDPEGHLIIYIDDEEDTDHSRVGVIYP"
FT   CDS_pept        complement(329789..330079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0310"
FT                   /note="BH0310"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04029"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04029"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG05"
FT                   /protein_id="BAB04029.1"
FT                   /translation="MQDFGYLDLKTNEYHSLEHGQYISTFKTYNDRLAILDDEHHFYFY
FT                   EFQDDELVPLEVTIMEEINPMHIFFDPEGHLIIYIDEEDDTDHSRVGVIYP"
FT   CDS_pept        330255..331427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0311"
FT                   /product="transposase (04)"
FT                   /note="BH0311"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04030"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04030"
FT                   /db_xref="GOA:Q9JWQ4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWQ4"
FT                   /protein_id="BAB04030.1"
FT                   /translation="MSTSIGQSTFENQLDSMVREFVKEKLETIMKEEMESFFTHEHPEL
FT                   KNQKNGFYTRQLDTRYGRLENLRVPRDRQNAFQTELFSPYQRREEWLGEAIITMYQKGV
FT                   STREIGHFIEKILGHSYSASTISQVTDVVTEDITQWQQRPLKKRYSVLYLDGTYLKLRR
FT                   EDVANEVVYLVVGVTEEGYREILGFYVGGQESANGWRNILLDLYSRGLEEVLLGVFDGL
FT                   AGLEEAMKAVYPKADVQRCVVHKVRNALHAVRKKDQPAVAQDFKPIYQANTYEEAKNRF
FT                   KEFKENWQKRYPKVVATWEKDLDVLLTFLSYPSTIRPMIYTTNIIERTMKEIKKRTKTM
FT                   NSLPNEKAAEKIVYLQAIDYNERWATRRLRGFGEAYEALQEMFKQRYSGP"
FT   CDS_pept        complement(331924..332196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0312"
FT                   /note="BH0312"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04031"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04031"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG04"
FT                   /protein_id="BAB04031.1"
FT                   /translation="MTKQIYYLFMILMISSLAGCNQGTKQVIIEIPYKEYNHPVVLGDN
FT                   MFVNVNRDASNLFDVDALIQYNMKTGEEKILYESEYEESAMQVHK"
FT   CDS_pept        complement(332264..333100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0313"
FT                   /note="BH0313"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04032"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04032"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG03"
FT                   /protein_id="BAB04032.1"
FT                   /translation="MNPYKKWTKLLTVSALFTVLFASPTISLANDGEANDETEGHTGAM
FT                   LNDPSLTPSLDAELEALAKEKDQWLEETLKEDMRINTVTEGEFYTISVSNYKQENGYYC
FT                   GPASARQTLSFHKSKSGSSTSLPSQSTLASKIGTTSSGSTTSGIASGLNSYKSTFGFSS
FT                   NPYVAADITNVSSPKSTFETRVKGVIKNKTNAPIVLMQTKHLERYDGKNIRHYNTISGY
FT                   SYEYSSGKKRMRTVDPHYDAKYRGIQWDPIGSTSSRGVFRAVYEADKAGSNKAMAY"
FT   CDS_pept        333342..333479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0314"
FT                   /note="BH0314"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04033"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04033"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG02"
FT                   /protein_id="BAB04033.1"
FT                   /translation="MAFNLVFNRINRELKISPPDVEISIFETSKYNRALGDYLGMNELQ
FT                   "
FT   CDS_pept        333594..334307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0315"
FT                   /note="BH0315"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04034"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04034"
FT                   /db_xref="GOA:Q9KG01"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG01"
FT                   /protein_id="BAB04034.1"
FT                   /translation="MFLKRIELQREKVLSFQEYPFSIPAIKHFQRLELKSRVTFFVGEN
FT                   GSGKSTLLEAIADKCEFNTAGGGRNNYYEVDASESALGDYIRLSWLPKVSNGFFLRAES
FT                   FYHFASHVDEVDARHAYGGRSLHHQSHGEAFLSLFANRFNRKGIYLLDEPEAALSPRRQ
FT                   LSFLAILHDLVSSGDSQFIIATHSPILLGYPHATILSFDHGTIEETTYEQTEHYQLTRY
FT                   FLENRERMLRELLGE"
FT   CDS_pept        complement(334358..335296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0316"
FT                   /note="BH0316"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04035"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04035"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KG00"
FT                   /protein_id="BAB04035.1"
FT                   /translation="MENRRIVIITGANSGIGKEAAQRFANEGDHVIMACRNIAFSRKVQ
FT                   HDIIAASGNDHVDLLELDVSSFASIRTFCTTFNSQYKRLDILIHNAAYFNHGEPYRLSP
FT                   DGIELTFATNVFGPYLLTSLLRDRLKQSEDPRILHAGSNIIKHFFDPKQTFDLDLLQGN
FT                   HGTKSYSVYKMYCQSKMALMLLTFQMAEVFADDGIKVNALQINGAKMSKRTIQKVKPWW
FT                   RPIAWGQNLFFPPPSYMADKYFTICTSDKYKQTTGKLFNDKLEIMEPSPTHYPGFFKQM
FT                   KLLLGSNVYPAYENTNIREKLWALCKELVGE"
FT   CDS_pept        complement(335323..335895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0317"
FT                   /note="BH0317"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04036"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04036"
FT                   /db_xref="GOA:Q9KFZ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFZ9"
FT                   /protein_id="BAB04036.1"
FT                   /translation="MPPKKKFTKEDIIDSAFSIAKTEGIDKITIRKVADHLGSSSAPIY
FT                   VNFEDVEELKHAVVQKIVQLSQQMIQKQKTGNPFRDIGLASLQMAKEYPVFVHDFMMKP
FT                   NEYLQDYDEGMDLIQLMKQDPELEGFSEDELMTILLKMRAFQLGLTMMVANDLLPEDFT
FT                   MENIIKLQDSLAEDVLTAARVRKEKDL"
FT   CDS_pept        336139..336594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0318"
FT                   /note="BH0318"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04037"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04037"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFZ8"
FT                   /protein_id="BAB04037.1"
FT                   /translation="MRETLSQFEKNIDEILALKEIDDTVLCEPLSEGKWSIREIVGHLY
FT                   YWDKFILEKMVPLMGEGGNLPGFPEHDQHNEDAILFLKEYSVESIIDHFVATRKELTRE
FT                   MKNLAEDIRFTIGGGKRQFSGESFLKIFLKHDAHHIKQMKEKGLRQK"
FT   CDS_pept        336893..337219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0319"
FT                   /note="BH0319"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04038"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04038"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFZ7"
FT                   /protein_id="BAB04038.1"
FT                   /translation="MGLFGWRLINSSSPAVNDLEHHIKGHIFRPSNIGSISIGSQGFLF
FT                   GYVNQKEVESIRFQTDEFEYLLKVKDYFWLIPVDETYLEFKDEQLSVILKNGEEIFYPF
FT                   KEVE"
FT   CDS_pept        337293..337910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0320"
FT                   /note="BH0320"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04039"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04039"
FT                   /db_xref="GOA:Q9KFZ6"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFZ6"
FT                   /protein_id="BAB04039.1"
FT                   /translation="MSLLEVTEALCAHGPNDRPFIVGIDGLGGAGKTTFVKKLSRELKN
FT                   WHHEVIVLPLDDYIVETKKRYETGYEEWYEYYYLQWDIRLLETELFKKLRNNSTDLTLP
FT                   YYDRATDTIMPQHIHLTSSTIVLIEGVFLQRDEWRDYFDYVLFIDCSREVRAERVLNRD
FT                   LYIGDYQTRVNKYKNRYWLAEEHYIKSVEPKKKADGLYSTRT"
FT   CDS_pept        337997..338281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0321"
FT                   /note="BH0321"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04040"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04040"
FT                   /db_xref="GOA:Q9KFZ5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFZ5"
FT                   /protein_id="BAB04040.1"
FT                   /translation="MKEILFTNPVTILSFMAIFSGLGLATTGATTVNSFSLVLGVFLGS
FT                   ALWWLLLSSLAGAVEHRMKKRSLHVIHRVSGLMLLGFGVWSLGNWLMGV"
FT   CDS_pept        338459..339337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aadK"
FT                   /product="aminoglycoside 6-adenylyltransferase"
FT                   /EC_number="2.7.7.-"
FT                   /note="BH0322"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04041"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04041"
FT                   /db_xref="GOA:Q9KFZ4"
FT                   /db_xref="InterPro:IPR007530"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFZ4"
FT                   /protein_id="BAB04041.1"
FT                   /translation="MRTEQEMMDVILTIAKKEERIRAVYMNGSRTNSNVPKDLFQDYDI
FT                   VYVVTDIAPFIQEQQWLKKFGEPLMIQEPDQLDAGIGVNRDFSRRYAFLMLFTDGNRID
FT                   LTLQTKETMREVYENDTLTVPLLDKDHCLPPIPPPSDSDYHVKEPTEGEFISCTNNFWW
FT                   CLQNVAKGIWRDELPYAKQMFELTTRASLDEMVNWWIGLENDFQLSTGKLGKYFKKHLP
FT                   PPYWAMYEATYANSDYEQMWESIFIACDLFRTLAKDVAAACSFTYPETDDRNMTDYLHR
FT                   VKNLSADATDM"
FT   CDS_pept        complement(341065..341622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0323"
FT                   /note="BH0323"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04042"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04042"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFZ3"
FT                   /protein_id="BAB04042.1"
FT                   /translation="MKDYHKLFKKYLRRKKQLVFTRDDVERILISKFKAREIPNEYMIK
FT                   LKFHDHLDENYIYKCFVIDDPVILNKWYSAAEKKEHREEIIDNRLNPFDFNQLKTKEDH
FT                   ILTHINIDEHEGRRVNVILESKDGKHVTEFIVRECEKIGRYINALIIAGEIEAGLLTYK
FT                   EDPEDEYFQWYLENLEMFGFLD"
FT   CDS_pept        complement(342016..342567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0324"
FT                   /note="BH0324"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04043"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04043"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFZ2"
FT                   /protein_id="BAB04043.1"
FT                   /translation="MDEKHINITSYISNHDGEKGFLTSKTLEDISIKDPEAKKAAEETL
FT                   VCGDYMYLPGYIDIKINGYTILGEEDWTDDIVSEWESICDFIVKSKENDPHEIFIFGHH
FT                   NRYYFELTNNLIQIKVNRDYIRSGLEIFTHYKDIPYVEFKKAAKKAAEEFYSFCKDLPF
FT                   GEEASFDSFVETYELLRKVD"
FT   CDS_pept        complement(343827..344399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0325"
FT                   /note="BH0325"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04044"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFZ1"
FT                   /protein_id="BAB04044.1"
FT                   /translation="MKYRIHVLISLIAIILAGCQAEPDTAIEPEKPKETVQEQEPSTEK
FT                   YQSIREFQDTFNGENLKNDTLLISIEEDQLTLSMEIALTEELLSKIQNTANDFYYHFAD
FT                   LDGSDEISKALVELPEPVDGHLLIDSLDKDNNRMTVKQELTLKDDLTDNQLDFLKQPEN
FT                   YEFQTLDENKVPVHVIIGIDVSTFDTL"
FT   CDS_pept        344950..345699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0326"
FT                   /note="BH0326"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04045"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04045"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFZ0"
FT                   /protein_id="BAB04045.1"
FT                   /translation="MELGTPIAEGNTAKIYLVENRVVKVFKGHLPDTEAANEARKQKYA
FT                   HSCGLSVPEIFDVTEVNGKQAIMMEYINGKTMGEILFENKEQAEYYMSISVGIQHQIHS
FT                   KVADSLEPMSEKLSRQIKAAPGLSNNQRSALLKRLETLSIDNRLCHGDFHLYNLIKTNN
FT                   KVTIIDWVDASVGDMCADICRTYLLYSQFSAELADMYLHLSCKKRGLSQADIFQWAPII
FT                   AGARLSETVISEKAERLIEIVKHHFPR"
FT   CDS_pept        347483..348859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0327"
FT                   /note="BH0327"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04046"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04046"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR007522"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFY9"
FT                   /protein_id="BAB04046.1"
FT                   /translation="MKSSKRVPNLTFEKLEETLNTLKERADKTKESLNISIITHMFGGG
FT                   TKAGQVDKEIPVRSTSIRGNLRFWWRATRGAMYPNVKSLKEAEAKIFGDTNRPSAVKIS
FT                   VSETGDAKWAPILERKNNRRLHSSLSKYKYVLFPFEDRKRDKHQDHTDYLNTDSPYTFT
FT                   LHLEYIQFEVDNINIRDEVHAALWAWINFGGLGARTRRGCGSLYCKSFSPPKDTQTPEA
FT                   LKQWFADRVKKYKIKVDSTSRKEWPTLQQIFIKSSNSKLLSPLQAWQFVVFHYSQFRGL
FT                   SNGKRGRSHWPEPDSIRHMTRMAEEDHKTSVTIEKEDANIAFPRAQFGLPVIFQFHSKD
FT                   RQDPFPTILKPRGKDRLASRLIIKAVGVSERSAFPIVVTLNQPEIEEVELSLMKEVKTE
FT                   EQKEVKEQLDKYKGKLKRDVVYPKNLNYQKYPMKESTSAVEAFIKKGGSIWERALPEKP
FT                   "
FT   CDS_pept        348829..350643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0328"
FT                   /note="BH0328"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04047"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04047"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013407"
FT                   /db_xref="InterPro:IPR024615"
FT                   /db_xref="InterPro:IPR038242"
FT                   /db_xref="InterPro:IPR040942"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFY8"
FT                   /protein_id="BAB04047.1"
FT                   /translation="MGARPSRKTLMLFSIGPVQEFIAQARKTRDLWFGSHLLSELGKAA
FT                   AFKLSKLEAHVIFPYVENLEKLDAKEKEKINSPNRVMALVDTSEPKAVALEVKAAVIEK
FT                   WMSYANGARRLLGRDINPALWKRQVKDLIEFHAVWMDCKEEAHYAEVRQKAEELLAARK
FT                   TLRDFKPNQPSHMYGEVKSSLDPGRECVLEKHQYKRYAPYGIKKDESLDAISLVKRLSF
FT                   HLSPNTRHFPSVCDVAFSQLRRKIEKDNLLTDLAKNYQEWVWNKYPKLKKRLFSDLFDS
FT                   RLFYVTHIKEMVEGAYPNKNEQEQIIKLIAQKLESFYKETKLNSTPYYAFLVCDGDQMG
FT                   KALRNLKNIEDHQAFSKKLSEFAAKARKIVTTDKRDEGELVYAGGDDVMAYLPLHRCLD
FT                   VAAKLQQLFGELMNEALPKEAVRPTLSVGIVIAHMMEPMSEVRKLAMAAEKQAKRKRNE
FT                   LAIFFQKRSGGDRMRFSVSFDTEPTRNIKKILKFYYRNVMSVGIAHAIQSLHTEYSGLL
FT                   QNQLVMSEERLEKLLEQEVSRLVWKKRSSGIDDETVKSFETCILGLMRKGKGSPLERLD
FT                   RLVQQMMVAIQLEKAGDFTDATDSNSST"
FT   CDS_pept        350603..351874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0329"
FT                   /note="BH0329"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04048"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04048"
FT                   /db_xref="InterPro:IPR010165"
FT                   /db_xref="InterPro:IPR019117"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFY7"
FT                   /protein_id="BAB04048.1"
FT                   /translation="MILPMRQIRIRPLDPLMVRDGRPFKDSPGARAYSMMDVVPGVIAG
FT                   TVRTMLAEQAAKSSRVVDYHTFSKVPVYGPLYVWKGKPFFPLPSDIGFYEDENGALQMN
FT                   YRQPQPLVNGQGYLGIGDKGDHESLWPAKVIPQMGKVSSIVPAYLSLDWMSRWLRGDLS
FT                   PKSWTSPLAEWQQLVRDNKLDSTDKDVHFLPPFALDERDHIAVEAGTRMAKDQALFTTQ
FT                   SIVFPPDLDMHARVEIPQEAAWPMQLSTLHSLGGKRRLAHFSESQDDQFWQCPEALEQS
FT                   LDESQYVRLVLATPAYFAKGWKPRWLDDELCTNEIFAKEISREVKLQLVWACISRWQPV
FT                   SGWSYSLKQPKAVRRMVPAGSVYFFKVTEGNPRELARRGWLNTVSDANRRKGAFDKEDG
FT                   FGLALWGTWRPDENDIDSEKECEV"
FT   CDS_pept        351874..352785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0330"
FT                   /note="BH0330"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04049"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04049"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013410"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AJZ6"
FT                   /protein_id="BAB04049.1"
FT                   /translation="MELNSSQLFFVHCLSPVHIGTGEGVGLIDMPIMRERVTKWPLIPG
FT                   STTKGVHRDYFVQQRDKESWIRTAFGAGKGEADAEGNAGSIVMSDARILAFPVASYYGT
FT                   FAYVTCPMVIKRLERDMGAANVSYFSNLIEKVEGWEKKLSTNEDKALIGHRCEVTDENN
FT                   EKIYLDEFELSVVIDGTFGELTNSLAKLVFKDDHFSQELLASRLVLVSDESFQYFVTQC
FT                   SEITPRIRLKAEEKVVDDGALWYEEYLPTETLLYGLIWCEKMDQVKESWKRLSKGRVLQ
FT                   VGGNATVGRGRVRYLYTGGDYS"
FT   CDS_pept        352782..353159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0331"
FT                   /note="BH0331"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04050"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04050"
FT                   /db_xref="InterPro:IPR010160"
FT                   /db_xref="InterPro:IPR023101"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AJZ5"
FT                   /protein_id="BAB04050.1"
FT                   /translation="MKSLDAHYANIALQSIQELEKSDEAFKTSFGSLCHQFPSMVRLNG
FT                   LRLTVAFYESKKENTAHARYLAGLKAALGVSISANDIPERGAEYRRMTEQALRASIWFK
FT                   RYAEAILKCSPTSEPVREGDV"
FT   CDS_pept        353156..353902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0332"
FT                   /note="BH0332"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04051"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04051"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR010172"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFY6"
FT                   /protein_id="BAB04051.1"
FT                   /translation="MNAYLTLTKYKGSQKKSDLLKQIDNPDGKSAFFEQAILDFGNYWG
FT                   TKNVSWYKQRYAAYEGHIKSSSDTNTSFFLKSSFPLIIGQGNPSILETHLTLHPIYGIP
FT                   YLPGSLIKGVTAHYCHQVLGKEDSKFKQGEEYALVLFGSQEQAGAIHYHDALPTPKSIK
FT                   NCLSLDVITPHHQSYNQGLNQAPRDDDSPVPVPFLTVKADFRVILSCEDLAYAEWLNIA
FT                   QKIVSHAVTEMGIGGKTNAGYGKMEV"
FT   CDS_pept        354282..355127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0333"
FT                   /note="BH0333"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04052"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04052"
FT                   /db_xref="GOA:Q9KFY5"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFY5"
FT                   /protein_id="BAB04052.1"
FT                   /translation="MDNKQSQLNEKLVDLSDEIHILTNETTKNESSTSDEILDFLKQEY
FT                   TNYREFANSDRESFMNLVNVFFVSLGILVTGGIIILYWIFGQTRNEVQESADLTIKKSV
FT                   SEIEENAERQIKSLLPPKLKNIEEKFTELQRFMDNQHKLRNSKVLVLTPENKKEEMEKL
FT                   EVRRIREIVGEVDVSTLGNLGYFKGKLENKKIDLIVYRYEKLENAAQENKIREYIKILK
FT                   KNNSRIPIVIYTKSKLEGEDESSVNSYYYSTFANMPVTLTTNMISLLSIISYEKKIEEN
FT                   "
FT   CDS_pept        356399..356683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0334"
FT                   /product="transposase (05)"
FT                   /note="BH0334"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04053"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04053"
FT                   /db_xref="GOA:Q9JWP9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWP9"
FT                   /protein_id="BAB04053.1"
FT                   /translation="MTKRPRRSYTKEFKDQIVQLHVSGKPRAEIIKEYELTPSAFDKWV
FT                   RQHQNSGSFEEKDNRTPEQEELIRLRKENQKLAMENDILKQAALIMGRK"
FT   CDS_pept        356725..357510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0335"
FT                   /product="transposase (06)"
FT                   /note="BH0335"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04054"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04054"
FT                   /db_xref="GOA:Q9JWR5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWR5"
FT                   /protein_id="BAB04054.1"
FT                   /translation="MCDVLQMARSTYYYEAKIRDDQDEELSELIVDIFKNSRDNYGQRK
FT                   IKIELRKKGWTVSRRRIGRIMKEQGLVSKYTVAQFKPAKTSCNESEIGNTLNREFNQEQ
FT                   ELKVVVSDLTYVRVQQKWHYICVLVDLYNREIIGYSAGPHKSAELVQRAFASVKYNLQR
FT                   LELFHTDRGSEFKNKLIDQALETFGIERSLSEKGTPYDNAVAEATFKTIKTEFVRGAVF
FT                   SSQQELDLELFDYVHWFNTIRIHGSLDYLTPTEYKLMNL"
FT   CDS_pept        358059..360461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0336"
FT                   /note="BH0336"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04055"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04055"
FT                   /db_xref="GOA:Q9KFY4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFY4"
FT                   /protein_id="BAB04055.1"
FT                   /translation="MYIAHIREVDKVIQTLKEHLCGVQCLAETFGAKLRLQHVAGLAGL
FT                   LHDLGKYTNEFKDYIYKAVFEPELAEKKRGQVDHSTAGGRLLYQMLHDRENSFHEKLLA
FT                   EVVGNAIISHHSNLQDYISPTIESNFLTRVLEKELPEYESAVERFFQEVMTEAELARYV
FT                   AKAVDEIKQFTDNSPTQSFFLTKYIFSCLIDADRTNTRMFDEQAREEEPTQPQQLFEHY
FT                   HQQLLNHLASLKESDSAQKPINVLRSAMSEQCESFAMRPSGIYTLSIPTGGGKTLASLR
FT                   YALKHAQEYNKQRIIYIVPFTTIIEQNAQEVRNILGDDENILEHHSNVVEDSENGDEQE
FT                   DGVITKKERLRLARDNWDRPIIFTTLVQFLNVFYAKGNRNTRRLHNLSHSVLIFDEVQK
FT                   VPTKCVSLFNEALNFLKEFAHCSILLCTATQPTLENVKHSLLKDRDGEIVQNLTEVSEA
FT                   FKRVEILDKTDQPMTNERLAEWVRDEAPSWGSTLIILNTKKVVKDLYEKLEGGPLPVFH
FT                   LSTSMCAAHRKDQLDEIRALLKEGTPFICVTTQLIEAGVDVSFKCVIRSLAGLDSIAQA
FT                   AGRCNRHGEEQLQYVYVIDHAEETLSKLKEIEVGQEIAGNVLARFKKKAEKYEGNLLSQ
FT                   AAMREYFRYYYSKMDANLNYFVKEVDKDMTKLLMSHAVENSYVTYYQKNTGTHFPLLLN
FT                   GSYKTAADHFRVIDQNTTSAIVPYGEGQDIIAQLNSGEWVDDLSKVLKKAQQYTVNLYS
FT                   QEIDQLKKEGAIVMHLDGMVYELKESWYSHQYGVDFKGEGGMDFMSF"
FT   CDS_pept        360504..361214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0337"
FT                   /note="BH0337"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04056"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04056"
FT                   /db_xref="GOA:Q9KFY3"
FT                   /db_xref="InterPro:IPR010155"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="PDB:4F3M"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFY3"
FT                   /protein_id="BAB04056.1"
FT                   /translation="MRNEVQFELFGDYALFTDPLTKIGGEKLSYSVPTYQALKGIAESI
FT                   YWKPTIVFVIDELRVMKPIQMESKGVRPIEYGGGNTLAHYTYLKDVHYQVKAHFEFNLH
FT                   RPDLAFDRNEGKHYSILQRSLKAGGRRDIFLGARECQGYVAPCEFGSGDGFYDGQGKYH
FT                   LGTMVHGFNYPDETGQHQLDVRLWSAVMENGYIQFPRPEDCPIVRPVKEMEPKIFNPDN
FT                   VQSAEQLLHDLGGE"
FT   CDS_pept        361216..363099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0338"
FT                   /note="BH0338"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04057"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04057"
FT                   /db_xref="InterPro:IPR010144"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFY2"
FT                   /protein_id="BAB04057.1"
FT                   /translation="MSWLLHLYETYEANLDQVGKTVKKGEDREYTLLPISHTTQNAHIE
FT                   VTLDEDGDFLRAKALTKESTLIPCTEEAASRSGSKVAPYPLHDKLSYVAGDFVKYGGKI
FT                   KNQDDAPFDTYIKNLGEWANSPYATEKVKCIYTYLKKGRLIEDLVDAGVLKLDENQQLI
FT                   EKWEKRYEELLGEKPAIFSSGATDQASAFVRFNVFHPESIDDVWKDKEMFDSFISFYND
FT                   KLGEEDICFVTGNRLPSTERHANKIRHAADKAKLISANDNSGFTFRGRFKTSREAVGIS
FT                   YEVSQKAHNALKWLIHRQSKSIDDRVFLVWSNDNSLVPNPDEDAVDIMKHANRELERDP
FT                   DTGQIFAGEVKKAIGGYRSDLNYQPEVHILVLDSATTGRMAVLYYRSLNKELYLNRLEA
FT                   WHDSCAWEHRYRRDEKEFISFYGAPATKDIAFAAYGPRASEKVIKDLMERMLPCIVDGR
FT                   RVPKDIVRSAFQRASNPVSMERWEWEKTLSITCALIRKMHIEQKEEWGVPLDKSSTDRS
FT                   YLFGRLLAVADVLERGALGKDETRATNAIRYMNSYSKNPGRTWKTIQESLQPYQAKLGT
FT                   KATYLSKLVDEIGDQFEPGDFNNNPLTEQYLLGFYSQRRELYKKKEEETNQ"
FT   CDS_pept        363096..363947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0339"
FT                   /note="BH0339"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04058"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04058"
FT                   /db_xref="GOA:Q9KFY1"
FT                   /db_xref="InterPro:IPR006482"
FT                   /db_xref="InterPro:IPR013418"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFY1"
FT                   /protein_id="BAB04058.1"
FT                   /translation="MTILDHKIDFAVILSVTKANPNGDPLNGNRPRQNYDGHGEISDVA
FT                   IKRKIRNRLLDMEEPIFVQSDDRKADSFKSLRDRADSNPELAKMLKAKNASVDEFAKIA
FT                   CQEWMDVRSFGQVFAFKGSNLSVGVRGPVSIHTATSIDPIDIVSTQITKSVNSVTGDKR
FT                   SSDTMGMKHRVDFGVYVFKGSINTQLAEKTGFTNEDAEKIKRALITLFENDSSSARPDG
FT                   SMEVHKVYWWEHSSKLGQYSSAKVHRSLKIESKTDTPKSFDDYAVELYELDGLGVEVID
FT                   GQ"
FT   CDS_pept        364072..364596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0340"
FT                   /note="BH0340"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04059"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04059"
FT                   /db_xref="GOA:Q9KFY0"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFY0"
FT                   /protein_id="BAB04059.1"
FT                   /translation="MHKKADQPFMKEKRGSKLTVRAMPIQSKNLQISGICDVVEFVQDS
FT                   EGIELSGVSGSYKAFPVEYKRGKPKKGDEDIVQLVAQAMCLEEMLVCRIDKGYLFYNEI
FT                   KHRVEVPITDALRDKVVQMAKEMHHYYENRHTPKVKTGPFCNNCSLQSICLPKLMNKRS
FT                   VKRYIEGRLSE"
FT   CDS_pept        364593..365624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0341"
FT                   /note="BH0341"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04060"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04060"
FT                   /db_xref="GOA:Q9KFX9"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019856"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFX9"
FT                   /protein_id="BAB04060.1"
FT                   /translation="MKKLLNTLYVTQPDTYLSLDGDNVVLLKEQEKLGRLPLHNLEAIV
FT                   GFGYTGASPALMGYCAERNISITFLTKNGRFLARVVGESRGNVVLRKTQYRISENDQES
FT                   TKIARNFITGKVYNSKWMLERMTREHPLRVNVEQFKATSQLLSVMMQEIRNCDSLESLR
FT                   GWEGQAAINYNKVFDQMILQQKEEFAFHGRSRRPPKDNVNAMLSFAYTLLANDVAAALE
FT                   TVGLDAYVGFMHQDRPGRASLALDLMEELRGLYADRFVLSLINRKEMTADGFYKKENGA
FT                   VLMTDEARKTFLKAWQTKKQEKITHPYLGEKMSWGLVPYVQALLLARFLRGDLDEYPPF
FT                   LWK"
FT   CDS_pept        365633..365923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0342"
FT                   /note="BH0342"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04061"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04061"
FT                   /db_xref="GOA:Q9KFX8"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="PDB:4ES1"
FT                   /db_xref="PDB:4ES2"
FT                   /db_xref="PDB:4ES3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KFX8"
FT                   /protein_id="BAB04061.1"
FT                   /translation="MLVLITYDVQTSSMGGTKRLRKVAKACQNYGQRVQNSVFECIVDS
FT                   TQLTSLKLELTSLIDEEKDSLRIYRLGNNYKTKVEHIGAKPSIDLEDPLIF"
FT   CDS_pept        complement(368881..369525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0343"
FT                   /note="BH0343"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04062"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04062"
FT                   /db_xref="GOA:Q9KFX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFX7"
FT                   /protein_id="BAB04062.1"
FT                   /translation="MSTIFLDYQVEIFITMEVLTVICLLLFGVTRYYFNIRKASLLFIL
FT                   LFIGITALEAALAWWLYNKTGEISTLQIIITVFVLYAITFGIGDFKKLDRWMRQKIGGW
FT                   KGIDLLTEKDRQLMSLQKDPAYVARSYRRSSYIHIALFVTAQMIFISMGTDSLSESLAY
FT                   VKDWSWIEHGTYEQSPYPNETIYSIAMLWGIIFVVDTIYSWSYTVFPKKPS"
FT   CDS_pept        370055..370138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0344"
FT                   /note="BH0344"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04063"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04063"
FT                   /db_xref="GOA:Q9KFX6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFX6"
FT                   /protein_id="BAB04063.1"
FT                   /translation="MTVFEALMFAVAFATLIIAVLSFHEKK"
FT   CDS_pept        complement(370443..370793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0345"
FT                   /product="transcriptional regulator (phage-related)"
FT                   /note="BH0345"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04064"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04064"
FT                   /db_xref="GOA:Q9KFX5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFX5"
FT                   /protein_id="BAB04064.1"
FT                   /translation="MAELKDRLRELRNAHNLTQQEVASFLNITESAYGFYEQGRNEPSI
FT                   GKLKQLAQKYNVSIAFLAGETDAKEPYANSSVHEHPLSYKYKDLDDEELRFLDEQLELF
FT                   RRLKREKEEKSQ"
FT   CDS_pept        370954..371232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0346"
FT                   /note="BH0346"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04065"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04065"
FT                   /db_xref="GOA:Q9KFX4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFX4"
FT                   /protein_id="BAB04065.1"
FT                   /translation="MRRREKLISFRKGKNWSQQDVVDLLKVRYDVSITESYYGMIEQGV
FT                   RMPSLTVAIAVSHLFQVEPSVLFGVPRRKAHDPNFSKIRNGFDKRDE"
FT   CDS_pept        371363..372913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appA"
FT                   /product="oligopeptide ABC transporter
FT                   (oligopeptide-binding protein)"
FT                   /note="BH0347"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04066"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04066"
FT                   /db_xref="GOA:Q9KFX3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFX3"
FT                   /protein_id="BAB04066.1"
FT                   /translation="MNKIWVFVAVVLLLVGCGGNQDEVGSSESETDSNDEADRTLTIAI
FT                   GTDIVSFDIHDHNNTSTEAVHDNMFNYLFKRDENNVIQPELVETFESIDDRTVEMTLKE
FT                   GVTFHNGDPLTSEDVKFTLERVATDDTLQEYPNYKQIKEVEIKDELTFRVITHEPEPSL
FT                   FHRLSRLGSGILPKTYIEEEGWDHFLANPVGTGPYQFKEWVRDSKIVLTPYENYFEGAV
FT                   DEWDEVVFRVIPENSTRVAELLTGGADIAVNIPSADWERVEENEGTSMKTETSNRTIML
FT                   ILRATEGYPTADVRVRQALDLAIDNKAITENVLRGGGIPTKTRVAPGNFGAEESLYNTY
FT                   DYDVEKAKQLLKEAGYPDGFEMTLHSPHGRYLQDAEVAEMIAGMLQAINVEVRLEFMEW
FT                   SNFVEMRQAGENKDAYLIGLGNSMFDGAYSVDWHRSDRFVGETDYKNEEIDALLEASAV
FT                   NMDEEERAKQIQEIQRIAAEEVPHIMLHQETLHYGVSDRIAFVPSMDEMIYVPAITRK"
FT   CDS_pept        372962..373879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appB"
FT                   /product="oligopeptide ABC transporter (permease)"
FT                   /note="BH0348"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04067"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04067"
FT                   /db_xref="GOA:Q9KFX2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFX2"
FT                   /protein_id="BAB04067.1"
FT                   /translation="MAAFVFKRLAEMIPVLFIISFIVFALVFVAGNPVALMLPEDASQE
FT                   DIDQLTASLGLDQPFLVQYGKYLLNLVQGDFGESFRYNTSALPLVLERLPATLELAVAA
FT                   LVLAVAMAIPLGVWSATKQHSPVDLLAAGGSVIGKAMPNFWLGIMLILIFSVMLGWFPV
FT                   SGRGTLGHLVLPAMTLATGIAAEITRLLRSSMIEILNQDYIRTARSKGIREGMVVYKHA
FT                   FRNSLIPLVTIVALQTSTVVGGTLITETVFSWPGLGQLLIQAVHTRDMAIVQACVFVIA
FT                   ILVIFMNLVADVLYRLLDPRIKYE"
FT   CDS_pept        373896..374813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appC"
FT                   /product="oligopeptide ABC transporter (permease)"
FT                   /note="BH0349"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04068"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04068"
FT                   /db_xref="GOA:Q9KFX1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFX1"
FT                   /protein_id="BAB04068.1"
FT                   /translation="METETTVTRLMRQSRAMGSKRLLAWGRRLIRSKTGTVGLIIVLVV
FT                   LLLAAFADVLAPHNPHEVNPAMMLKPPAWLDGGSSEHFLGTDHLGRDIWSRMVYGSRIS
FT                   LLVGVTAVVLAGLIGVTVGMVAGFYGGWLDTAFMRLVDSFLSIPNILLALVILSVFGPG
FT                   VWTLIFVLGVTNWVNYARLVRGEVLSIKEREFVKAARAIGVKNRMVMVRHLLPNVVSPF
FT                   IVISTLSVATTIILEASLSFLGLGIQPPDISWGGILSDGRDYIATSWWLATFPGLAITL
FT                   TVLGIIFLGDWLRDVLDPRGQSRR"
FT   CDS_pept        374826..375815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appD"
FT                   /product="oligopeptide ABC transporter (ATP-binding
FT                   protein)"
FT                   /note="BH0350"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04069"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04069"
FT                   /db_xref="GOA:Q9KFX0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFX0"
FT                   /protein_id="BAB04069.1"
FT                   /translation="MKKDTLLSVRELKTYFYTESGAVPSVNGVSFEVKHGETVAVVGES
FT                   GCGKSVTSLSIMGLVRSPGKIVGGDIRFNGQDLTTISEREYRKLRGNELSMIFQEPLTS
FT                   LNPLFTIGNQLGEVILQHQQVTKEEAKQKGIEMLKKVGIPRAEQVYRSYPHQLSGGMRQ
FT                   RVMIAMALACEPKLLIADEPTTALDVTIQAQILQLMRKLVKENDTAILLITHDLGVVAE
FT                   MADTVIVMYAGQVVEQADVFTLFATPAHPYTQGLLASTPNIHASGEKLQSIEGTVPTHE
FT                   TMPKGCRFFPRCLHATEQCVHQEPPLMKTGRGQHVRCWLFDGKEAASG"
FT   CDS_pept        375812..376810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appF"
FT                   /product="oligopeptide ABC transporter (ATP-binding
FT                   protein)"
FT                   /note="BH0351"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04070"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04070"
FT                   /db_xref="GOA:Q9KFW9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFW9"
FT                   /protein_id="BAB04070.1"
FT                   /translation="MKEVLLEAKGLTKHFDVSEGFFKRKKAVLRAVDGVDLTIYAGETL
FT                   GIVGESGCGKSTLGQLLMRLLEPTRGTLSFAGSDFLALKGEALRQKRSDIQIIFQDPFS
FT                   SLNPRMTVREIIGEPLKTHRLAKGNDLIKRVDELMDAVGLDRSYAKRYPHEFSGGQRQR
FT                   IGIARAIALKPKLIICDEPVSALDVSIQAQILNLMVRLQKEFQLTFLFIAHGLPAVKHI
FT                   SDRMAVMYLGKVVELASKDALFAQPMHPYSEGLIQAVPIPDPTVRNDKKWVTLEGDLPS
FT                   PVHPPSGCRFHPRCPYAQDKCTVQEPALTEKEPGHFVACHFPLEKTRKDLM"
FT   CDS_pept        376811..377935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0352"
FT                   /product="carboxypeptidase G2"
FT                   /note="BH0352"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04071"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04071"
FT                   /db_xref="GOA:Q9KFW8"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFW8"
FT                   /protein_id="BAB04071.1"
FT                   /translation="MDIGDKGEMLSLLKALVNIDSGSYYKEGVDRVGRMLTNAFKQIGF
FT                   KVAIFKQERYGDHLLFTHPHAFDPKILLVAHMDTVFPVGTAAARPFQLIGTRAYGPGVI
FT                   DMKGSLVACLYAIKALVGAQSPAVKQVAVLMTSDEEIGAPSGREIIEKIGVGKKAVLVM
FT                   EPARKDGSLVTARRGGGRYTLNVTGRAAHSGVEPEKGRSAIEELAHKIMKLHALSDYKS
FT                   GISVNVGVIEGGTAVNTVADRAKAKVDIRISRLEQAEPLDRDIRRICGTPDVDGTTIEL
FT                   KGGITRPPMERNAQTVALFQLIQQVASTIGLELTETATGGSSDASFTSALGIPTIDGMG
FT                   PVGGFPHSEKEYLRVDTMQERTLLLAKVIERLSE"
FT   CDS_pept        379095..379688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0353"
FT                   /note="BH0353"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04072"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04072"
FT                   /db_xref="GOA:Q9KFW7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFW7"
FT                   /protein_id="BAB04072.1"
FT                   /translation="MAKPNVVTKEELIEAAKRCIVEKGIHSLTLKSVAEGAGVTQGTVY
FT                   YHFRSKDQLMLEIVESMCTSAWHSLESMSKQEGENTHWIQAALHSAHDRTTKDAYFHKL
FT                   LASLIVTGFTNEQIRQKLEKLFQFENQVLKEQMAAVLGDHELHGVSLEVWSVLFNALID
FT                   GLAIQALVAENTDIDGLYHHLHLLVNKLLEASRA"
FT   CDS_pept        379726..379980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0354"
FT                   /note="BH0354"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04073"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04073"
FT                   /db_xref="GOA:Q9KFW6"
FT                   /db_xref="InterPro:IPR020509"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFW6"
FT                   /protein_id="BAB04073.1"
FT                   /translation="MFFLLWGVLVWLGATGVFKLAGHFFFSPENPTLMILSYLLVIPLI
FT                   LVLTLPLYKWKQLNDHEKLKAAIFIALPGMLLDVIVMVT"
FT   CDS_pept        380035..380775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0355"
FT                   /note="BH0355"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04074"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04074"
FT                   /db_xref="GOA:Q9KFW5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFW5"
FT                   /protein_id="BAB04074.1"
FT                   /translation="METNALDVNKQSWDQAAPRFFARNPLPEYGPLAPSEEELHLFGDV
FT                   DRLKVLEIGCGSGHSLKYLDEKQAGELWGIDLSTKQIEAAQTVLKDSKAPVTLFESPME
FT                   VNPGLPTDYFDIVFSIYALGWTTNLTKTLENVYRYLKPGGSFIFSWEHPMYNRVRQHQH
FT                   GLTVDKSYHEEGAYAHEAWSSPAIMQQYRLSTYLNHLIDHGFKVERVIEDVCLADAQKH
FT                   TNGWYGYEKAQMIPTTLIIKCLKQ"
FT   CDS_pept        381124..382296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0356"
FT                   /product="transposase (04)"
FT                   /note="BH0356"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04075"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04075"
FT                   /db_xref="GOA:Q9JWQ4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWQ4"
FT                   /protein_id="BAB04075.1"
FT                   /translation="MSTSIGQSTFENQLDSMVREFVKEKLETIMKEEMESFFTHEHPEL
FT                   KNQKNGFYTRQLDTRYGRLENLRVPRDRQNAFQTELFSPYQRREEWLGEAIITMYQKGV
FT                   STREIGHFIEKILGHSYSASTISQVTDVVTEDITQWQQRPLKKRYSVLYLDGTYLKLRR
FT                   EDVANEVVYLVVGVTEEGYREILGFYVGGQESANGWRNILLDLYSRGLEEVLLGVFDGL
FT                   AGLEEAMKAVYPKADVQRCVVHKVRNALHAVRKKDQPAVAQDFKPIYQANTYEEAKNRF
FT                   KEFKENWQKRYPKVVATWEKDLDVLLTFLSYPSTIRPMIYTTNIIERTMKEIKKRTKTM
FT                   NSLPNEKAAEKIVYLQAIDYNERWATRRLRGFGEAYEALQEMFKQRYSGP"
FT   CDS_pept        382797..383321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0357"
FT                   /note="BH0357"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04076"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04076"
FT                   /db_xref="GOA:Q9KFW4"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFW4"
FT                   /protein_id="BAB04076.1"
FT                   /translation="MARKHLLTEAHLHRKQLRRMAVVGISIALVGGLPLAIVGAHSWEL
FT                   SPIATGLIQAIHIMSGIAGGCAYAALFGLLGPVVNRSALAIRALVALGKRSFTFYVFNE
FT                   TMLVLLLSPVALGLGGGLHSTGAAVTAILIWLTAVGLAFLLEKKNMRGPLEVLLRWLLD
FT                   RNAPKLKQTQA"
FT   CDS_pept        383442..384767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoE"
FT                   /product="short-chain fatty acids transporter"
FT                   /note="BH0358"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04077"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04077"
FT                   /db_xref="GOA:Q9KFW3"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFW3"
FT                   /protein_id="BAB04077.1"
FT                   /translation="MKYMISLSNRLMQRYLPDPFLFVVLLTFLVFALSLIFTESTPLTI
FT                   VQYWGEGFWGLLSFSMQMVLVLVTGHVLASSPLFKKGLGALAGLPASPGQAILLVTVVS
FT                   LVASFINWGFGLVIGALFAKELAKKVDNVDYRLLIASAYSGFMIWHGGLSGSVPLTIAT
FT                   PDHFAQDMIGVIPTSETIFAPYNLAIVFALFIAIPLANRLMMPGKSDTVTVDRSLLDDG
FT                   RDLQAASLELEAMTPSDRLENSRMISLLVGVLGLVFLGYYFATNGFELNLDIVNSLFLF
FT                   LGILFHGTPKLFLKAVTSAVKGASGIIIQFPFYAGLMGIMVSSGLATVMSEAFVSFSNE
FT                   VTFPLFVFLSAGIVNVFVPSGGGQWAVQAPVVLEAAQSLGVPAAKAAMAVAWGDAWTNM
FT                   IQPFWALPALAIAGLKAKDIMGFCVMILVVSGVVISLGFLLM"
FT   CDS_pept        384858..385604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0359"
FT                   /note="BH0359"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04078"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04078"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR041496"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFW2"
FT                   /protein_id="BAB04078.1"
FT                   /translation="MQVGTIFGHKNSEGTLVSSAAIIPYESKLASIGMVIVSSQCRGLG
FT                   LGREVTEACIKATLEDTTLMLIATDEGRPLYERLGFAAVERIHKHLCDDYKEPESIPSM
FT                   DVTIEELRSNDFRQLVQLDEGAMGVRRSRFLKQRTTQANQSLVAKDKAGNVIGYGLSIL
FT                   GPIHLIIGPIVAPNHEIACLILDRLACQHKGKLRMDVPSGHHTFLQHLQRRGFTEVNTP
FT                   PVMAKQSAYEPRRNGTLFAIAAQVFG"
FT   CDS_pept        386066..386893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cah"
FT                   /product="carbonic anhydrase precursor"
FT                   /EC_number="4.2.1.1"
FT                   /note="BH0360"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04079"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04079"
FT                   /db_xref="GOA:Q9KFW1"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="InterPro:IPR036398"
FT                   /db_xref="InterPro:IPR041891"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFW1"
FT                   /protein_id="BAB04079.1"
FT                   /translation="MKKYLWGKTCLVVSLSVMVTACSSAPSTEPVDEPSETHEETSGGA
FT                   HEVHWSYTGDTGPEHWAELDSEYGACAQGEEQSPINLDKAEAVDTDTEIQVHYEPSAFT
FT                   IKNNGHTIQAETTSDGNTIEIDGKEYTLVQFHFHIPSEHEMEGKNLDMELHFVHKNEND
FT                   ELAVLGVLMKAGEENEELAKLWSKLPAEETEENISLDESIDLNALLPESKEGFHYNGSL
FT                   TTPPCSEGVKWTVLSEPITVSQEQIDAFAEIFPDNHRPVQPWNDRDVYDVITE"
FT   CDS_pept        388026..393011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0361"
FT                   /note="BH0361"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04080"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04080"
FT                   /db_xref="GOA:Q9KFW0"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFW0"
FT                   /protein_id="BAB04080.1"
FT                   /translation="MKTLKHISYKLRIFALIALLISQTLLTSLSLPFQAVANSEKSGLT
FT                   NVEITDANGQTIDADQFPDRFVSIDSILQIILSWSVDESVAQGAEYSLNIPSALVVSSH
FT                   GGVLTTTDSQEVGTYEVKDNGEVTLQVNEKGNGTLIVEAAFNKDEVHGKSEVPLTFHLD
FT                   DETRTITVPFTVEEKTEEAVEPASESETEATIEQHKEDEEEEMVALTTQSTEASGSEIT
FT                   ENILTSVQLKDEEGNLIHANENPDLRPALGSAVEVIYNWKLRNNHGYTAGSTFTFQLPD
FT                   AFRFYNNIENEPLVFTQANTTVGSFNVTTDGTVTMTFNESIEQLSNIRGNLHLWTEFRE
FT                   DLQGDRLQVIHFEAKDEVIASIPVEFENATGHSIDKRGVVDQTFNATEIKWTVDFNKQL
FT                   QPIEQAILKDPIQTGQALRAGSIKVYELNVQLDGSVVQGAEVDPSSYTIEQVDGNDFQI
FT                   VFGSIDSAYRVEFITDITNRNATYYMNRATLTGENIDDLSADAGVWTHRGTPLSKASTG
FT                   YDPATQTITWEIKYNYDGKLIRQADAVLTDLFTNSHILLDDSMKVYRVTINEHGNEVST
FT                   EEVSNYSVNGTSDEDHNGFVLQFTEDVQDSYKIIYQTTAAERGFEDATIENTVTTGDHE
FT                   AKTSRTVHQQTFNKWRGQIDYAKKTVAWEYFFNEERQELTNVIISDVFANGGLTLIEDS
FT                   FTITSFPSTDEEVTLENGNDYRVVTNETGFTIEFMAPITEPHHVRYETTFDFDARDDKN
FT                   KAFLENGATLQWQTSSGNTMKKEGKSEFHPDTFTRNNGFKNGLYNATSKEITWNIGVNY
FT                   NLHTLEHAIVEDFVREGQRLLMDSIEVYEMGLLGWWDGVSQGSKLEEGTDYVIEAVEDG
FT                   EGHPGFQVRFLNTIDSAYWITFKTSLEDTLIKSNYPNRATLKSDNAEDFNVDASVSVRH
FT                   GGEFVTKSGAQNGRLIDWSLNINFSQSSISNAKIVDEPSVNQILLEDTFRLYATNVQPN
FT                   GTMTKGDELERDKDYTLDIRTDGEGNQHFELQFTEDIDTGYILEYQSFINARNGDVVTN
FT                   NVKLEGDQLTTEEVTESSGAVSVRLSGGAGTGSGETGSLEVTKVDADTGEVLQGATFTL
FT                   YDSEGEFAIRTLETGEDGKATFVNLLYGDYLLKEDSAPEGYLVGINDTQRVTIDTVLHE
FT                   VTVENEKSDINRVSAVGAVQLQKVDEETGESLQGALFALQQKVDDEFVTIAEMETDEEG
FT                   IVFAGSLEPGDYQFVELNAPVGYKLDETPVVFTVEEDRTETIELQKENHLIPGSVQLVK
FT                   VDADDAANTLEGAEFTLLDGEGNVVQEGLTTDENGQVVVTDLKPGEYQFVETKAPAGYE
FT                   LEATPIGFTIERNQQEVATVAVENHLIPGSVQLVKVDADDAAITLEGAEFSLLDGEGNV
FT                   VQEGLTTDATGQVVVTDLKPGEYQFVETKAPAGYELDATPIGFTIERNQQEVATVAVEN
FT                   HLIPGSVQLIKVDREDSAVTLEGAEFSLLDEEGNVLREGIRTGENGQLMVIDLKPGDYQ
FT                   FIETKAPTGYELDDTPIAFTIEKGTDEVLTLVFENKLTPEVPESPENPENPENPENPEI
FT                   PEDLETPESPENPETPESPKHSEDSEVPNSDKNPEKSSDSNNRIDRLPQTGEEFLTFLL
FT                   ILGLLLMTAGGVLLLKRRNVAEC"
FT   CDS_pept        393026..393589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0362"
FT                   /note="BH0362"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04081"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04081"
FT                   /db_xref="GOA:Q9KFV9"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042000"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFV9"
FT                   /protein_id="BAB04081.1"
FT                   /translation="MNKTRKILGVMLLLTGLILVSIPLYYEWQHGREVRALEEALSLIS
FT                   DYEQVEGTSFTTDELNAVLELEIPSIELKQKVLSETTEENLKLALTQLKENQHPGEGNF
FT                   AIAGHRGYRGNRHFSRLPDVTIGDEVFLHTKEETFVYKVTDISIIEPTDVDILDDRDGK
FT                   HEITMITCTRSGKQRVAVRGVLVG"
FT   CDS_pept        393706..394680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0363"
FT                   /product="quinone oxidoreductase"
FT                   /note="BH0363"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04082"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04082"
FT                   /db_xref="GOA:Q9KFV8"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFV8"
FT                   /protein_id="BAB04082.1"
FT                   /translation="MKAIVVTAFGGPEHMMWEDVSTPVIKENEVLIKVVKTSVNFADIK
FT                   ARYGRKGGTLPFIPGLDAAGYVEKVGREVSDIQVGQRVIAFPKSGSYAEYVVAAESLVF
FT                   PIPDEINFRTAAASPIVSFLSHRLLYNVAQMERGESVLVHAAAGGVGTTAIQMAKLLGA
FT                   GTVIGTVGSADKITAAKESGADEVICYEEEDFTKSVQEMTNGVGVDIILDSVSGSVTEK
FT                   SLQCLARYGRLVHFGNSSGAIGTIKTIDLHASCRSVLGFSLGTTRKCKPHLLKETARHV
FT                   LPYLASGKLKVHIGHEYRLTDAANAHRLMESRLNRGKILLNVE"
FT   CDS_pept        394809..395009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0364"
FT                   /product="transcriptional regulator"
FT                   /note="BH0364"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04083"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04083"
FT                   /db_xref="GOA:Q9KFV7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFV7"
FT                   /protein_id="BAB04083.1"
FT                   /translation="MKNNVKQTRMNMSMTQEQLARKVGVTRQTIGLIEKGEYNPSLQLC
FT                   VAIAKNLHKTLDDLFWEVDEG"
FT   CDS_pept        395006..395464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0365"
FT                   /note="BH0365"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04084"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04084"
FT                   /db_xref="GOA:Q9KFV6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFV6"
FT                   /protein_id="BAB04084.1"
FT                   /translation="MKSWISVLLPKDEYKKQKYLYFISEGALITLIFLFLLFIGSRYLR
FT                   VNVQIETALLLPIAVFTFYVMTRVILAGIEHADIATEKAYKKERRLIFVRLASFVMIFL
FT                   PLYVLFVGMPEGGEWFDILGVVTVVVAGWWLCSYVSLKRSYRKNKELA"
FT   CDS_pept        395900..396835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0366"
FT                   /note="BH0366"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04085"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04085"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFV5"
FT                   /protein_id="BAB04085.1"
FT                   /translation="MKTKPIDLYILSGFLGSGKSTLLKRLIEQEQARGNKIGVLMNELG
FT                   EVSVDSSIVPKDTPLKEMLNGCICCTIQGELSAQLQSFIEEYELDVIFIEATGAAHPLE
FT                   VVEACTHPVFAGQVRVRGVLTVVNARQWIEGKMSIKIKKLMEAQVTFADLIVVNKVDQV
FT                   TDAQVEQLTTSIKDLNPKAINIPTTFSNLEPVHSERLHHAAAPSSRGSESKAHVHEHLH
FT                   LRTMAVPIQHPVDRMELLSFLKGIQGQIYRVKGFIHLKESPGLFLFNYAYGDPMFERHR
FT                   TDQAYAPVLVFIGDDLDHQAIEEGLQQLQQ"
FT   CDS_pept        396871..397260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0367"
FT                   /note="BH0367"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04086"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04086"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFV4"
FT                   /protein_id="BAB04086.1"
FT                   /translation="MATWNLTKTKHHVLICNGSSCNKAGAEQLTRSIRAEIMAKGLDPI
FT                   IHTTRTLCNGRCQDKCVLITYPSGHWYKEMSSEDAPRFVDSLLSGRRVEEKISHTFNGE
FT                   AFEPTEGTVLGVEKDQELVRRVSKL"
FT   CDS_pept        397287..397820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0368"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="BH0368"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04087"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04087"
FT                   /db_xref="GOA:Q9KFV3"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="PDB:4XJC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KFV3"
FT                   /protein_id="BAB04087.1"
FT                   /translation="MILSGKTISEKLTEKELEITPLTEEQIQPASVDLRLGPHFVTIDD
FT                   SKEAVISFERPIRYREWTTSDETIVLPPHTFLLATTMETVKLPNHLTAFVEGRSSVGRL
FT                   GLFIQNAGWVDPGFNGQITLELFNANRLPIELPIGRRICQLVFAEVTGEVAPYQGKYLF
FT                   QKGATMSEIYKDAF"
FT   CDS_pept        397887..398336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0369"
FT                   /product="nitrogen fixation protein"
FT                   /note="BH0369"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04088"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04088"
FT                   /db_xref="GOA:Q9KFV2"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFV2"
FT                   /protein_id="BAB04088.1"
FT                   /translation="MLEHLYRQLVIDHAKKRRNHRRISGEHVQQTHYKNPTCGDVITLY
FT                   VELQGHHVDDIAFVGEGCSISMASASMMTELLKGVSLEEASSMRHAMERMIRHGEISSD
FT                   VDLGDALSLEGVHKLRGRHNCALMAWQALDRVIGHETTYEPVARS"
FT   CDS_pept        398654..399172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0370"
FT                   /note="BH0370"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04089"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04089"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFV1"
FT                   /protein_id="BAB04089.1"
FT                   /translation="MEKSPLVHEGGRSVTFLKQGVDEKGAYLLVEHRMMQQGAVNGPHW
FT                   HPVLQETFTVKEGQMRFVIDGEEKFVEAGEQVTIEPKQVHQFWNMSEERLVAIHEVRPP
FT                   GNHWAMFELLHKLEVEGKVNQKGIPTNPLWVGVAWELMDGYIKGPPLLVQKVVFGGLAK
FT                   LAKIFGYYR"
FT   CDS_pept        399433..401031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0371"
FT                   /note="BH0371"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04090"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04090"
FT                   /db_xref="GOA:Q9KFV0"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFV0"
FT                   /protein_id="BAB04090.1"
FT                   /translation="MSEQDIERFLSEQNKRVEDLYQPVLLNHWMVATTGEQEWSDKHEQ
FT                   SLSEYWAHFSDRESFQKVTRFRKIDSLPLMQRRQLDDLHDKMIKNQFEEGTRQQILSLE
FT                   KKISHVFTTFQPQVNGSRVSNNELLDILRYDLDHERRKQAWFASKEVGKRTEKDLLQLI
FT                   RKRNEVARNLGFETFYHMSFATQELDLEQTFAMFETIKKSSDQAFRMIKDEIDEERAKV
FT                   LKIKKDDLRPWDYVDPFFQEAPSIEHVDFDSFYKDQDLEQVVSQTFQAMELPIDDILKR
FT                   SDLYPRKNKNPFGFCTDMDRRGDIRVLLNLDQSMYWVTALLHEFGHAVYFKFIDSRLPF
FT                   LLRFHSHTLTTEASALFFGRMTKMAEWYERFLGIDRETCERIGRNMEKMLQRQMVVSTR
FT                   WMLTFSFFEKSLYEDPDQDINALWWKLVKEIQYMAPPEDTGSPDWAAKMHFSLAPVYYQ
FT                   DYLLGEMAASQLHHYIKTNVSTDLFSPNVGTYLKENVFKPGALLHWNDKMKKATGEYLT
FT                   PTYFIKQFFTNDEAS"
FT   CDS_pept        401097..401765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0372"
FT                   /product="two-component response regulator"
FT                   /note="BH0372"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04091"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04091"
FT                   /db_xref="GOA:Q9KFU9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFU9"
FT                   /protein_id="BAB04091.1"
FT                   /translation="MARILIIEDEKKIARVLQLELEHEGYETDAAFSGSDGLETFQAHA
FT                   WDLVLLDVMLPELSGLEVLRRIRMTDPVTPIILLTARNSIPDKVSGLDLGANDYITKPF
FT                   EIEELLARVRACLRTVQTRERVEDTLMFQELTINEKTRDVQRGNETIELTPKEFELLVF
FT                   FIKNKGQVLSREQILTNVWGFDYYGDTNVIDVYVRYLRKKLSLTEALQTVRGVGYRLKE
FT                   "
FT   CDS_pept        401769..403148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0373"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="BH0373"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04092"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04092"
FT                   /db_xref="GOA:Q9KFU8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFU8"
FT                   /protein_id="BAB04092.1"
FT                   /translation="MKIKSKILLFSTVWLVTMLLLINGSIFLLFHKLIFDNETNRVAEH
FT                   TESVVSATNAAVATGGDVRSLLRAYLPTNGMIRIITDETASVLTISESGEMLDLPTKYQ
FT                   NEQSVEVRTFDDIPYAVVSVPLIWTDGSIVMLEVTENLEDSQRTLRTLLLVLVIASVIV
FT                   LIPALFLGNMLSRLLLTPIQSLTKTMKHIQETGDYEKIKLPSSSKDELYTMGMTFNQMI
FT                   DMLEQNYQKQQQFVSDASHELKTPLTVIESYASMLRRWGMKKPELLDEAVEAIHEEAVR
FT                   MKAMTEQMLQLANEDAREVLEKKEVDLLEVAEKACQHIHVSFEREIQVVKQGEVFRVWA
FT                   DENKLKQVVYILLDNARKYSQGRITVTIKETSETCSLSVMDQGIGISKGDLEKIFDRFY
FT                   RVDKARARETGGAGLGLSIAKAIVDAHGGEIAIESREGKGTTVLVVLPKQRQRDVKANE
FT                   A"
FT   CDS_pept        403138..403656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0374"
FT                   /note="BH0374"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04093"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04093"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFU7"
FT                   /protein_id="BAB04093.1"
FT                   /translation="MKRKRVMLIFVPLLLLFVGALCWLSFFNQDPSLASEAEVTELIQT
FT                   QYEGSTIQSLTRQGTVYTVMIDHRLGIYELMLDGETRDVLSLQLITLHEEKGGDEEGPE
FT                   EEPVSTMLTEEQAIAIAQQEVEGKVDDIELEEENGLHVYEIEIEVDDDTEATIVMNAYT
FT                   GQILSVTWD"
FT   CDS_pept        403762..404346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0375"
FT                   /note="BH0375"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04094"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04094"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFU6"
FT                   /protein_id="BAB04094.1"
FT                   /translation="MRKLMIPIVAGVVIAGGVTVGAQVFAKEDDSAQFKQVHQAESVSA
FT                   DNEGLTLAEASDIALERAGNGVVTEAEKDRDNGRVVYEIEVKNDDDEYDFKIDQQTGEI
FT                   LKEKQEQRKGSKPREGHSSSKGSEAVISMDEAKEIALKEVSGKIDDIELERENGSLVYE
FT                   VEIESDHYDDDDVTVYVDAMTGNVLYVEWDD"
FT   CDS_pept        complement(404623..406338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0376"
FT                   /product="DNA mismatch repair protein"
FT                   /note="BH0376"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04095"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04095"
FT                   /db_xref="GOA:Q9KFU5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFU5"
FT                   /protein_id="BAB04095.1"
FT                   /translation="MNDTALQQLDYHHILETVASFAYTDRAKETIRMSKPTLNKKQIER
FT                   MLHEVDEAGRILAINSSVPIHSLDDMTTYLEQAKKGLYLQPSQLQRVMSFLEHCRKLKR
FT                   YMRDKVAVAPTVATYVQSIEDMGDTEDEMARSLRHGQIDDHATPELANIRRHLRIKRAE
FT                   VKEKAEAMCRSKKLASYLQENIVVEKNGRFTIPIKKQYRSKVSGTVIDTSSSGATVFME
FT                   PKEVGALYEQLDDLLAAESYEVETILYTLTASVLAIEKELHLAMDIMHHYDVLFAKAKY
FT                   GRSIDGVIPALNDDYTIHLDDARHPLLGEQAVPLSLKLGIRERALIITGPNTGGKTVTL
FT                   KTVGLLTLMAQTGLMIPAGPKTSLHVFQKLFVDIGDGQSIEQNLSTFSSRLTNIIHILE
FT                   RADDQTLVLVDELGSGTDPNEGMALAQVLLEQLFAKGATILATTHYRELKSLSKTHEGF
FT                   LNGSMEFDVATLQPTYRLLLGETGNSQAFDIAFTLGLHPELIHRAQQLTGDQLGESRYT
FT                   TTKDLDSTQRLRYERQLRTSNHIRTKGKAKKAPIPQFNQGDNVTVSPHGAIGRL"
FT   CDS_pept        406752..407093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0377"
FT                   /note="BH0377"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04096"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04096"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFU4"
FT                   /protein_id="BAB04096.1"
FT                   /translation="MKVSKANGEHYIWGDQCDGWHLVKTDELSIIHERMPPQTQEVRHY
FT                   HERSRQFFFVLSGTATLEVDGEKIQIGVQEGVEVPPRVPHKMFNESSEDVHFLVTSQPN
FT                   SRGDRVLCK"
FT   CDS_pept        407102..407773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0378"
FT                   /note="BH0378"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04097"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04097"
FT                   /db_xref="GOA:Q9KFU3"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFU3"
FT                   /protein_id="BAB04097.1"
FT                   /translation="MGRQAMKKFVDVSHTIENGLITYKGLPAPIICDYLSREESRSFYE
FT                   PGTEFQIGKIEMVTNTGTYIDVPFHRYADGKDLSEATVEQMAGLEGVVIPVDKHVKKID
FT                   VDVFKSADLHGKAVLIYTGWDEHWNTERYFEDHPYVTEEAANYLKEQKVALVGIDSHNI
FT                   DDTSGKRRPVHTILLRADILIVEHLCKLGQLVDQSFLFYAVAPKFKGAGTFPVRAFAEI
FT                   V"
FT   CDS_pept        408755..409972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0379"
FT                   /product="transposase (01)"
FT                   /note="BH0379"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04098"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04098"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWR6"
FT                   /protein_id="BAB04098.1"
FT                   /translation="MNFTMNLPGLKGVKVTKMEEREDFIALHVEMPRTPHRCPSCGERT
FT                   ERIHDYRIQKVQHLKLFERWVYLFYRKRRYACRCGKRFAEKACFVERYQRQTVEWNQAF
FT                   RLRLIQGKNFTDTANQFQTSVTTAMRRFDQLAAPLVKKVDHLPPRIAIDDYKGDTNAGK
FT                   YQVIIADADTRKPLDILPDRKADTLKRYLQEKGHHVKTVVMDLSYTFKSAVQKALGHPL
FT                   IIGDPFHFCRYIYWALEGVRRRVQKAFHPYHRKRCKRIKHLFQKERERLDDKQKKKVER
FT                   YLELSPDLREAYELKEHFRQWYQEAKMQGREGRMSEVKQGLYAFYRRVEASPLKEFHRA
FT                   IQTLKNWQTEILNSFAFGLNNGFIEGLNNQTKVIKRNAFGFRRYDRLRNRILLHHQFKH
FT                   QTFGVG"
FT   CDS_pept        410049..410903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0380"
FT                   /product="rRNA adenine N-6-methyltransferase"
FT                   /note="BH0380"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04099"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04099"
FT                   /db_xref="GOA:Q7AJZ0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AJZ0"
FT                   /protein_id="BAB04099.1"
FT                   /translation="MTKKKHKYSNKKLSRGEPPNFSGQHLMHNKKLLQEIVDQAKVSKK
FT                   DTVLELGAGKGALTTFLSERAKRVLAVEYDQTFIQVLNRKMAHAANTTIIHEDIMRIHL
FT                   PKGEFVVVSNIPYSITTPIMKKLLSNPVSGFQRGVIVMEKGAAKRFTSPFIKNAYVLAW
FT                   RMWFDLEYVKGISRECFSPPPKVDSAMVFISRKPDPIVPYKDRSAFFGLAEYALREPKA
FT                   PADSLLRGIFTATQLKHVKRNAGIKHDVSIGALSERQWGVIFETMTQYVRRPLWPRPRK
FT                   TTL"
FT   CDS_pept        410919..411821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mphB"
FT                   /product="macrolide 2'-phosphotransferase"
FT                   /note="BH0381"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04100"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04100"
FT                   /db_xref="GOA:Q7AJY9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AJY9"
FT                   /protein_id="BAB04100.1"
FT                   /translation="MSKTKEQVVELAQKHGITIQEGSLILNESGLDFQVVFALDVNGKR
FT                   WVLRLPRREDVVPSTAKEKKTLELIAPHLSVQVPNWEVYSVEMIAYKQLKGVPAATIDH
FT                   GKKAYVWEMDHTNVSDRFIDTLASGMASLHQIKQDEARRAGVPAEQATEARERMSVRME
FT                   KVKSEFGVSEPLWARWQKWLHHDALWPAETGLVHGDLHAGHILIGEQTEVTGFIDWTEA
FT                   QVTDLSEDFVPHYRIFGEAALNRLIAAYEEAGGYVWPSMKEHVIEREAAFPVAIAEFAL
FT                   KSGIGEYKRMAKEVLGVAE"
FT   CDS_pept        complement(411941..412633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0382"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="BH0382"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04101"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04101"
FT                   /db_xref="GOA:Q7AJY8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AJY8"
FT                   /protein_id="BAB04101.1"
FT                   /translation="MISFQQVTKKYRQKAALQEVNLELTRGKIIGLVGENGSGKSTTLK
FT                   LIAGLIYPTKGEVLVNGNKVSRRIASSVSYLSELDEYYRFYNVEQTIEFYASQFPDFDP
FT                   KKAYEILTFMKLDPESKLKQLSKGNRGRLKIVLSLARNVPVILMDEPLSGLDPMVRQSI
FT                   VKGLISFIDLERQLVLITTHEVREVENILDEVIAIKEGKIIGHHNVEQLREEENLSIVD
FT                   WMTKVYES"
FT   CDS_pept        complement(412630..413010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0383"
FT                   /product="transcriptional regulator (GntR family)"
FT                   /note="BH0383"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04102"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04102"
FT                   /db_xref="GOA:Q7AJY7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AJY7"
FT                   /protein_id="BAB04102.1"
FT                   /translation="MTDTFHSSEPIYLQLAERVKRQIVRGELRLGEKLPSVRDMGIEAN
FT                   VNPNTVQRTYRELEGLKIVESKRGQGTFVTEDEQVLQAIREQMKETEISHFVQGMREMG
FT                   YSDNEIQAGLESYLTEKGASEQ"
FT   CDS_pept        complement(413014..413787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0384"
FT                   /note="BH0384"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04103"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04103"
FT                   /db_xref="GOA:Q9KFU2"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFU2"
FT                   /protein_id="BAB04103.1"
FT                   /translation="MTAWLDLTKKEFRLGLPAFIFSLVILIGMFAIGILIGRSLDMVWE
FT                   LLTFIAFAAITLHSFYLVYYMLYSLDVERKRMHLWLHNPLPTSSLLLAKLVSGSTYMLI
FT                   TFIISVTVLWQAFGNSMVSINSGEWLGVLTLWMIYLMITTILFGCTYLFFWTIFMALSK
FT                   TYNDFLSFVFTFIFFVGAVWLLSAFDGFPFLTWGAIHIGNIPSGVEFSISNEVHHFEIE
FT                   QTTTVLYLSHFVRDLALAILLFGGGCWILDRKVEV"
FT   CDS_pept        414049..414120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0385"
FT                   /note="BH0385"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04104"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04104"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFU1"
FT                   /protein_id="BAB04104.1"
FT                   /translation="MEGVFHVIEASFVSSSMVLIKLN"
FT   CDS_pept        414230..415114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0386"
FT                   /note="BH0386"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04105"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04105"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFU0"
FT                   /protein_id="BAB04105.1"
FT                   /translation="MTEAAEAGNRGFEDYYVNIGFTPDRLVSMLSLTGLSSVHSVVAFY
FT                   DDRPAGFILNGIRMIGGKQVAWNGGTAVVPELRRQGIGQKLMAATVECYEEQGVELATL
FT                   EAFRINERAIALYETFGYHIVDQLCFLQHIGALETSFRSKSVGENDYRVARGTAHDVRL
FT                   LSFYQHTAPWRTQWFALRGGQSILVKDALNHTIGYALYERVFDGEGSLASIVLYQCEAA
FT                   PGRDDADEIVREALDALFAPHDEPCKRTTFNMPRANERVVRILQEAGFTDAHTADGIPF
FT                   EQVYMVRKGKDDR"
FT   CDS_pept        complement(415406..416578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0387"
FT                   /product="transposase (04)"
FT                   /note="BH0387"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04106"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04106"
FT                   /db_xref="GOA:Q9JWQ4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWQ4"
FT                   /protein_id="BAB04106.1"
FT                   /translation="MSTSIGQSTFENQLDSMVREFVKEKLETIMKEEMESFFTHEHPEL
FT                   KNQKNGFYTRQLDTRYGRLENLRVPRDRQNAFQTELFSPYQRREEWLGEAIITMYQKGV
FT                   STREIGHFIEKILGHSYSASTISQVTDVVTEDITQWQQRPLKKRYSVLYLDGTYLKLRR
FT                   EDVANEVVYLVVGVTEEGYREILGFYVGGQESANGWRNILLDLYSRGLEEVLLGVFDGL
FT                   AGLEEAMKAVYPKADVQRCVVHKVRNALHAVRKKDQPAVAQDFKPIYQANTYEEAKNRF
FT                   KEFKENWQKRYPKVVATWEKDLDVLLTFLSYPSTIRPMIYTTNIIERTMKEIKKRTKTM
FT                   NSLPNEKAAEKIVYLQAIDYNERWATRRLRGFGEAYEALQEMFKQRYSGP"
FT   CDS_pept        416707..417204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0388"
FT                   /note="BH0388"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04107"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04107"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFT9"
FT                   /protein_id="BAB04107.1"
FT                   /translation="MKKVLGVLLVSGLLILPNGIMLANESHIQTTHGIETVNGERYEVS
FT                   EHKVESREIPDGTMSITAGKAGKRYSSTKTYKSLLGNYYFISKSQADYQQNVIGVRGRA
FT                   FDRHDGLVSSKSDKQTHSTIASVKVFPDMNSFYNAYAVGNHTYERKGFKNYYPETKSYW
FT                   GK"
FT   CDS_pept        417260..418234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0389"
FT                   /note="BH0389"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04108"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04108"
FT                   /db_xref="GOA:Q9KFT8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFT8"
FT                   /protein_id="BAB04108.1"
FT                   /translation="MTPFFKLNLGGIKIKRKFIIISCMTITLIAIVYLLYQNRTFPIEE
FT                   NSSIYMIGEDPDQGVEIWTTNTQGDPIMNDTVFEVEQESTIVNVHINHEVNTSREYGII
FT                   VLQDFIQSSFQVDGVSYNNLYTFESDPLTENIIPLEIDIFDDSKELIILIIREPHVKEK
FT                   EFDLEKAVNYELIYGKRHLLKSDLELPSEFVEPDGYVSDEQNEIDIFLSSEKEDLQAIA
FT                   SMTENTTLYLHVGNQGLGISVPYAIVGFMDWKQIEIEGENSVLYIESPVDSSDRAIYEF
FT                   LIPNVEHDTNLQFVAFPFPYENLNERVLFPVQGTFRVVIEGKQ"
FT   CDS_pept        418518..419453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0390"
FT                   /note="BH0390"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04109"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04109"
FT                   /db_xref="GOA:Q9KFT7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFT7"
FT                   /protein_id="BAB04109.1"
FT                   /translation="MNQTISAQLKIMFAMVIVGSSVVAGKMLVESFPVFLASELRFLIA
FT                   ALILVPMLLKKEGIPTFSKKEVGILFLQALSGVFLFSIFMLYGLMYTTAMEGGIIMSTL
FT                   PAVVALMAFITLKEKLTRLTIIGILLAVGGTLAINTSGTLSDVERGVAPLLGNLLIIGA
FT                   VISEALFIIFGKSISQRVSPLAISTMVSVFGVVLFLPFAIYEATRFPLTDVSLNDWLII
FT                   FYFGVVVTVIAFVLMYQGIEKVPASTVGVLTGVLPISAVLLSALILKESFSTFHVAGMG
FT                   LVLAAILLISIDSNVEKKEVASLKKKKGIS"
FT   CDS_pept        complement(419566..420270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0391"
FT                   /note="BH0391"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04110"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04110"
FT                   /db_xref="GOA:Q9KFT6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFT6"
FT                   /protein_id="BAB04110.1"
FT                   /translation="MQHTNLSLVASLVSDDSRGAMMTVLLDGRFHTATELALAANITPQ
FT                   TASFHLTKMVEAHLVAVEKQGRHRYYGIVDSDVANVLESLLAIAPPKEIHSFNQATEDH
FT                   ALRFARTCYDHLAGHVGVQLMESLLQNQFIFETENGFSITDKGERFFSDFQVNLEELRK
FT                   KRRSFSHKCLDWSERRPHLAGALGHALLERFYQLHWIERLPRSRALTITPLGKTGFRET
FT                   FSMDVLAEKNKN"
FT   CDS_pept        420362..420970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0392"
FT                   /note="BH0392"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04111"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04111"
FT                   /db_xref="GOA:Q9KFT5"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFT5"
FT                   /protein_id="BAB04111.1"
FT                   /translation="MSHVKSTTIKPSILYYGTPVILLTTLNEDGTVNISPISSSFVLGN
FT                   HIVLGIGVGGKAMENLERHAECVINLPSPELWEHVERLAPYTGKQPVPREKEALGFTFE
FT                   KDKYGRSGLTPVKSLSVQPDRIAECPLQMEAKVIDVKVPAHSPYFAIVETEVLHVHAHD
FT                   SIVIDNRYIDPVRWSPLIYNFRHYFSLGKELGKTFRSET"
FT   CDS_pept        complement(420919..421425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adaB"
FT                   /product="O6-methylguanine-DNA alkyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="BH0393"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04112"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04112"
FT                   /db_xref="GOA:Q9KFT4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFT4"
FT                   /protein_id="BAB04112.1"
FT                   /translation="MNLYQDYYFSPIGPMEILASDTHVRHIRFSTTPSHQRPNEQTDHC
FT                   IRELTDYFAGTLTQFTVSIHMRGTPFQQEVWKALASIPYGDTRTYQQIAALIGRENAYR
FT                   AVGQAISHNPLALVIPCHRVVGKTGKLTGFAWGVERKKQLLDHEAQSRYVSLRNVFPSS
FT                   FPSEK"
FT   CDS_pept        421572..422117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adaA"
FT                   /product="methylphosphotriester-DNA alkyltransferase
FT                   (AraC/XylS family)"
FT                   /EC_number="2.1.1.-"
FT                   /note="BH0394"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04113"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04113"
FT                   /db_xref="GOA:Q9KFT3"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR016220"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFT3"
FT                   /protein_id="BAB04113.1"
FT                   /translation="MDKRYWQAIVSCDQSYDGVFYYAVKTTMIYCRPSCRSKTPKRENV
FT                   LIFHDHEQPRTGGFRPCKRCRPDVPSFRTTKEEVVEKAKAFISAHYTEELNLSVIASQL
FT                   YVNPFYLRRIFKEETELSPSQYLLKKRIEAALALLVNQEETITDIAFKVGFKSPAHFST
FT                   VFRHMIGLPPQKYRESFT"
FT   CDS_pept        422404..423120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0395"
FT                   /product="necrosis and ethylene inducing protein"
FT                   /note="BH0395"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04114"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04114"
FT                   /db_xref="InterPro:IPR008701"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFT2"
FT                   /protein_id="BAB04114.1"
FT                   /translation="MMRFVIGFLLSILASISLVSPANAAVIDHDKVVGFEEVTPTTITQ
FT                   KVAKRFQPYLTVSTGCVPFPAVDADGNTSGGLAPTGPHNGGCSSHIGQVYSRSTWHNGV
FT                   WAIMYAWYFPKDSPSPGLGHRHDWEGIVVWVDNPANPSPQLLSIAYSQHGNFYNVAPTD
FT                   RNTREQRPLIRYSHAWPLNHSLWIHDQVGGTQPLIGWDDLTPAARHALNTTDFGAANVP
FT                   FNDHNFINNLRKAWYR"
FT   CDS_pept        423311..424228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0396"
FT                   /note="BH0396"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04115"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04115"
FT                   /db_xref="GOA:Q9KFT1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFT1"
FT                   /protein_id="BAB04115.1"
FT                   /translation="MRLYVMLLSLSLIWGFSFVFIEHLLGIVGVWGTVVVRCFAGAIIL
FT                   LPILLMRRKLFYRPAPWKALMIVGIFNAGLPWGLIALSQTEIYSSTAAVLNALTPLFTG
FT                   LIGFLLYSNALSRQQWGGIVLGFSGVVVLTGFQLQLLAPEHFVGVGTMILATICYGFAS
FT                   QYVKRHLHDTDVVLITTFSLLFGGLVGLIGMWITDSLHVVRVPLTIDWLSLISIIGLGC
FT                   LGSGMAHLLYYDLMKKGGPEFATTVTYLIPMTAIIWGKLFLDELITKNIVIGMLMILMG
FT                   VYFTSRKRNVCSKANEDSNKGELA"
FT   CDS_pept        424357..425955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0397"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="BH0397"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04116"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04116"
FT                   /db_xref="GOA:Q9KFT0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFT0"
FT                   /protein_id="BAB04116.1"
FT                   /translation="MRKKKTKLSILITALVCLVVIVALIITDLLVSVATSERLQSNIEE
FT                   KAIAISRTVAKAQWVIDGLENEEEEWRVQTYTMEIQSATDVLFIVVMDMEGIRKSHPNP
FT                   EEIGKRFVGGDEVAALEGREHVSISTGTLGESLRAFTPIFNDHGEQLGAVAVGISLQEV
FT                   NDVLADNHTSILKGSVIGIIVGIIGALIVASYIKRALLGLEPFEIAKILEERSAMLQSA
FT                   REAIIAVDSKGTITLVNKSALNLFEKAGMSGDPIGKKVTEFMPTSRLEWVLKTRQPEFD
FT                   EEQQMNGMTILVNRVPIIVNDEVVGAISTFRDLTEIKQQAKQLTGVKLYVEALRAQSHE
FT                   FMNKLHVILGMVKTESYDELNDYIHQIVNHRSTELNHVIKRIKDSVLAGFILGKLSYAR
FT                   EKHITLDVQTKSVIPKASSEQMVHELITILGNLIDNALEAVIKAKEKTVLVQLEYSNER
FT                   LHIRVQDTGPGIPDGEQGDIFKKGYSTKGENRGYGLYLVKQSVEKLGGAMEYESRATGM
FT                   TFYVDIPYKTRRDKR"
FT   CDS_pept        425952..426665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0398"
FT                   /product="two-component response regulator"
FT                   /note="BH0398"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04117"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04117"
FT                   /db_xref="GOA:Q9KFS9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFS9"
FT                   /protein_id="BAB04117.1"
FT                   /translation="MIHVLIVEDDPMVAEFNKRYVKNVDGFHLVGIAYHVEEAKTVIEE
FT                   KKVDLILLDVYMPGENGLELLSYIRAEKLGIDVILITAASDADHIQTALRYGAVDYLIK
FT                   PFEFERFEQALLSYKDKQYALREKEQLNQEELDQLLLSDDKDPDQEIALPKGLTQSTLQ
FT                   IIVEEIRKIGETPFSTDELAEQTEISRVSIRKYLKFLVDIECLEERLTYGIGRPVYSYQ
FT                   YIKENGDRLKQYLSG"
FT   CDS_pept        426790..427983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0399"
FT                   /product="malate oxidoreductase (NAD) (malic enzyme)"
FT                   /EC_number="1.1.1.38"
FT                   /note="BH0399"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04118"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04118"
FT                   /db_xref="GOA:Q9KFS8"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFS8"
FT                   /protein_id="BAB04118.1"
FT                   /translation="MANPNLKEEAIALHQKHSGKLEIVGKMEITDEKDLSLVYTPGVAD
FT                   VCKQIAEQPDKVNSLTSRGNMVAIVTDGTAVLGLGNIGPKAAMPVMEGKALLFKKFANI
FT                   DGFPVCLNTQDTDEIVQIIKALSPTFAGINLEDIAAPRCFEIEERLKEELDIPVFHDDQ
FT                   HGTAIVVLAALTNALKVVNKLNQPIKMVINGAGAAGTAIANLLLHAGFKDITLVSLEGV
FT                   VAKGEAWLNPMQAKMAEVTNLAGVKGTLKDAITDADVFIGVSGPGAMKKEHIQAMAKDP
FT                   IVLALANPIPEIYPEEAIEAGAAVVGTGRSDYPNQVNNLLAFPGIFRGALDAGAKTITM
FT                   EMKIAAAYAIADVLSDKEVNANMIIPDALDARVAQRVAEAVATTALQRERVAALSAN"
FT   CDS_pept        428078..429397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0400"
FT                   /product="sodium-dependent citrate transporter (symport
FT                   system)"
FT                   /note="BH0400"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04119"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04119"
FT                   /db_xref="GOA:Q9KFS7"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFS7"
FT                   /protein_id="BAB04119.1"
FT                   /translation="MKQAAEKWPANEMKNKTVPLPKAGVKIFETPVLWFFVFAIVTIVS
FT                   LYTGNLPGGMIGSLLVMIVLGELLGWVGDRTPIVKTYLGGGAIVAIFGSAYMVYSGLLP
FT                   EYAITGVTDFMTTGGFLDFYIAALITGSILGMSSKLLIKVGVRFFLPIIGAIIGAIVIA
FT                   AIIGSLVGFSVQDAILVMTLPIMGGGMGAGAVPMSQIYSELLGNEPSYYISMLVPALAL
FT                   GNVFAIIFASVLDMVGKKYPSLTGNGQLIEGVEQEKKEHKYDIKIMGVGLLAAITFFTA
FT                   GSILGDFLPIHAYAIMIILVAIAKITNMLPKVVLDGASQWYQFVAKNWTFALLFGIGVA
FT                   YTDLNTVLEALSYQYVLTVFGVVLGAILGAALLGKLVGFYPIEAAITGGLCMANMGGTG
FT                   DVAVLSAAKRMQLMPFAQISSRLGGAIILLITGLIIQLFL"
FT   CDS_pept        429508..430407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0401"
FT                   /note="BH0401"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04120"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04120"
FT                   /db_xref="GOA:Q9KFS6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFS6"
FT                   /protein_id="BAB04120.1"
FT                   /translation="MSMSDRARFHAVFQYIETHYKDRIDLDTLANRSHLSKYHFSRLFK
FT                   ELTGDSPMAYVNKVRVQKAIPLLTSTKKTVLEIASLCGFDSVSTFNATFKKHYDLTPSY
FT                   VRKNSNNSLVVSKKQEELPAVLRYDPINEDSFLRRIWTMNISIKELPDYEVAFVRHVGS
FT                   YLETYKAWATLGAWASENRLDPPQSYFIGISLDDPKEVEEHLCRYDACVTLPEGFTKKP
FT                   HEDIQFKGLSGGTYALYSFYDRVDKLGIVYQSIFTQWLPASGFVADDKPSLEFCMNDPA
FT                   LDPEGKAKVDLYIPIRKK"
FT   CDS_pept        430583..431083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0402"
FT                   /note="BH0402"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04121"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04121"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFS5"
FT                   /protein_id="BAB04121.1"
FT                   /translation="MTEDELLLYGAWVDAIGTIVSAYAELREISGFNDENDKIVSIGEG
FT                   LQAVGTAMMGIVTTEDPMNFAGTWVDAAGAATASLAAYRQSVEGGESDANLRLEVLGDT
FT                   FQAMGSAMSALAEYRAGAPYAGNVLQSLGATLEALGALFEQKSREEQGQMLATVGDYSS
FT                   NRG"
FT   CDS_pept        complement(431130..431327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0403"
FT                   /note="BH0403"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04122"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04122"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFS4"
FT                   /protein_id="BAB04122.1"
FT                   /translation="MKNKQKKTFPFPTEANQSGELGVEHGRPYSTNQKPVGDSIDEHQE
FT                   LEAANEDLAEKEISQTFNNS"
FT   CDS_pept        431458..431718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0404"
FT                   /note="BH0404"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04123"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04123"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFS3"
FT                   /protein_id="BAB04123.1"
FT                   /translation="MEFVDRLYELYKDKLTGDEEDAFIIIEGIMESFTARDVNQLFHDL
FT                   PEPERFDMLALYLYEKFRQKLAEEGIGQTKNRDDGQIKFYH"
FT   CDS_pept        431830..432498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0405"
FT                   /product="NAD(P)H-flavin oxidoreductase"
FT                   /note="BH0405"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04124"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04124"
FT                   /db_xref="GOA:Q9KFS2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFS2"
FT                   /protein_id="BAB04124.1"
FT                   /translation="MNKKAIAKEEILNAYRFRHATKEFDPNKTIPADDFQFILETGRLS
FT                   PSSFGMEPWRFIVVQNEKLRDKIKNTSWGAAGKLPEASHFVMILARTHLDTRFDSAYLK
FT                   EQFSDFPEDRLSQYLGMIEQFQKHDFKLLDQERFLNDWAIRQTYIPLANMMTAAAEIGI
FT                   DSCPIEGFNVERMNELLAEEGLLEDGHFTISVMVAFGYRKKEPQPKTRRPYDDVVKWIE
FT                   "
FT   CDS_pept        432501..433025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0406"
FT                   /note="BH0406"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04125"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04125"
FT                   /db_xref="GOA:Q9KFS1"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFS1"
FT                   /protein_id="BAB04125.1"
FT                   /translation="MKKRGGVPLALNLAVAFFVTPYYNDYIAIMYCKVVIFLFRFLVLQ
FT                   DSNLAIFFCITTLHYKVGGNVSIRSQLLKGILEGCILAVIRRQSVYGYELAVKLQEHGL
FT                   EVSEGSIYPILLRLQKEKLIKGTMKKSPTGPNRKYYVLTEDGMAALEQFKQNWEQLKTP
FT                   VDGLLERVEKL"
FT   CDS_pept        433022..433708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0407"
FT                   /note="BH0407"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04126"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04126"
FT                   /db_xref="GOA:Q9KFS0"
FT                   /db_xref="InterPro:IPR009214"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFS0"
FT                   /protein_id="BAB04126.1"
FT                   /translation="MNADDLIKDNNEKRKLLTEENLKVYEDLLLYIRLAHSKSEQETEE
FT                   LLTELLDHLLEAQAKGKSAKAVFGDNPKQYADEIIGEIPKMVTKERFGLFAYGLSMFFA
FT                   TVLVFSGIYRMLRYYVFQVGEAVSEVYVGTALITTIASIVIAWMFVFVVFQYFRWSCFR
FT                   TINKVFEFFILWLGGMIPFALFFALLYFTPNVGRMIEIPVYLYFVAGVVLYLAAKWFQS
FT                   RAKSSI"
FT   CDS_pept        433876..434643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mta"
FT                   /product="transcriptional activator of multidrug-efflux
FT                   transporter genes"
FT                   /note="BH0408"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04127"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04127"
FT                   /db_xref="GOA:Q9KFR9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFR9"
FT                   /protein_id="BAB04127.1"
FT                   /translation="MAMKVKEVAELVGTSVRTLHHYDEIGLLIPDETTEAGYRLYSDDN
FT                   LEMLQQILFFKELGFSLKQIKEIVYSPTFDRLEALSLHRNMLLEKRSRIDQMVETIDKT
FT                   IKHLKGEIHMTNEEKFAGFDFSHNPYEQEARERWGDEAVDRSNEKLGRLTKEEQQALGE
FT                   RMNQIYRRLAEMRHLSPQSQAAQEAIKDWYEFLNNNFGHHYTLEAFKGLGQMYVEDERF
FT                   TQNIDQFGEGLALFMSKAMAAFVGSTEKIVKSP"
FT   CDS_pept        434704..435129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0409"
FT                   /product="50S ribosomal protein L11"
FT                   /note="BH0409"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04128"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04128"
FT                   /db_xref="GOA:Q9KFR8"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KFR8"
FT                   /protein_id="BAB04128.1"
FT                   /translation="MEKVIKQIVTINLEAGKANPAKVGKDLAPTGINLLGFCNQYNEMT
FT                   KLQLGLVVPAKITIYEDRSFNVKLKTPPAAFLLKKYAGVEKGAAQPGKEVVGSITTQQL
FT                   RTIAEIKLPDLNTTSIDRAMKIIAGTARNMGINIEDD"
FT   CDS_pept        complement(435179..436087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0410"
FT                   /note="BH0410"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04129"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04129"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFR7"
FT                   /protein_id="BAB04129.1"
FT                   /translation="MKPLIGKVALVAGATRGAGRGIAVELGAAGATVYVTGRTTRERRS
FT                   EYNRPETIEETAELVTNAGGTGIAVPVDHLDPQKVEALVSQIEREQGKLDVLVNDIWGG
FT                   ELLTEWNAPVWQHSLDDGLRMLRLAIDTHLITSHFALPLLLKSRGLVVEMTDGTAEYNR
FT                   EHYRQPLYYDLAKTSVLRMAWGLAQELQPHECTAVALTPGWMRSEIMLDHFEVTERNWR
FT                   DATIKEPHFVISESPRFVGRAVAALASDPNVSRWNGQSLSSGQLAQAYGFTDLDGSKPD
FT                   CWRYLVEVQLTGKEADATGYR"
FT   CDS_pept        436194..437189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0411"
FT                   /note="BH0411"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04130"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04130"
FT                   /db_xref="GOA:Q9KFR6"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFR6"
FT                   /protein_id="BAB04130.1"
FT                   /translation="MKADRLLEIVALLQNHEKLTTHQLVDHLHVSSRTILRDMDTLSAL
FT                   GIPIVSERGRAGGWKLMDHFRSQLSGMSMTELKALFILPSDKVLKDLGIPTKGRDIRLN
FT                   MLSSLQGNRKHAVRPYLEKVYIDTGTWKPSKERMEEFNVVQQAVFEEKKLYIVYENAKG
FT                   EQRERLISPLGLVAKGSAWYVVATVETGDIRNFKLSRIKDSKLVREPIVKPETFSLATY
FT                   WNESKEQFVQTLPSYEATVLAHDSIIHRLTFTGKFVENIQVGHRDDEWVTVNLCFHDEQ
FT                   EITEYVLGFGGRMKLVTPKHLIGRIVQQASAVIQQYASDKEPTNETKEGL"
FT   CDS_pept        437265..437894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paiB"
FT                   /product="transcriptional repressor of sporulation and
FT                   degradative enzymes production"
FT                   /note="BH0412"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04131"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04131"
FT                   /db_xref="GOA:Q9KFR5"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFR5"
FT                   /protein_id="BAB04131.1"
FT                   /translation="MYIPKAFHVDDVNELITFIRNHSFGIMVSQTEEEPFATHLPFLLD
FT                   EQKGENGVLISHLARANPHWQGLQDQKVLVVFQGPHAYISPTWYDEPRTVPTWNYVAVH
FT                   VYGTFRQIQDKHKVKEWIEKTVNVYEQTMNPPWEAVFDEPFMEGLLNGIVAFEIEVERM
FT                   EGNWKLNQNHPIERQERVVKKLKSINEPNAQKMAELMEKEIEKRNK"
FT   CDS_pept        438223..441099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0413"
FT                   /product="alpha-amylase G-6 precursor"
FT                   /note="BH0413"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04132"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04132"
FT                   /db_xref="GOA:Q9KFR4"
FT                   /db_xref="InterPro:IPR005085"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031965"
FT                   /db_xref="PDB:2C3G"
FT                   /db_xref="PDB:2C3H"
FT                   /db_xref="PDB:2C3V"
FT                   /db_xref="PDB:2C3W"
FT                   /db_xref="PDB:2C3X"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFR4"
FT                   /protein_id="BAB04132.1"
FT                   /translation="MNASYVKKVSLYLLLSFVITLPLFSPTFSINSVDASQGGEQQSFS
FT                   WDNATVYFAITDRFHDGNPSNNQSYGRPQEDAWGQNIGTFHGGDLQGLTDKLNEGYFTE
FT                   LGINAIWITAPYEQVHGWVGGGSDGDFAHYAYHGYYALDYTMIDQNMGTVEDMREFVHT
FT                   AHEQGIRVVLDVVMNHPGYNTIKDMHEYGFGNPGVSEHWTPGQGQNWHDVHQQINYEDA
FT                   GAWRHWWGPWIRAGIAGYESCGNSEITMCLAGLPDFRTELTHSVGLPPLLETKWNQERQ
FT                   GGYEDWIVPAANDLRRDLGVAPADYIVKWLSAWVEEFGIDGFRVDTAKHVELSRWQQLK
FT                   DAANEALWKWREENPEAPGANWTDDFWMVGEVWGHGVGRSEYFDHGFDSVINFTFQGEH
FT                   GNGPAYRLDTMESTFSRYANAINTDSTFNVLSYLSQHDTQLYPRERLIDGGTYLMLLPG
FT                   GVQVFYGDETARPFGPTGSDPHQGTRSSMNWDSVNEEVLHHWQKMGQFRSNHLAVGAGE
FT                   HRQIAASPYTFSRTYVEGDVDDRVVVVVGASGETTIDVSSVFSDGQQVRDFYTGNVTVV
FT                   ENGHVTFPAHRNGVILIERAGDLLPSVSASPAGGEFDREQQEVILYVQHAEWGAYTIDG
FT                   SDPKEEGTAFANGDVITVGRELNIDESLTLRLYAENETGEAKAEFTFTKVPAYPQVFAD
FT                   PPGGTFAGDTLKVTLHTRNVEGGTYSIDGSDEQAFTDGDEIMIGKGIEAGSETTLQLKA
FT                   ENEFGTIEETYTYTKSTGLTIYFKKPDSWGTPHLYYYDTNPKVDEPTWSEAPEMEHYEG
FT                   DWYTHTIEGVESVRLLFKDRGTNQWPGPGEPGFFRDQDGWFDGEWHVDRPGDATDITIY
FT                   YKTGWTHPHIHYSLNQGAWTTLPGVPLTKSEYEGYVKVTIEAEEGSQLRAAFNNGSGQW
FT                   DNNQGRDYDFSSGVHTLADGRILSGTPK"
FT   CDS_pept        441405..442865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0414"
FT                   /product="sulfate permease"
FT                   /note="BH0414"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04133"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04133"
FT                   /db_xref="GOA:Q9KFR3"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFR3"
FT                   /protein_id="BAB04133.1"
FT                   /translation="MNIQQLKNEWFGNVRGDVLAGIVVALALIPEAIAFSIIAGVDPMV
FT                   GLYASFCIAVVIAFVGGRPGMISAATGAMALLMINLVADHGLHYLLAATILTGVLQILF
FT                   GVFKLASVMKFVPRSVMIGFVNALAILIFTSQLQHFVGETWVMYALVALTLAIIYLLPK
FT                   VTTAVPSTLVAIIIVTAIVIFGNIGVRTVGDLGTLTQSLPTFLIPSVPFSFETLMIIFP
FT                   YSLALAIVGLLESLLTANIVDDMTDTESDKNKESRGQGIANIVTGFFGGMAGCAMIGQS
FT                   VINVKSGGRGRLSALVAGVFLMFLIIVLGNVVVQIPMAALAGVMIMVSIGTFDWSSLRN
FT                   LHKIPRTDATVMVVTVGTVVYTHDLSKGVLAGVVLSAIFFAAKISRVKVEEMTSATPEL
FT                   KRYKVQGQLFFASVSDLPAKFSYMANVNEVEIDLSEAHVWDDSAVGALDKIEMKFEQQN
FT                   IKVTFTGLNTESRKLVQRMGGLSKASGH"
FT   CDS_pept        443106..443519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0415"
FT                   /note="BH0415"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04134"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04134"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFR2"
FT                   /protein_id="BAB04134.1"
FT                   /translation="MKKILLATDGSVQSQRSAEQAIQLATAFNGVIDVVHVIDAERAKH
FT                   DALKNITPAALEQDRKQRLNPVLTKIKKEGIPYKLHFLKGEPGPSIVDFANKGEYDWVI
FT                   LGSRGLNPLQKMVLGSVSHKVAKRVKWPVMIVK"
FT   CDS_pept        443760..444977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0416"
FT                   /product="transposase (01)"
FT                   /note="BH0416"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04135"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04135"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWR0"
FT                   /protein_id="BAB04135.1"
FT                   /translation="MNFTMDLPGLKGVKVTKMEEREGFIALHVEMPRTPHRCPSCGERT
FT                   ERTHDYRIQKVQHLKLFERWVYLFYRKRRYACRCGKRFAEKACFVERYQRQTVEWNQAF
FT                   RLRLIQGKNFTDTANQFQTSVTTAMRRFDQLAAPLVKKVDHLPPRIAIDDYKGDTNAGK
FT                   YQVIIADADTRKPLDILPDRKADTLKRYLQEKGHHVKTVVMDLSYTFKSAVQKALGHPL
FT                   IIGDPFHFCRYIYWALEGVRRRVQKAFHPYHRKRCKRIKHLFQKEREGLDDKQKKKVER
FT                   YLELSPDLREAYELKEHFRQWYQEAKMQGREGRMSEVKQGLYAFYRRVEASPLKEFHRA
FT                   IQTLKNWQTEILNSFAFGLNNGFIEGLNNQTKVIKRNAFGFRRYDRLRSRILLHHQFKH
FT                   QTFGVG"
FT   CDS_pept        445088..446017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0417"
FT                   /product="inosine-uridine nucleoside hydrolase"
FT                   /note="BH0417"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04136"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04136"
FT                   /db_xref="GOA:Q9KFR1"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFR1"
FT                   /protein_id="BAB04136.1"
FT                   /translation="MEKVLLFCDPGIDDSVAIMYALLHPGLDVVGIVTGYGNVTQEQAT
FT                   ANAFYLLSLAGRSDIPVYAGAQFPLTGEIATYYPEIHGENGLGPIRPPIDLEGELLNFT
FT                   DLFDLIISYPNDITIIDVGRLTSLSIAYILGEETMGRVKQVIVMGGAFFVPGNVSPVAE
FT                   ANFIGDPVAANLIMERARPLTVVPLNVTSYSVVTDEHIRAITDRYYNPFTPFIQPIYHY
FT                   YATAYSALIPGLEGALFHDVLAVMALVHPEMFQMMKRDVSVSIAPLTRGQSVADFRPFA
FT                   PEGELKIAVDFHYPTFIQSFIQVLRREL"
FT   CDS_pept        complement(446018..446629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0418"
FT                   /note="BH0418"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04137"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04137"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFR0"
FT                   /protein_id="BAB04137.1"
FT                   /translation="MLDDTGERIIPKNMKPMNGMLLEHLARYYFSTPYASGRVLDIACG
FT                   TGYGSVMVAKTRKTEVDQVLGVDFDADVIHYAKQNYYHPKVSFLVGDAMDPYLRNQIGT
FT                   FDTILSFETIEHVKDDRLFIERMRQLLKKDGTLVLSTPFGQGRGKPSDEPFHYHQLTEE
FT                   EFRSLFDSFSEKEVFYQRGVTIEPKRTNVHYAFGVAVCKK"
FT   CDS_pept        446868..447590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0419"
FT                   /product="transcriptional regulator (GntR family)"
FT                   /note="BH0419"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04138"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04138"
FT                   /db_xref="GOA:Q9KFQ9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFQ9"
FT                   /protein_id="BAB04138.1"
FT                   /translation="MINKNSPLPIYYQIEEQIKQQIESGVLKPGDMLKSEREYAEYYDV
FT                   SRMTVRQAINNLVNQGYIYKKKGSGTYVQEKKIEQALNGLTSFTEDMRKRGMEPSSRLL
FT                   KFELIPATAKIAKELNLKENTPVTEIKRIRYGDGVPIAIERNLLPANLVKGLNEEIINQ
FT                   SLYQYIEEELNLRIADALQVIEASTASKTEADLLEIQKGSPILLIERKTFLADGTVLEL
FT                   VKSAYRADRYKFMITMQR"
FT   CDS_pept        complement(447642..448382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /product="N-acetylglucosamine-6-phosphate isomerase"
FT                   /EC_number="3.5.99.6"
FT                   /note="BH0420"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04139"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04139"
FT                   /db_xref="GOA:Q9KFQ8"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KFQ8"
FT                   /protein_id="BAB04139.1"
FT                   /translation="MKIIEAKHFDDMSLKAAQFMIEKIQRDPTITLGLATGGTPQKMYE
FT                   LLINDHRTNGTSYHQVTTFNLDEYIGLDRHDPNSYYTYMHKALFDHIDIRDEQAFLPNG
FT                   TASNFNAECERYEALIQQRGGIDLQVLGIGANGHIGFNEPGTSFESSTHIVKLTDSTRE
FT                   ANARYFNDLSEVPTEAITMGIQSIMNAKEILLLASGKKKADALYQLIHGKVDESFPASV
FT                   LQRHEQVTIIADREALQKVAVSSN"
FT   CDS_pept        complement(448369..449562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /note="BH0421"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04140"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04140"
FT                   /db_xref="GOA:Q9KFQ7"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFQ7"
FT                   /protein_id="BAB04140.1"
FT                   /translation="MENGNCVLKGASIVGETQSYDKGFLKVEDGIITEVTEQEIENHRH
FT                   DKSIDLSGCYVVPGFIDVHIHGSHGADTMDASQICLETIAKSIVREGTTGFLATTITQG
FT                   QGRIEQALANVAEYAKGPHNEGAQLLGVHLEGPFISAKRAGAQPVEHILEPNLSLFNRW
FT                   YEVSGRTIKLVTLAPETEQGLQLVGALRSRQIIASIGHSDAVHEQMMDAISHGANHVTH
FT                   LYNGMRGFHHREPGVAGTALARNELTVELIVDGIHVHPEVVKATYDAKTADNIILITDA
FT                   MRAKWLADGTYELGGQTVHVKNGKALLQDGTLAGSVLKMNDAVKNVMTYTGCSLEEAVQ
FT                   MASVNPAKQLNVFDRKGSIRVGKDADLTVLDQDWNVVLTMCQGRIVYQKGAKSYENH"
FT   CDS_pept        449869..451236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0422"
FT                   /product="PTS system, N-acetylglucosamine-specific enzyme
FT                   II, ABC component"
FT                   /note="BH0422"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04141"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04141"
FT                   /db_xref="GOA:Q9KFQ6"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFQ6"
FT                   /protein_id="BAB04141.1"
FT                   /translation="MLTFLQRIGKSLMLPIAVLPAAAILLRLGQEDLFNQAFIAAAGAA
FT                   VFDHLPLIFAIGVAIGFSKDSNGTAGLAGAIGYLVLVNGTQAIDPNVDMAILGGIISGI
FT                   VAGLLYNRFHDVKLPQWLGFFGGRRFVPIITATVMVIFAGLFGYVWPPIQDGINQIGQW
FT                   IIGGGALGVGIFGFLNRLLIPVGLHHVLNSLVWFVFGEYEGATGDLHRFFAGDPTAGSF
FT                   MAGFFPIMMFGLPAAALAMIAAAEPERRKEVTGMLIGIAVTAFVTGVTEPLEFSFMFLA
FT                   PILYVAHALLTASSLAIAHLLEIRHGFGFSGGAIDFVLNWRLATKPALLIVMGLIYALI
FT                   YFVLFYVVIKKFDLKTPGREDESEETDASSNGQADKYDVMASHFITDLGGQENLKTIDH
FT                   CTTRLRLTVHDMGKVNEELLKKHGARGVIKVNETNVQVIIGTDVEFVADRMKNKHG"
FT   CDS_pept        complement(451343..451777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0423"
FT                   /product="transcriptional regulator"
FT                   /note="BH0423"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04142"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04142"
FT                   /db_xref="GOA:Q9KFQ5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFQ5"
FT                   /protein_id="BAB04142.1"
FT                   /translation="MKIDEIDKQILNELMKDGRISMKELGTKINMSSPAVRERVKQMES
FT                   YGIIKNYTVAIDLTKVGYPVSCLIEATVKHGEYSRFKQVVEGMNNVEFCHRIAGRACFM
FT                   IKAYMEDLSKVEAFIEQLSPFAETVTHVVLSTLDTDMTLT"
FT   CDS_pept        451896..452312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0424"
FT                   /note="BH0424"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04143"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04143"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFQ4"
FT                   /protein_id="BAB04143.1"
FT                   /translation="MARLSAGPYGETPFQKRLGHNRYILRAWNELSEILEQDGALFSTL
FT                   KEQVRRALAQKNGCEYCKAKGRPDPQLVDEKTGVAIGFAEAFLQMRGAVPDSIFEVARE
FT                   ALSEREMSELCAFICFTTASQFFGALMDLQPDEQ"
FT   CDS_pept        complement(453687..454058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0425"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="BH0425"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04144"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04144"
FT                   /db_xref="GOA:Q9KFQ3"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFQ3"
FT                   /protein_id="BAB04144.1"
FT                   /translation="MKLKLATKINVLVLSIILVFAAVIGVVVNDQITKGIKAFATEKAR
FT                   ADLALAHRYIDERFPGDWKATDGELYKGTTLMNDNFDLVDAIGEDTGDTVTIFSGDTRI
FT                   STNVLIDGERPLGPKPLKK"
FT   CDS_pept        454236..454733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0426"
FT                   /note="BH0426"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04145"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04145"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFQ2"
FT                   /protein_id="BAB04145.1"
FT                   /translation="MRIRPIDTLDAEAFLDLSKAVDQTGMMLFEPREKKWTVEQQRKMI
FT                   DGILGRRNSMTFVAEEYGRLIGYITAIGGNVKRTAHRAYIVVGVREEEQGRGIATELFN
FT                   RLFNWAKSVDITRLELTVIKDNRKAFQLYQKLGFVLEGEKVHSLMIDGKPVNEYYLYKL
FT                   LD"
FT   CDS_pept        complement(454793..455698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0427"
FT                   /note="BH0427"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04146"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04146"
FT                   /db_xref="GOA:Q9KFQ1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFQ1"
FT                   /protein_id="BAB04146.1"
FT                   /translation="MRSSVSVLYLSISVIGAIIFSAVGIIWGLAIHSHMIIFDGIYSLI
FT                   SVVLSLFSLGATVFMMKDDRDKFPYGKGMVQALTLVIKHGVIALLCLFAFITAVGDLVD
FT                   GGRHVVPIHGAAYSLLSTAGCAAIFFFLRRKAGANPLIKAETHQWLMDTCLSAAVFIGF
FT                   AAAFLLAHTKFAFLVPYVDPLMVALSAGLFITLPVKQIVLNGKEMLEMAPNPELQQSIE
FT                   SHIHAIEEKYQIPESHVRMAKVGQTLFIDIYFIIDRTSCARNVKDLDDIRQQFHQSLRS
FT                   LPYEPLVNMTFTHDRKWAIS"
FT   CDS_pept        complement(455756..456313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0428"
FT                   /product="transcriptional regulator (TetR/AcrR family)"
FT                   /note="BH0428"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04147"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04147"
FT                   /db_xref="GOA:Q9KFQ0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041603"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFQ0"
FT                   /protein_id="BAB04147.1"
FT                   /translation="MRYKSEETYRAILQAAIDVMKDKGFEKASIGEIAKRAGVAHGTFY
FT                   TYFQAKNEIIPAIADEILQDQLHQLQNRIQEDDDVQTLIRELIDVSFTLTKSYKEVILL
FT                   CYAGLSYYDSLNRWEEIYDPYYRWIEKHLKKHLTINIQTLVPMIVNLIEFTAERHYFAN
FT                   ECEQELSQLKEDTFQVVMNMLR"
FT   CDS_pept        456515..457138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0429"
FT                   /note="BH0429"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04148"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04148"
FT                   /db_xref="GOA:Q9KFP9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFP9"
FT                   /protein_id="BAB04148.1"
FT                   /translation="MDLTSLLSFLGVAVLLTLMPGPDILFVLAQSMSQNRQAGIVTALG
FT                   LCTGLLVHITAAVVGISALIYQSALAFTVVKYAGAAYLLYLAWKAFQEKGEGLSIDKQT
FT                   TLAYGALYKKGIIMNVLNPKVSLFFLALLPQFVNSGAGSAPWQMLLLGVVFLIQAFIIF
FT                   SLVSWFAEKVGQLLMRSSFIKNQMHRIKGGLLALIGLQVAFSKN"
FT   CDS_pept        457154..457825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0430"
FT                   /note="BH0430"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04149"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04149"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFP8"
FT                   /protein_id="BAB04149.1"
FT                   /translation="MTTIIFDMDGTLFQTDSVLEGALEKTFDYLRQTDRWQGETPIEQY
FT                   LAILGAPMHVVWETIMPSASHEERQVADQAFWDFLLEEIRLDHGKLYPNVGKTLEELYQ
FT                   LGYDLYVASNGFMRYLQAIVDHYGFTSYLKDIYGADRFETASKTELVAKLVRDYRIEGG
FT                   VMVGDRSSDLTAGADAKLVTIGCLYGYGTKDELDSADVLVEDISEIRSIVSQRLENHQK
FT                   R"
FT   CDS_pept        complement(457793..458395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0431"
FT                   /note="BH0431"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04150"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04150"
FT                   /db_xref="GOA:Q9KFP7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFP7"
FT                   /protein_id="BAB04150.1"
FT                   /translation="MDSFLHGFLLAFGLILPMGVQNLFIFTQGMTQNKLRRALPAVMTA
FT                   SICDTILIIVSVLVMAVAAHLVERFVPFLIIGGFVFLLYMGWVIWNSTSASNGKVAPFT
FT                   AKKQMSFALTVSLLNPHALLDTLGIIGTNSLLYKAADKWSFTCGTIVVSWLYFCLLAWI
FT                   GRWFGQLQAIQKYVTYLNRLSALLIWGLAFLMIFQSL"
FT   CDS_pept        458511..459959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0432"
FT                   /product="transcriptional regulator (GntR family)"
FT                   /note="BH0432"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04151"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04151"
FT                   /db_xref="GOA:Q9KFP6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFP6"
FT                   /protein_id="BAB04151.1"
FT                   /translation="MKLDWKPDRSSHVPIYLQIKEELKRRIEGGEWTVGTLLPSQRELA
FT                   NLLGVNRSTIVQVYEELMADGLVESVQGKGTKVVNNTWNVIAATSPDWQQYVSGGVFQP
FT                   NKTYVQKINEAEFSEEVVRLGTGELAKGLLPVKQTEEVLASLSLEASHLSYEEAKGSLA
FT                   LREAVCEFVSKYGIHVSPSSVLIVSGALQALSLMTNGLFQAGARVAVESPSYLMSLRIL
FT                   TSANIRGVQVPLADVQHKPSVLRQYKRQQDVQMFYTIPTFHNPTNVTYSTAVRKELLHV
FT                   CQAIQLPIIEDDVYRELWFDAAPPPPLKSLDQTGNVLYLGSMSKIISPGLRVGWVIGPE
FT                   PVIHRLADMKMQTDYGASSISQAIAQRWLTNNDWFTSHAQFVRDKLKNQRNAMLQLLQE
FT                   HMGELAEWNRPSGSFYIWCKLKHPVDMNRVFHRCLKDNVLIHPGTIYEGSKHSYIRLSY
FT                   SYETGERLEYGIKALARVIHEMLA"
FT   CDS_pept        459975..460472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0433"
FT                   /product="phosphinothricin N-acetyltransferase"
FT                   /note="BH0433"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04152"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04152"
FT                   /db_xref="GOA:Q9KFP5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFP5"
FT                   /protein_id="BAB04152.1"
FT                   /translation="MESIRIIEMTDNDWPEVERIYREGIETGNATFETEAPSWEKWDAG
FT                   HVKRCRFVAKSKEKVVGWVALSPVSSRCVYQGVAEVSVYVGSTGRGKGVGRKLLASVVE
FT                   ESEKQGYWTLQASVFPENVASLKLHRQLGFREVGKRERLAKREGVWRDVILLERRSEKV
FT                   GL"
FT   CDS_pept        461345..462628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0434"
FT                   /product="transposase (03)"
FT                   /note="BH0434"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04153"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04153"
FT                   /db_xref="GOA:Q9JWR2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWR2"
FT                   /protein_id="BAB04153.1"
FT                   /translation="MNYTQNQKISQITPSTLVIGIDVAKDKHVARAQDDRGLEFGKRLI
FT                   FENRIHGFELLLEWALRHAKENSKDHIIFGVEPTGHYWLNLAYYLTAKDFDFVLVNPMH
FT                   VKKSKELDDNSPTKNDTKDAKVISQLIKDGRYSVPNLLDGIYAELREGVKLRDQLIQQL
FT                   LITEGRIQNIIDRYFPEFFDVFGDWEGKAAFCTLKLFPFPSQIVKMTPEEVLRQWKPFV
FT                   QRGVGIKRATKLVETAHKSIGITIGSHFAQREMSSLLDQWELFKKQLEELDQELEGVVR
FT                   TIPGANEMIDITGLGVATVTTVLSEIGDLKKYKHPQQLVNLAGLSLRENSSGKFKGQTT
FT                   ITKRGRSKLRRALYLAIRPLVAHNPTFKALHHYYTKRPDKPLKKQQSLIALCCKLLRVL
FT                   FVIGQKQCPFDGSKLLQGIPQEKTLQAA"
FT   CDS_pept        463065..463442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0435"
FT                   /note="BH0435"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04154"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04154"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFP4"
FT                   /protein_id="BAB04154.1"
FT                   /translation="MGIVLIPEEHEFPMIIHQKISKVISEQSFGIYDDSTLQAIECHTT
FT                   LRGTPTLQDHILFVADKIEWDQSGTPPYIQELLKALDVSIYHASFSYIKYLMDRKHSLI
FT                   VVHPWLIDAHSHLEKVLNKQI"
FT   CDS_pept        complement(463511..463927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0436"
FT                   /product="transposase (14)"
FT                   /note="BH0436"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04155"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04155"
FT                   /db_xref="GOA:Q9KFP3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFP3"
FT                   /protein_id="BAB04155.1"
FT                   /translation="MVDDRNVCMCLTVAISTMNALILWQMMVTFLTRLRKNEVIREVYA
FT                   FKLHEDTTILSDQIILIATTQNRTENYFRLLRVLDSKGNELQLLTNRFDLSTEDISERY
FT                   KSCWAIELFFKWVKGSKSFTVKVNGPSTIKCLSH"
FT   CDS_pept        complement(464113..464292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0437"
FT                   /note="BH0437"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04156"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04156"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFP2"
FT                   /protein_id="BAB04156.1"
FT                   /translation="MRQEIIYFLEHTTDAAVMKRVIDNLDHKGLWMLIQYLERTNQQTK
FT                   QKWHEALNAHLRLS"
FT   CDS_pept        complement(464315..466585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0438"
FT                   /product="homosystein methyl transferase"
FT                   /note="BH0438"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04157"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04157"
FT                   /db_xref="GOA:Q9KFP1"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KFP1"
FT                   /protein_id="BAB04157.1"
FT                   /translation="MLTSNLGYPRIGENREWKKALESFWANDTTEEQLLATMKELRLNH
FT                   LRVQQEQEVDLIPVGDFTLYDHVLDMAVMFGIIPKRFLQQGDTPTLSTYFAMARGSKNA
FT                   QACEMTKWYNTNYHYIVPELHDAAPRLTKNAPLEAYLEAKNELGIDGKPVILGPYSFVK
FT                   LAKGYEEDKLQETIQSLLPLYIQVIQELVDAGARSIQVDEPSLVTSISAREMALVTRIY
FT                   EQINEAIADAPLFLQTYFDAVTFYEEVVSLPVKGIGLDFVHGGAKNLEALRTFGFPEDK
FT                   VLAAGIIDGRNIWISNLRERHELVHQLEQHVAKDRLVLQPSCSLLHVPVTTKREEKLDP
FT                   TLLGVLAFANEKLTELHTLKQLAAGNEAEVKEALEANDDALAALEKSGWRSGAATSHNL
FT                   ENKKRPQSFNERRPLQEEKWQLPLLPTTTIGSFPQTKDVRRTRSLWRKGELSTVEYERT
FT                   MKSYIEKWINIQEELGLDVLVHGEFERNDMVEFFGEKLDGFAFTANGWVQSYGSRCVKP
FT                   PIIYGNVSFTEPMTVAETVYAQSLTDKPVKGMLTGPVTILNWSFVRDDLPLTVIAHQIA
FT                   EALTHEVTALEEAGIEMIQIDEPAIREGLPLKAEDQQEYLDWAVSAFRASCAHVKATTQ
FT                   IHTHMCYSEFHEMIEAIDDLDADVISIETSRSHGEMISAFEKTTYEKGIGLGVYDIHSP
FT                   RVPSEEEMLNVIRRALTVLPASLFWVNPDCGLKTRAEKETVAALKNMVAAARAAREELK
FT                   TKA"
FT   CDS_pept        467276..468229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0439"
FT                   /note="BH0439"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04158"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04158"
FT                   /db_xref="GOA:Q9KFP0"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFP0"
FT                   /protein_id="BAB04158.1"
FT                   /translation="MGLKKAGASLLLATSLFLTACGSSATDSEVSEGDAVGGTDSEAYV
FT                   PESLMVQFVPSQNAETLEARAKPLENLLSDELGIDVEVSVSTNYNTVVEAMASGQVDVG
FT                   FLPPNAYVQAHDEYGAAEVILQSQRFGVNEDGSPTDELVDYYLSMFIARADSDIESIAD
FT                   IKGKTVAFQDYTSSAGYVWPAAILLDEGIDPLTDVNPLILQGHDAGVTAVLNGEADVAA
FT                   IFQDARNVVAGDFPTVFEDTKVISFTEPIPNDTISVRSDMDDEWKKKIQQAFIKIGQSE
FT                   EGLEIIRDIYTHEGYTESEDATFDIVRDYAERVQGE"
FT   CDS_pept        468488..469261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0440"
FT                   /product="transport system protein"
FT                   /note="BH0440"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04159"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04159"
FT                   /db_xref="GOA:Q9KFN9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KFN9"
FT                   /protein_id="BAB04159.1"
FT                   /translation="MIELKNVSKVYPNGVIGLDNINLTIEKGEFVAIVGLSGAGKSTLL
FT                   RAMNRLIDISDGDIMINRRSITSASGKELRMMRRDIGMIFQNFNLVKRSTVLRNVLSGR
FT                   VAHNHTFRTLFNLFPQKDVDLALQSLERVNILEKAYTRSSQLSGGQQQRVSIARALAQE
FT                   AKMILADEPTASLDPVTTKQVMDDLKKINTEDQVTVVINLHFVDLAREYATRIIGLRDG
FT                   KVVFDGPAQRATDEVFKDIYGRPLKEDELLGKEVG"
FT   CDS_pept        469261..470052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0441"
FT                   /product="phosphonates transport system (permease)"
FT                   /note="BH0441"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04160"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04160"
FT                   /db_xref="GOA:Q9KFN8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFN8"
FT                   /protein_id="BAB04160.1"
FT                   /translation="METKLNDRVPIKPSRHSFYLFLVILFIIVFASAIYIEADPYVIVQ
FT                   NGSNMFDLISRMFPPDWSYIVTTTPAMLDTIRMALLGTTMGTILSIPVMFLCARNMFHV
FT                   RWLVEASRIGLNVLRTIPDLLLAAIFAAILGYSSLAGIVALSVFSVGIIAKLSFEAIEN
FT                   IDDGPLESMTAVGANKLQWIAFGVVPQIMPHFVSYVLYTFEINIRAAAILGLVGAGGIG
FT                   LFYNRALSSFNYDQVLALILYTLVVVILIDLISLKTREKLL"
FT   CDS_pept        470049..470852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0442"
FT                   /product="phosphonates transport system (permease)"
FT                   /note="BH0442"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04161"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04161"
FT                   /db_xref="GOA:Q9KFN7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFN7"
FT                   /protein_id="BAB04161.1"
FT                   /translation="MKRSDLFKKERFLRRAKFSLLFIVLLALYGWAIAGIQFNGMLDTA
FT                   WPVTKSIVQGFLTPDTSYIYNPEGEDLLRGLLETLAIAIVGICLSIVLAIPIGLWAAKN
FT                   LSSTPLISQGGKSTLSFIRTLPDIILALLFIKVVGPGAYAGMLALGIGAIGMLGKLYAE
FT                   EVEAMDPGPVESIVAVGGNKLEQLAFGVIPQVLPGFISATLYRFEINMRSAATLGVIGA
FT                   GGIGTPLIFAIQARNWDRVGMIMIGVVLVVLIVDWCSSALRKRVL"
FT   CDS_pept        complement(470914..471450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0443"
FT                   /note="BH0443"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04162"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04162"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFN6"
FT                   /protein_id="BAB04162.1"
FT                   /translation="MIELLDFNESDFDQLLKHIESPEFLKQWSGSAFTYPLTRSQLASY
FT                   IDGANMDGSDQYIFKVKAVGSSETIGHIALGKVDRVNESARMGKVLVFPAARGKGFAAP
FT                   MIEELLRIAFEQLSLNRVSLGVFSFNVRAIHRYEKIGFQREGLLRQNTKVKGEYWDLIE
FT                   MSMLKREWNERKYSQ"
FT   CDS_pept        471640..471945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0444"
FT                   /note="BH0444"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04163"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04163"
FT                   /db_xref="GOA:Q9KFN5"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFN5"
FT                   /protein_id="BAB04163.1"
FT                   /translation="MQLEEIAFYGSSIGGLLVIIAFVVFWIVAKQAGETGHANEIFLKV
FT                   YRLMFSVLAIFILSSVVFNLGEKVTGHLFQQVSLTVFSIATFLGAVYLLILNKTRS"
FT   CDS_pept        472000..472920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0445"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="BH0445"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04164"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04164"
FT                   /db_xref="GOA:Q9KFN4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFN4"
FT                   /protein_id="BAB04164.1"
FT                   /translation="MTTTNYLIETNNLTMTYKHVHAVDRINLKVKEGEIYGFLGPNGAG
FT                   KTTTIRMLLGLIKASHGSIKIFGKDLKQHRLDILKNIGALVESPSYYPHLSGEDNLETV
FT                   RKIVKVPKSRIAEVLELVRLTKVADRKVQEYSLGMKQRLAIAAALLANPRLVILDEPTN
FT                   GLDPAGIIEIRNLILRLPKEYGITVLLSSHLLSEVEQVASQVGIIAKGKLIFQDSIEEL
FT                   RKKANRKIFLSTSHPEVAATILQERGINVDTQARGLVMNDRSDEEIAQLVKAFVEKDID
FT                   VYRISDETSSLEEIFLQLTKGGQTL"
FT   CDS_pept        472917..473627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0446"
FT                   /note="BH0446"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04165"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04165"
FT                   /db_xref="GOA:Q9KFN3"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFN3"
FT                   /protein_id="BAB04165.1"
FT                   /translation="MILDLLRSDLLKTKKIAWLLVLFGPIGVVGLQFINYSLRYDHLLS
FT                   VHPDHGYFFLVNVHAFWPPALLLGITLIISLQASIEHQKNLWKQILILPVRREQVYLSK
FT                   LFLIVTMLLLTSLFLVGWTYVTGIYFGFTNEFSLLQAFQMSFYTLFAAWPFVLLQFWLS
FT                   MHFKNQGAALTVGIASAAFIMYAQGVPDWLPWKWPLLLDGFSESLSTSVLYGSILGIVF
FT                   ALLSMLVLTRKDVH"
FT   CDS_pept        473629..474372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0447"
FT                   /note="BH0447"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04166"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04166"
FT                   /db_xref="GOA:Q9KFN2"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFN2"
FT                   /protein_id="BAB04166.1"
FT                   /translation="MFFNVLEVEWNKLKHMKVWIIVIAGPLLASVIGFFPYFTIDASEW
FT                   IALATQMILAHSALFLPLLTGIYAALICSYEHQHGGWKQLLALPVERYHVYIAKFVVII
FT                   TLLLLTQIVFFFSVWLVGVARGYSISSFTYMPLLVSVLAGFLSCLPLAALQLWLATRFT
FT                   SFAAPSVMNVMLTVPAILIANSEVLGPLYPWAHPLLSMTQGFSMGLGGDAGFLASNTAF
FT                   VVTLILSFLLFSVGGVISFQRKQWT"
FT   CDS_pept        474403..475326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0448"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="BH0448"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04167"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04167"
FT                   /db_xref="GOA:Q9KFN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFN1"
FT                   /protein_id="BAB04167.1"
FT                   /translation="MIIEAKGLKKIYNHVPVVDDVDLLVPEGEVFGFLGPNGSGKTTVM
FT                   RMLLGLVKTDGGDIKILGKSLEKNRLSILKEVGALIETPAYYGHLNAIDNLKIAATLRQ
FT                   IEDHSQIEKTLDRVGLTSSKHKKVKSFSLGMKQRLGIAMALLHQPKLLLLDEPTNGLDP
FT                   EGIQEMRELIRDLPKKEGVTVFVSSHLLGEIDQVASQVGVIYHGSLLYQGQKNDLLASH
FT                   GGTTVSVHTPEKDKVEQLLVMEGFHVQKSIRHKEDEIMITGPHVTKEVIVMLLQREGIQ
FT                   NYYVQEHHRTLEDAYMALIGGKGVAV"
FT   CDS_pept        475323..476039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0449"
FT                   /note="BH0449"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04168"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04168"
FT                   /db_xref="GOA:Q9KFN0"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFN0"
FT                   /protein_id="BAB04168.1"
FT                   /translation="MSHLLKVEWRKQRKGVLLVPILLCLILLPVIGGMAFSYLIQNDRT
FT                   VEQVWAIIYETFHLLWSYVVIIVIVIYAALVVDVEHRSGMWPSVLLYPYAKWKHFFIKV
FT                   LWVFILVQLFGLISWVSIATVSLLYGGVESSELIAFGTLLYLPFLLALPFVIFQTFLSV
FT                   VLSNSFVSMGIGMFVFLFHNLLPSVWLPWGSMIQPFLEGQPVNVVDIIFLMVGAALYTM
FT                   ISLFFFERKTFSTGVE"
FT   CDS_pept        476041..476799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0450"
FT                   /note="BH0450"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04169"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04169"
FT                   /db_xref="GOA:Q9KFM9"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFM9"
FT                   /protein_id="BAB04169.1"
FT                   /translation="MSLFRQSFMAEWMKIRKSTIWLVILGLVALPVFYGCIIFTQIVVK
FT                   QYNYTDSDPWLMQLMMVQMFYGTIFLPIIVSIIIETVLNFERKANEWEHLFLFPIKRNT
FT                   FYLSKMAWVFILTALAQLLMFTMVVIAGIVIKIDTTIPVLSYLSVFILGTIGAISLGSL
FT                   LFYLFMLIKSSRVALAISIFLSFPAFLALSNESGSWLPSLYPWALPIYGMTQSMSSVSS
FT                   LLVFLGVCFILIILSSFLTIKRLKNGALSG"
FT   CDS_pept        complement(476922..479096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0451"
FT                   /product="lantibiotic mersacidin transporter system"
FT                   /note="BH0451"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04170"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04170"
FT                   /db_xref="GOA:Q9KFM8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033839"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFM8"
FT                   /protein_id="BAB04170.1"
FT                   /translation="MTDNKIKHRRKVPFIEQLQQTECGLCCMAMIVKYYKGHVSLHYLR
FT                   ERMANGRDGTTLLHLKQLAKHLGFEAKVYQTPAEHLHMHQLPAILFWEGKHFVVLEKVT
FT                   KNHYYIVDPALGRLKIRQDELQQKYTGYILTCNPERQPDYQKPKNLWKPYLTYMVKKPK
FT                   LLLFIIAVSVTLQLLTLANPLLVQFVIDFILLPENREMLQVFLIGLSCYVFSQAFFVFI
FT                   QGRALVIMQNHLDREMMTKFFRHLLNLPYHFFQVRSFGDILFRAGSLRVIRDLLANQLL
FT                   KGILDIGMLVVILAYMTLFSPLLTLIVFLLATVNGLIIYFSRPKISEANQKEIMKQSEV
FT                   QATQTETMYGIFGIKTAGVEDTMYQKWENRFDKLILAYKNKEYILNNVNTATTFLTVIA
FT                   PLIVLYIGSHQVLAQAVTMGTVVAFYSVTTQFFGLSSSLVHTINSFILANAYLGRAQDV
FT                   FDSKEEDIGENRKALHNLHGEITLKDVSFSYSRFGQEVVKDVSLRVAPGTKVALVGKSG
FT                   SGKSTLSKIMLGLYEPTKGEVYYDGYNLNDLNKRALRQKIGVVPQDVTLLNQSIRENIA
FT                   LHNPDTSMEDIIEAAKIAQVHEEIMNMPMNYETLVSEMGHNISGGQRQRIALARALVHK
FT                   PKILLLDEATSSLDHVNEAKIDQYLSAMKCTRIVIAHRLTTIMNADLIIVLEDGKIIET
FT                   GTHTELLNQSGYYASFYNNYSEEQKVPQSI"
FT   CDS_pept        complement(479086..482058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0452"
FT                   /product="lantibiotic mersacidin modifying enzyme"
FT                   /note="BH0452"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04171"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04171"
FT                   /db_xref="GOA:Q9KFM7"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017146"
FT                   /db_xref="InterPro:IPR025410"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFM7"
FT                   /protein_id="BAB04171.1"
FT                   /translation="MKTPLTSEHPSVPTTLPHTNDTDWLEQLHDILSIPVTEEIQKYFH
FT                   AENDLFSFFYTPFLQFTYQSMSDYFMTFKTDMALIERQSLLQSTLTAVHHRLFHLTHRT
FT                   LISEMHIDKLTVGLNGSTPHERYMDFNHKFNKTSKSKNLFNIYPILGKLVVNETLRTIN
FT                   FVKKIIQHYMKDYLLLSDFFKEKDLRLTNLQLGVGDTHVNGQCVTILTFASGQKVVYKP
FT                   RSLSIDKQFGEFIEWVNSKGFQPSLRIPIAIDRQTYGWYEFIPHQEATSEDEIERYYSR
FT                   IGGYLAIAYLFGATDLHLDNLIACGEHPMLIDLETLFTNDLDCYDSAFPFPALARELTQ
FT                   SVFGTLMLPITIASGKLLDIDLSAVGGGKGVQSEKIKTWVIVNQKTDEMKLVEQPYVTE
FT                   SSQNKPTVNGKEANIGNYIPHVTDGFRKMYRLFLNEIDELMDHNGPIFAFESCQIRHVF
FT                   RATHVYAKFLEASTHPDYLQEPTRRNKLFESFWNITSLMAPFKKIVPHEIAELENHDIP
FT                   YFVLTCGGTIVKDGYGRDIADLFQSSCIERVTHRLQQLGSEDEARQIRYIKSSLATLTN
FT                   GDWTPSHEKTPMSPASADREDGYFLREAQAIGDDILAQLIWEDDRHAAYLIGVSVGMNE
FT                   AVTVSPLTPGIYDGTLGIVLFFDQLAQQTGETHYRHAADALLEGMFKQLKPELMPSSAY
FT                   FGLGSLFYGLMVLGLQRSDSHIIQKAYEYLKHLEECVQHEETPDFVSGLSGVLYMLTKI
FT                   YQLTNEPRVFEVAKTTASRLSVLLDSKQPDTVLTGLSHGAAGFALALLTYGTAANDEQL
FT                   LKQGHSYLVYERNRFNKQENNWVDLRKGNAYQTFWCHGAPGIGISRLLLAQFYDDELLH
FT                   EELNAALNKTISDGFGHNHSLCHGDFGNLDLLLLYAQYTNNPEPKELARKLAISSIDQA
FT                   HTYGWKLGLNHSDQLQGMMLGVTGIGYQLLRHINPTVPSILALELPSSTLTEKELRIHD
FT                   R"
FT   CDS_pept        complement(482191..482388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0453"
FT                   /product="lantibiotic cytolysin precursor"
FT                   /note="BH0453"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04172"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04172"
FT                   /db_xref="GOA:Q9KFM6"
FT                   /db_xref="InterPro:IPR027632"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFM6"
FT                   /protein_id="BAB04172.1"
FT                   /translation="MVNSKDLRNPEFRKAQGLQFVDEVNEKELSSLAGSGDVHAQTTWP
FT                   CATVGVSVALCPTTKCTSQC"
FT   CDS_pept        482580..482789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0454"
FT                   /product="lantibiotic mersacidin precursor"
FT                   /note="BH0454"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04173"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04173"
FT                   /db_xref="GOA:Q9KFM5"
FT                   /db_xref="InterPro:IPR029243"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFM5"
FT                   /protein_id="BAB04173.1"
FT                   /translation="MTNLLKEWKMPLERTHNNSNPAGDIFQELEDQDILAGVNGACAWY
FT                   NISCRLGNKGAYCTLTVECMPSCN"
FT   CDS_pept        482858..486037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0455"
FT                   /product="lantibiotic mersacidin modifying enzyme"
FT                   /note="BH0455"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04174"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04174"
FT                   /db_xref="GOA:Q9KFM4"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017146"
FT                   /db_xref="InterPro:IPR025410"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFM4"
FT                   /protein_id="BAB04174.1"
FT                   /translation="MRELQNALYFSEVVFGPNLEKIVGEKRLNFWLKLIGEDPENLKEF
FT                   LSRKGNSFEEQTLPEKEAIVPNRLGEEALEKVREELEFLNTYSTKHVRRVKELGVQIPF
FT                   EGILLPFISMYIEKFQQQQLRKKIGPIHEEIWTQIVQDITSKLNAILHRTLILELNVAR
FT                   VTSQLKGDTPEERFAYYSKTYLGKREVTHRLYSEYPVVLRLLFTTISHHISFITEILER
FT                   VANDREAIETEFSPCSPIGTLASLHLNSGDAHHKQRTVTILEFSSSLKLVYKPRSLKVD
FT                   GVFNGLLAFLNDRTGEVIKDQYCPKVLQRDGYGYVEFVTHQSCQSLEEVSDFYERLGSL
FT                   MSLSYVLNSSDFHFENIIAHGPYPVLIDLETIIHNTADSSEETSTAMDRAFRMLNDSVL
FT                   STGMLPSSIYYRDQPNMKGLNVGGVSKSEGQKTPFKVNQIANRNTDEMRIEKDHVTLSS
FT                   QKNLPIFQSAAMESVHFLDQIQKGFTSMYQWIEKNKQEFKEQVRKFEGVPVRAVLRSTT
FT                   RYTELLKSSYHPDLLRSALDREVLLNRLTVDSVMTPYLKEIIPLEVEDLLNGDVPYFYT
FT                   LPEERALYQEASAINSTFFTTSIFHKIDQKIDKLGIEDHTQQMKILHMSMLASNANHYA
FT                   DVADLDIQKGHTIKNEQYVEMAKDIGDYLMELSVEGENQGEPDLCWISTVLEGSSEIIW
FT                   DISPVGEDLYNGSAGVALFYAYLFKITGEKRYQEIAYKALVPVRRSVAQFQHHPNWSIG
FT                   AFNGASGYLYAMGTIAALFNDERLKHEVTRSIPHIEPMIHEDKIYDFIGGSAGALKVFL
FT                   SLSGLFDEPKFLELAIACSEHLMKNAIKTDQGIGWKPPWEVTPLTGFSHGVSGVMASFI
FT                   ELYQQTGDERLLSYIDQSLAYERSFFSEQEENWLTPNKETPVVAWCHGAPGILVSRLLL
FT                   KKCGYLDEKVEKEIEVALSTTIRKGLGNNRSLCHGDFGQLEILRFAAEVLGDSYLQEVV
FT                   NNLSGELYNLFKTEGYQSGTSRGTESVGLMVGLSGFGYGLLSAAYPSAVPSILTLDGEI
FT                   QKYREPHEANH"
FT   CDS_pept        486075..486155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0456"
FT                   /note="BH0456"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04175"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04175"
FT                   /db_xref="GOA:Q9KFM3"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFM3"
FT                   /protein_id="BAB04175.1"
FT                   /translation="MEWNVLVGVIIIFAVAIGLFSMKKKK"
FT   CDS_pept        complement(486190..486564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0457"
FT                   /note="BH0457"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04176"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04176"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFM2"
FT                   /protein_id="BAB04176.1"
FT                   /translation="MSVSHVKDVRSSTEARGNRQIHYNPVYEELKAKQHQKRKSEEGRT
FT                   LYQKRKTDVERVFGHVKQNLGFRRLPSSRQRKRAHRARACGPCPQPKETSDGGSSLEGT
FT                   NENTSTQKSGELHQTVLPIL"
FT   CDS_pept        486789..486995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0458"
FT                   /note="BH0458"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04177"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04177"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFM1"
FT                   /protein_id="BAB04177.1"
FT                   /translation="MNFGSGTFILNDWAIFCMFFRALMGVERATRRRLLREKQQRKIAE
FT                   SGVLEEAGALPAESVRQVAISNE"
FT   CDS_pept        complement(487054..487347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0459"
FT                   /note="BH0459"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04178"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04178"
FT                   /db_xref="GOA:Q9KFM0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFM0"
FT                   /protein_id="BAB04178.1"
FT                   /translation="METWIPFLNAISSITFLVFIVLMIIMKREGDDERAQAMQYRLFRF
FT                   SFFFVMAGLSFLILISGWIEMTYTTFRSLTTTMFSLTLISALCYWLYLQRKF"
FT   CDS_pept        complement(487350..487574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0460"
FT                   /product="transcriptional regulator"
FT                   /note="BH0460"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04179"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04179"
FT                   /db_xref="GOA:Q9KFL9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFL9"
FT                   /protein_id="BAB04179.1"
FT                   /translation="MKKKGKISNRINVLRAENSMTQKQLAERAGVTRQTIISIEKNKYV
FT                   PSLALAFEIAHALNADIHEVFQYIQDEEE"
FT   CDS_pept        487819..488190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0461"
FT                   /note="BH0461"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04180"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04180"
FT                   /db_xref="GOA:Q9KFL8"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFL8"
FT                   /protein_id="BAB04180.1"
FT                   /translation="MRYKREEAFRYEFPTPIIATLLVYEEGELLAKDERCEVINMSLGG
FT                   ARIRSSLNIKNHSRVELRYMMVQNNVMLMLPGDIVWKESTYTHQHYGLKLVLDVEAEDR
FT                   LLRDLKARAKIMQSLPDKT"
FT   CDS_pept        488253..488576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0462"
FT                   /note="BH0462"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04181"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04181"
FT                   /db_xref="GOA:Q9KFL7"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016941"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFL7"
FT                   /protein_id="BAB04181.1"
FT                   /translation="MKRLLNYFRRMKFLLRFSRSLPFFREFFFTKQISVKKKLIGVALI
FT                   VGYALFPYDLIPDFLLGIGILDDVFVATLVLNWFMKLAPEQLKTKYQLIEKKDDSSENP
FT                   RIN"
FT   CDS_pept        complement(488573..489691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0463"
FT                   /note="BH0463"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04182"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04182"
FT                   /db_xref="GOA:Q9KFL6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="InterPro:IPR014227"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFL6"
FT                   /protein_id="BAB04182.1"
FT                   /translation="MNHPTLLLIARLLIVALLIATGLYALYFFLSLTYPFLIAALLAFF
FT                   MNPIVNTLEKDIRLPRPLAVLVSLLLLFGLIGGLVTIMIVKMIDGFRYLSLMVPTQIER
FT                   ISMTIQNYVNEQILPLWNQGLGLIDRLEPSQQRALEEGIQQLGGQLASLLGNLGQAIAN
FT                   GLSHIVSALPLTLTVVVFIILGLYFISKDWNKFKMAARTRLPFIVRRRTLDVIKDLKTK
FT                   VFGFITAQVILISLTALINFIGLLVLQVEHPFTIALIIGLVDLLPYLGTGIILIPWGIY
FT                   SIVTGNLFLGVGLLALYGLTVLIRQLAEPKVLSSSLGLNPLATLISLFAGLQLFGVLGL
FT                   VIGPVLLVLLLSLYQANVLNGIWRFIKGESTR"
FT   CDS_pept        complement(489711..490535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0464"
FT                   /product="bacitracin resistance protein (undecaprenol
FT                   kinase)"
FT                   /note="BH0464"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04183"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04183"
FT                   /db_xref="GOA:Q9KFL5"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KFL5"
FT                   /protein_id="BAB04183.1"
FT                   /translation="MEWSQELWLLIKYLLLGLFQGFTEPIPVSSSGHLVLLQHFLGIEI
FT                   EGLSFEVMVNFASLFAVIAIYRFDLLKLVKGSARYVLYQDAQGKGDFRISFYLLLATVP
FT                   AVLAALLFKDWIETELKQLHVIAFALLITGMALWLIRHLNGRKQDGDITLKDALLVGLA
FT                   QTAALIPGISRSGATIVAAMGLGWRQETALRFSFFLYIPISLGSGVLAISDIVQDPHFT
FT                   ALWIPYTIAFIGSFIASYVSLLWFMNIMRHGKLIYFALYCWLAGLIVLSLLS"
FT   CDS_pept        complement(490644..491600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0465"
FT                   /note="BH0465"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04184"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04184"
FT                   /db_xref="GOA:Q9KFL4"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFL4"
FT                   /protein_id="BAB04184.1"
FT                   /translation="MSYVLLLLGFALLIKGADFFVDGSSSIARLLNVSPLLIGLTIVAF
FT                   GTSSPEATASIIAALNGNPDVALGNVIGSNMFNITLVVGLTALLSPLIVTNATLRKEIP
FT                   FTLLASIALYIFINDQMIEGAVESTLSRSEGLILLLIFCVFLYYIFEVARTSPREQKIV
FT                   QDFAIKPTWRKNIFLSILGLAMIIGGGELVIRHSTAIAFSHGMSETLVGLTIVAIGTSL
FT                   PELVTSLTAALKKESEIALGNIVGSSIFNIFFVLGTAATITPMHVDSRVVVDLLLLIFL
FT                   TLLLLVFSRTRYTVGKYEGLILASFYIGYMVYIIWRN"
FT   CDS_pept        491844..492347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0466"
FT                   /note="BH0466"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04185"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04185"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFL3"
FT                   /protein_id="BAB04185.1"
FT                   /translation="MITIEPAKKQHVEGIVRVCSEGYRQTYRETYSTEYMERVIREFYD
FT                   YERIEKELKVSQEWGGWFVAIDDGQVIGAGAGGLTADHVGEIFVLYMDPVRRGEGVGTE
FT                   LLEAITAQQKEFGAMEQWVSVAKGNEKGIPFYEAKGFICIDEKKSYATTEEEAYTSLRY
FT                   KRSI"
FT   CDS_pept        complement(492435..493103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0467"
FT                   /note="BH0467"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04186"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04186"
FT                   /db_xref="GOA:Q9KFL2"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFL2"
FT                   /protein_id="BAB04186.1"
FT                   /translation="MAKREKKQFAVIGLGRFGGSICRELYSMGHEVLAIDKNADKVNEF
FT                   TATATHTVVAEATDEKALTSLGIRNFDYVIVCIGEDIQASILATLLLKEMDIKNVWVKA
FT                   QNHYHHKVLDKIGADRIIHPEYEMGMRIAQSLSSEKVVDFIELSDEYSIMELLATEKVA
FT                   GKTLIELDVRAKYGVTILAIKRGEEINVSPVPDEMIKNRDLLIVIGHKNDLKRFEDEGL
FT                   "
FT   CDS_pept        493609..494580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0468"
FT                   /product="phosphonates transport system (phosphate-binding
FT                   protein)"
FT                   /note="BH0468"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04187"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04187"
FT                   /db_xref="GOA:Q9KFL1"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFL1"
FT                   /protein_id="BAB04187.1"
FT                   /translation="MKKWLQGLMVAAVAVGMTACGSSETTGEDKQAEGNTGEVDHAEVD
FT                   RSNWPETFVYGILPTEDQGELASRFEALEDYLEEKVGIEFELFVGTDYNALIEGMRNGH
FT                   VHASGFGPFSYMLAHERANAEAFATGVSDPEDAFYYSWFITLEETNLNGLEDLDGATIA
FT                   YADPASTSGHIFPKGMLITELGLTMDNVDDYFSYVTFSGSHEASLYSVLNGDVDVAGVC
FT                   SSCIENIYDRVEDHPNFEQLKVIAESDPIPNGPQAISMDLPEDLRELIIDAFLTMHEDP
FT                   SMQEFLESNGYDAGYIEVDDSMYDVVRETAEALEMSAEDLLN"
FT   CDS_pept        494716..495459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0469"
FT                   /product="phosphonates transport system"
FT                   /note="BH0469"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04188"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04188"
FT                   /db_xref="GOA:Q9KFL0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KFL0"
FT                   /protein_id="BAB04188.1"
FT                   /translation="MGEMILRVEGLKKVYPDGTVGIKEINTSIRRGELISVIGPSGAGK
FT                   STFLRSINRLVEPTSGAIFVEGENICNARGKKLRQMRRKIGMVFQHYNLIKRSSVLQNV
FT                   LHGRLGYMSTIKGGLGRFHESDTKRALSILKRVGLEEQALKRADELSGGQQQRVGIARA
FT                   IAQNPTLILADEPIASLDPTASENVLHYMKTICQEEGITTVVNLHQVEFAKKFADRMIG
FT                   IKAGKIVFDGTPRELTDYTVDQLYQ"
FT   CDS_pept        495474..496340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0470"
FT                   /product="phosphonates transport system (permease)"
FT                   /note="BH0470"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04189"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04189"
FT                   /db_xref="GOA:Q9KFK9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFK9"
FT                   /protein_id="BAB04189.1"
FT                   /translation="MSLPAEQLTEKQLSRSKKHEGKSVDQLFQDWKQRKKMVRKNRMFT
FT                   LIVLVALIIWSWVETGFQLTYLFSGASNMATFIFEDLLPPDMTAIGLFLKPAFDTVIMS
FT                   YVGMVISVIASLFFGFLAAKNLSFHPLISVLSRSFIAFLRAVPALVWGIVMVAAFGLGP
FT                   FAGTLAIGLSGVGILAKAYADMLEELDTGQLEAIRATGATWFQLVGQGVWPQFKAGFVG
FT                   WSLYKMDLNIREAAVLGLIGAGGIGTALQSSISLFQYQQAAVGILMIWGLILIVEFTTA
FT                   KIRERLL"
FT   CDS_pept        496337..496627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0471"
FT                   /note="BH0471"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04190"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04190"
FT                   /db_xref="GOA:Q9KFK8"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFK8"
FT                   /protein_id="BAB04190.1"
FT                   /translation="MSQWAQQKNRTTKQIIGFLAAVFFLYSMFHLEIVPERVIQSWERS
FT                   QSLILGMFPPTLDEPIDVLGAALESLHVAVMGTVLGVIFSIMLACFAAKNL"
FT   CDS_pept        497040..498293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0472"
FT                   /note="BH0472"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04191"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04191"
FT                   /db_xref="GOA:Q9KFK7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFK7"
FT                   /protein_id="BAB04191.1"
FT                   /translation="MTKSEHAPESKSVKVVALVTALCLLGDSLLYVALPIYYREVGLQS
FT                   LWEVGIILSLNRFVRIPINPLVGKCYQHVTLRTGLLIAVSLTLVTTIGYGVGYGFFVWV
FT                   ILRLLWGIAWSFLRLGGLFTVLEEATDSNRGKLMGQYNGLYRLGSLGGMLGGGILASFI
FT                   GLSATAIIFGVLAVLAIPYVLRYVPSLAQERTGQPEGDSTEKKRKGLYGRHAILAISSG
FT                   LLLALFLQGLFGSTLSLLMLEHYGETIYIVGMIVGVTALSGVLQGVRWVWEPFLAVLFG
FT                   HWSDGDRGRLPLFILFLIMTALGYGAMVLSLPLIIWLAAVIVVMVASTALTTLIDALTS
FT                   DVAKGQDANRVMTSYTVFLDVGAALGPLLAYFLLDIGLSLTFVYLSSAVIFLLLAVQWG
FT                   WCYLRDPFYRHDSMRKAV"
FT   CDS_pept        498318..498992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0473"
FT                   /note="BH0473"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04192"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04192"
FT                   /db_xref="GOA:Q9KFK6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFK6"
FT                   /protein_id="BAB04192.1"
FT                   /translation="MIFFDIDDTLLDHQGAERRGAAQFYHQYRHELPYGKADFLQAWEE
FT                   ASEHFYTKYLTGCLSLQEQRRERIRSFFPELLDVEADERFQDYLDYYEVNWRRFDDVKA
FT                   CLDRWTKAGLSLGVISNGSQQQQQSKLERLEIREFFRYVVTSEAAGVAKPDPHIFAYAC
FT                   NLAKEAVESCFYVGDRLKTDAVASQQAGLTGVWLNRLGKELRETDVIIIRSLDELDKYL
FT                   TI"
FT   CDS_pept        complement(499032..499751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0474"
FT                   /note="BH0474"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04193"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04193"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFK5"
FT                   /protein_id="BAB04193.1"
FT                   /translation="MKKLWLGLSTCVLSVMLVACGTGGTSGTEGEDPEEIVEDVENAED
FT                   EAVEEEDAVEEEPVDEEEAAEEEPTEEETTEDEASEETSDASEVKEIEVEVEGDKEMRS
FT                   AQFNRGELGYSIYVLENFSLTGEEPRRDVILSDYDGSFFTRIIQEGSSADTNALKNNII
FT                   EHTTGTIEDNYPTPLEDVDFSLREKVTSDDGETNIFHVAKTYPNGETYRFELYIPNKEA
FT                   QEGILPSFWAMLKTFQP"
FT   CDS_pept        complement(499869..500693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0475"
FT                   /note="BH0475"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04194"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04194"
FT                   /db_xref="GOA:Q9KFK4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFK4"
FT                   /protein_id="BAB04194.1"
FT                   /translation="MNHVPIVRILLWCVATSLIAMLILALVSIVFSLDVLSYVAEFLPL
FT                   VAVFTLWWRLKTHGVSLRTWLTFREGFPSFNSFTQLACWQLVFLLFSMAIVFVLMYFVA
FT                   LLFPSLLTDFIPNPSFLHDRSFIRGFLATVLIAPIVEEMFFRGFLLQKWAARYGLFTGA
FT                   IIASLVFALLHVNLGFLGHFMIGLFWSFLYMATKNIWLPIVLHAFHNLVLLVIFHLPIG
FT                   ETPETSELTVKMFYYTGYVGIALSLLSLPFILWKLQQVYKQAKANENFLTIN"
FT   CDS_pept        500799..501668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0476"
FT                   /note="BH0476"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04195"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04195"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFK3"
FT                   /protein_id="BAB04195.1"
FT                   /translation="MTISLRKLSDRVYYFPSDAATDRPVLAIIYGEGQSLMVDAGNSNR
FT                   HARTFLESLKAENLPMPSLAVLTHWHWDHVFGLRELRIPAVAHTRTYEALRRMQPLSWD
FT                   NSALDKRVEQGEEIAFCAEMIKREFGEMRDIDIVLPTITFHTKIELDLGGVRGTVEHVG
FT                   GDHAPDSSVIYLEEEKVLFLGDALYPNLYARNPEYTVNNMRGLLNKVRTYQADTYVLSH
FT                   QEPLDKLTFFHYIDVLQRLCDLTERYQGEREPMRAELQQIMGQKVDEIFLEAFTCFVNG
FT                   ALAEEEKR"
FT   CDS_pept        501675..502019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0477"
FT                   /note="BH0477"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04196"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04196"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFK2"
FT                   /protein_id="BAB04196.1"
FT                   /translation="MFERIDTIIMPVTEIEKAIQWYEENLNMRVSYRGEGYCVLSVGQG
FT                   ETPLTLEQADGSSTQGATRPILFAKNIHGVHQKLREKGVSVSDIQTEEANTFFHFVDLD
FT                   GNQLEVCYWE"
FT   CDS_pept        502045..502518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0478"
FT                   /note="BH0478"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04197"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04197"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFK1"
FT                   /protein_id="BAB04197.1"
FT                   /translation="MIKPWDPSDASYVIDSHYALYKKERGYDETFRAFIAKKVDEIKTR
FT                   GSDRERIWIVQEGKKRLGSIAITEESECVARLGLFLLAPEARGKGYGKQLIDSALTFCR
FT                   EVGYEKVTLTTNSDLHTARALYEKFGFAIVHQVKKQYSGYELVDETWERSLLS"
FT   CDS_pept        502536..503030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0479"
FT                   /note="BH0479"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04198"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04198"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041656"
FT                   /db_xref="PDB:3K9I"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFK0"
FT                   /protein_id="BAB04198.1"
FT                   /translation="MDVKQTLEKAIALRQNKRYQESNAILVTLCKEHAHDPQILYQCGW
FT                   SFDVLGLEAQAVPYYEKAIASGLQGKDLAECYLGLGSTFRTLGEYRKAEAVLANGVKQF
FT                   PNHQALRVFYAMVLYNLGRYEQGVELLLKIIAETSDDETIQSYKQAILFYADKLDETWK
FT                   A"
FT   CDS_pept        503083..503520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0480"
FT                   /product="small heat shock protein"
FT                   /note="BH0480"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04199"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04199"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFJ9"
FT                   /protein_id="BAB04199.1"
FT                   /translation="MSLTPYEPFRHLDQMRREFDRFFPDFPIDLPNRHLTLSPKMDVHE
FT                   TDHEVILECDIPGLESKEDLQIDVEPRSVRIEGRIKRSKEVHDERFYRREREIGHFRRV
FT                   VPLPAEVAEDDIRAAYRNGVLEVRMRKRLDDRRRTIDVEFH"
FT   CDS_pept        503838..504719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0481"
FT                   /product="ABC transporter (permiase)"
FT                   /note="BH0481"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04200"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04200"
FT                   /db_xref="GOA:Q9KFJ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFJ8"
FT                   /protein_id="BAB04200.1"
FT                   /translation="MVHDQSLGSRVFNIFNYLFLFLFSMICFLPFVHIVAGSFASVEEV
FT                   LQKRFILFPTTFSLDAYRYIFSTDIIFRSLIISILVTVVGTGFSMFLTSLMAYGLSRKD
FT                   LDGRRVLMFLVVFTMLFSGGMIPTFLVVRSLGLLDTYWALIIPTAINAFNLIILKNFFQ
FT                   NIPESLEESAKIDGCNDVGIFFRIVFPLSMPAIATISLFYAVTYWNTFMQAILYLNDSS
FT                   MWPIQVLLRQIVIMSSGMQGDLTELGAGFVMPPEQTIKMAVIVVATIPVLIVYPFIQKH
FT                   FAKGALLGSVKG"
FT   CDS_pept        504745..506283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0482"
FT                   /product="lipoprotein"
FT                   /note="BH0482"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04201"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04201"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFJ7"
FT                   /protein_id="BAB04201.1"
FT                   /translation="MKRMSLACRWLAFLSLLLLVVACSSSNEGTSAPAEEGEGNTEEEA
FT                   FDPDSPLDLDWMVILYHQQPPKDTVIKEIEELTNTNLDLIWVPDAVKEDRVNAALASGN
FT                   LPKVITLQDFRTSSVLNAFRSGQFWEIGPYLDEFPNLSEMNETILENVSVDGKIYGIYR
FT                   ERPLSRQGVVIRQDWLENLGLEMPTNLEELYEVARAFTYDDPNGSGADDTVGFTDRNDL
FT                   IFGAFKTLASYHGTPNEWGFDDEGKLMPEFMTDEYVETMNYMKSLYDEGLINTEFPVTS
FT                   KEQQQELFMTGRAGIYVGNMVDARNLRDKAKDINPEMEVAITNRIAGPDGEDRVWAQGG
FT                   HNGIFAIPKSSVETEAELKRILAFFDRIAEEDVYNLMAYGIEDVHYETIDGEYFERIEE
FT                   NLDDWAAEVQPLVSLVAREMNYLKAYGDPLYEEYERLTEDNNEIIVTNPAEPLFSPTYT
FT                   ERGTELQKIIDDATYKYILGELDEDGFEAEVERWLTNGGESIIEELNEDYERLN"
FT   CDS_pept        complement(506616..508925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0483"
FT                   /product="transcriptional regulator (AraC/XylS family)"
FT                   /note="BH0483"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04202"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04202"
FT                   /db_xref="GOA:Q9KFJ6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFJ6"
FT                   /protein_id="BAB04202.1"
FT                   /translation="MFKRKTTFYVRLILFILILSTLPVLLVGTFSYIKASDAIHEQVSE
FT                   DKRSSVYQTQTNIEHILKTADHSLTYFVNSSLLRDTLNQPLTATQFQLYNDIRKELTHL
FT                   QTYEIGIEDIVLLSTNQEWLMNNWGLQRITKKEIDDHFQRYFELPVNSTWIYEVDTWGS
FT                   EFNEELANSCSTQMNLVKKLPLNSNQKTGLAIASIPACSVNKILSENSQNEAFFLLDEQ
FT                   YRPVGYHNLSILEDDLLSDGTLIEALATQQTANGNGQFSLPLSHSTYTVTFRTSDYNQW
FT                   TYVSVISSRELAKQSNAIGAFTMYISAGVLLLSLLYSWVGSRRIYRPVQELYQMITATF
FT                   SAGSAKKPPKDEFELIHAHIHNVLDLNNELEEKLQGQIKQLKQFFVLNLIKGHMSPSEI
FT                   ETKYETFQYPKDWRQLHVLTLQIDSLEGTKYAKEEKDVLLFSINNLVETLIPEVERLTP
FT                   ALLNNTVVLILLTNVDQEQKRDGFVREKAEAIMNEVRQQLDISVSIGVSLPYDDITKTQ
FT                   EAYDEGIEALKYRIKLGCQSVIFFSNLAHTHSFHTYYPKQQENELFDALKLGDKSNVKD
FT                   HLDALIDGIFQKDLHPSQYQISLLRLLNNTIQLLQTLGIDSVDVYDKKTLFDQLFSLQT
FT                   IDEVKQWFFTKLIAPSVHTVAERMDSQYRTISDQIIHIIQNEFDMELTLESIAERLHYN
FT                   PNYLSSIFRKETNISFSEYLSSYRLAMAKKWLLETSMPIREIAERLCYGNSQNFIRSFK
FT                   KKEGMTPGKYRQSKVS"
FT   CDS_pept        509239..510216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0484"
FT                   /product="transmembrane lipoprotein"
FT                   /note="BH0484"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04203"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04203"
FT                   /db_xref="GOA:Q9KFJ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFJ5"
FT                   /protein_id="BAB04203.1"
FT                   /translation="MAQASVEQALPIESAAPSIPKKVRRQQKLKRIFRNKYLYLMILPG
FT                   LVYFLIFKYVPMWGLIIAFQDYQPFLGVTGSEWVGFKHFERLFTEPTFFQLLRNTLVLF
FT                   LYNLIFFFPVPIILAVLLNEIRLMVFKRFVQTMIYIPHFMSWVIVVSLTYVLFTTDGGV
FT                   INEIIYSITGKNVNFLMSEDWFRPLYILQVIWREAGWATIIYFAAIAAIDPSLYEAAKM
FT                   DGANRFRQIWHITLPAIRSVIVVLLILKIGDILELGFEHVFLMLNAMNREVAEIFDTYV
FT                   YTAGLKEGQFSYSTAVGFFKSIVGLIMVMLANWLAKKFGEEGVY"
FT   CDS_pept        510235..511332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0485"
FT                   /note="BH0485"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04204"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04204"
FT                   /db_xref="GOA:Q9KFJ4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFJ4"
FT                   /protein_id="BAB04204.1"
FT                   /translation="MSTLSVATMAVAEQACQTMMKRYEPLELPPKNRWHYHQGVFLYGM
FT                   YRVWEATKKEEYLSYTKGYVDGLIDEHGNFYFARDELDAIQAGLLLFPLYEKTKDSRYE
FT                   VAARKLRQLLTTINRTSEGGYWHKDKYPYQMWLDGLYMAGPFKMKFAQMFNEPELVDHV
FT                   LYQEQLMRRHTRDPETGLYYHAWDEKKQMPWADPNTGRSQEVWGRSIGWYGMALVDIIE
FT                   DLPEGHPSRHELTKVVTDYVDTISRYQDPDHGYWYQIVDKGERKENWPESSGTCLFLYT
FT                   IAKGMNLGIFDHRYVTQLRKGYQGLVDHFVKIDKDGNVTISGICIGTSCGVYDYYVGRE
FT                   TSENDLHGVGAFLLASVECARALSR"
FT   CDS_pept        511346..511825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0486"
FT                   /note="BH0486"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04205"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04205"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFJ3"
FT                   /protein_id="BAB04205.1"
FT                   /translation="MKWFILLLSLYVISGCSNSSDQLEVKIYSESLQPFVHEIERAVSD
FT                   VRAVDIQFQAPFAEKLVLDIVAQEGDLFIVDENVLRAIYDPVGLYPLHEVSRESFVDQD
FT                   RLSDYEDREGGEVTYYALPLSFAGSDVALFIPQYSERKEEVMDLLIDGFDLQVER"
FT   CDS_pept        511836..513128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0487"
FT                   /note="BH0487"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04206"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04206"
FT                   /db_xref="GOA:Q9KFJ2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFJ2"
FT                   /protein_id="BAB04206.1"
FT                   /translation="MKKYAICGVSNRALRMFIAPILDQYAKNHQVVALLDQDPRRLEIA
FT                   KEQYPQLASVRGYDDQSFEQMMNETKPDVLLVCSRDDTHIDYILKGLAHDLHVITEKPM
FT                   VTTAKDAKRVIEAENKSRGKVTVTFNYRYGAHHRKIKELILEGRLGRITSIDFNWYIDT
FT                   YHGASYFKRWNRVRDYSGGLSIHKSTHHFDLVNWWVDQRPIEAFAYGALNYYGADGELN
FT                   PSKKNGRFCGTCDEQDRCQYYRRWTTRSQSSAAKDDHIEYVPSTAKLYTDYRPDACIFD
FT                   EEINIEDTYVATVRYDRGTLLSYSINFSTPYEGYHLVINGTKGRIETKEYHEPSRIPFP
FT                   FDEQTIDYYPLFGSKETIHVVTNEGGHGGGDPILLEDLFLGVDPARPYEILAGAQAGAD
FT                   SIAVGEAVWRSVQTGQPIKIDDLLKVEVQQG"
FT   CDS_pept        513164..513814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0488"
FT                   /note="BH0488"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04207"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04207"
FT                   /db_xref="GOA:Q9KFJ1"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFJ1"
FT                   /protein_id="BAB04207.1"
FT                   /translation="MEMHGFTGAFYRVCVWIARFAYVNALWVTFTLLGLIVLGFMPATT
FT                   AMFAVVRRWVQNDHDIPIFKTFVTNYRKDFVKANGLGLFYGLLIGLILVNLALLPPDPL
FT                   WATLLRYAFMFIGLLTFGALLFLIPVFVHFELSIYQYVRTSIMLALSYPHYAITMTAGM
FT                   FALQYVFMTVPGLIPFFAASFISYVLMWLSNRVFSHLKKRSDATDYEGQASGV"
FT   CDS_pept        513893..514870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0489"
FT                   /product="sodium dependent transporter"
FT                   /note="BH0489"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04208"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04208"
FT                   /db_xref="GOA:Q9KFJ0"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFJ0"
FT                   /protein_id="BAB04208.1"
FT                   /translation="MVDDRFNHFRIINRVLEKGMPVLTPVSVAIGVWMAERFSNFASAV
FT                   PWLFAVISFVGALGLTLVDIRERLRRPQAMIVTLFILQILMPLIALLVGMWLFDPMTRS
FT                   GLVLAFSIPTGVMSLMWVTIYHGNKSFALAVVFIHTLLSPFFIPWTLRWFIGTDIPFDV
FT                   GGMVWGLLWMIVIPSLLAISATRYTPKVVPMMKDVLSPIAKLHLFLIIMINSSVAAPFI
FT                   RSWDLSLLYIILTVLAIALSGYGLGYVGARLLKLDESMRISMVYTCGMRNIGAGAALAV
FT                   AYFPPPVMVPIVAAILFQQVLAAALGKWMRTGRTDQSLIERGTT"
FT   CDS_pept        514867..516360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0490"
FT                   /product="altronate hydrolase"
FT                   /note="BH0490"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04209"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04209"
FT                   /db_xref="GOA:Q9KFI9"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFI9"
FT                   /protein_id="BAB04209.1"
FT                   /translation="MNEKFAYIHEKDNVIIALSPLEQGEVLNVNGLPITLSESIPRGHK
FT                   VAIVTIEQGEDVIKYGFPIGKATTTIQPGAWVHSQNMKTKLEGVQEYDYTPSTPSFRKQ
FT                   VEKVRTFQGYVRDNGNVGIRNEIWIINTVGCINKTAERLAAISNETCGAGVDGVYHYPH
FT                   LFGCSQLGDDLLYTQKILRNLVLHPNAAGVLVLGLGCENNHIAAFKQVLGDYDDRRVKF
FT                   LAVQEADNEMEQGLAIIEELISYAKTAKREPIPLSKLKVGLKCGGSDGFSGITANPLVG
FT                   AFSDKVVAHGGTTVMTEVPEMFGAETILMNRAKDQATFEKMVRLINDFKEYFLRHNQPV
FT                   YENPSPGNKEGGITTLEEKSLGCVQKGGFAEVVDVLPYGERLEKPGLNLLQGPGNDLVS
FT                   VTALAAAGAHFVLFTTGRGTPFGGPVPTVKISTNTSLYERKKHWIDFNAGRLVEGATLD
FT                   EVAEELLNYGVKLASGEVRAKNEEYGFKEISIFKDGVIL"
FT   CDS_pept        516360..517442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0491"
FT                   /note="BH0491"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04210"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04210"
FT                   /db_xref="GOA:Q9KFI8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFI8"
FT                   /protein_id="BAB04210.1"
FT                   /translation="MERLCEQVRKVRRWLIDQPFDGILLSEQKNIAWLTGARAYVNLAT
FT                   ERSIVFFLITESETVMYCSNIEKERLLAEEIGDTVGEIHVFPWYDPLLAESITQEQSKI
FT                   GKVVLDREVESAFKAVRSALSPSQVAGYRQLGKLSAAAVEETALGLQRGETELEIAGRL
FT                   ANAAIKRGIEPVVNLVAVDDRVSAYRHPLPTDKRLDRYVMIVLSGRRNGQYISLTRLVH
FT                   FGVIPIDLKKKHAAVCTIDSRLMHHTRVGQSMGDLFKEMKAAYATVGYLHEWKNHHQGG
FT                   LTGYVGRERLLQPDAQELIQANEVYAWNPSITGTKSEDTILVTESGPEILTLGKKFPLM
FT                   TVTVAGCTYERPDILGRNDG"
FT   CDS_pept        517455..518993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0492"
FT                   /product="altronate oxidoreductase"
FT                   /note="BH0492"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04211"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04211"
FT                   /db_xref="GOA:Q9KFI7"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023668"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KFI7"
FT                   /protein_id="BAB04211.1"
FT                   /translation="MEKLSHGLVTSRNMIRYKSSQLPERVLQFGEGNFLRGFIDWMIQQ
FT                   MNKQNVFNGRVVAIQPTPHGKVVPKLQEQDSLYTVWLRGIADGETVDHHEVITSISRGL
FT                   NPYTNWQDVLEVAASPDISVVFSNTTEAGLTYLEEGYDKEKAPLSFPGKLAACLWHRYE
FT                   TLGWGEGSGLVIIPCELVEQNGKVLKELVCRYAKAWNFPQEFFTWLERENEFCHTLVDR
FT                   IVPGFPSDTADECFERLGYEDILLTVAEPYHLFIIEGSERVRKLLPFNEAGLHVRWNHL
FT                   EKHRNMKVRVLNGTHTFMFALSYLSGVDTVGEAMADEQLCSFIRKGLFEEIIPCVDAPE
FT                   QEVTAFAETVLERFENPFLQHRLTDIGLNAVNKFRTRLMPTFNDYVAQTGEAPTYLLFS
FT                   LAALINYYRGVEEDGPFLIGRRREDSYLIRDDLEVIEAFKVGWQQVNTGKLSLAQLCED
FT                   LLSKRELWGVDLSMERKVVDKVAESLQIIVEKGMRQAISGVLNQIGGNNHVHKQ"
FT   CDS_pept        518977..520260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0493"
FT                   /note="BH0493"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04212"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04212"
FT                   /db_xref="GOA:Q9KFI6"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="PDB:2PNK"
FT                   /db_xref="PDB:2Q08"
FT                   /db_xref="PDB:2Q6E"
FT                   /db_xref="PDB:2QEE"
FT                   /db_xref="PDB:3HK5"
FT                   /db_xref="PDB:3HK7"
FT                   /db_xref="PDB:3HK8"
FT                   /db_xref="PDB:3HK9"
FT                   /db_xref="PDB:3HKA"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFI6"
FT                   /protein_id="BAB04212.1"
FT                   /translation="MSINSREVLAEKVKNAVNNQPVTDMHTHLFSPNFGEILLWDIDEL
FT                   LTYHYLVAEVMRWTDVSIEAFWAMSKREQADLIWEELFIKRSPVSEACRGVLTCLQGLG
FT                   LDPATRDLQVYREYFAKKTSEEQVDTVLQLANVSDVVMTNDPFDDNERISWLEGKQPDS
FT                   RFHAALRLDPLLNEYEQTKHRLRDWGYKVNDEWNEGSIQEVKRFLTDWIERMDPVYMAV
FT                   SLPPTFSFPEESNRGRIIRDCLLPVAEKHNIPFAMMIGVKKRVHPALGDAGDFVGKASM
FT                   DGVEHLLREYPNNKFLVTMLSRENQHELVVLARKFSNLMIFGCWWFMNNPEIINEMTRM
FT                   RMEMLGTSFIPQHSDARVLEQLIYKWHHSKSIIAEVLIDKYDDILQAGWEVTEEEIKRD
FT                   VADLFSRNFWRFVGRNDHVTSVKVEQQT"
FT   CDS_pept        520349..524479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pelX"
FT                   /product="exopolygalacturonate lyase"
FT                   /EC_number="4.2.2.9"
FT                   /note="BH0494"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04213"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04213"
FT                   /db_xref="GOA:Q9KFI5"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFI5"
FT                   /protein_id="BAB04213.1"
FT                   /translation="MSIYLKKISIVTLVFLIVFSHFPRLGVSANQEELEAGWSFRAFGG
FT                   NTSEERNPPPVIHEDGSVTMTATGGKIASGDEGLSFMYQELPHDVNFTLHASVNVQHFN
FT                   SNQSISTPNQKSFGLMVRDAVGEDGDSAVQTANYVANGALDTVMKGFYKEQGVQTKLTP
FT                   FSSSRPPTSGETYELSITKSGDAYLLTANEESEVVLTEGNFDETLFAGFYVARDAEVTF
FT                   RDFSLVIDNRVVEQLIVDDQDMKKDYFVGEPFDPTGLLVTARFMTGEEQTLSPDDYFWT
FT                   GFSSAEPGARTLTIYYLGATETIELKVHQTAVEDLAILYYPAKTTYYLGDHFDREGLVV
FT                   IATLATGERQEVPEDDYFLSLDGEVIDESFTFSRPGELAVDVTLKEDRAMRTSFAVEVR
FT                   DAAVTHLELYTPPEKQLYFIGEELKMDGAIVYAHYSDQSRVRLLRGEYDVSKIDSSTSG
FT                   MQKVTITYKGVSASFTVEVKEREIQELTIVRYPKTTYTVGEALALEGLEIGYLFDNGDV
FT                   EKVSEDEYEVDVSAYNQQQTGVYDLFIHPLRQEVASIVLPVTVREEIEYEWKSIRFGQS
FT                   TSNARNVVNDFGDGTVELIALEGGGKVTGDHDGITFYYTELDAVEDNFTLSADVRVKEY
FT                   AKNPHDGQESFGVMARDAIGPANDASVFASNIAAVGGYSGGTREANGTQLFVRTGVLAS
FT                   DGEGSKGIQKKMLDQEKPRPETTHPEASYRLTLKKTNSGFIGALNDGKEELFFTPDIVN
FT                   VQDSKMYIGFYTARLATIEVSNIELEVTAAATDFPKQEPPEEPTAPELDILSLSSVSKM
FT                   DYELIVRANVGGSLTIKKGNQTIEENLNVEKGEMKTVSTTVASHQKTNFSLSFIPDDTQ
FT                   LLTSYDRIVRNFTVTMKTFNEEGDLYVSPDGTSDGDGTRGAPLDLDTAIDFIMEGQTIV
FT                   VLDGHYVRDSKLEINKYNDGTPDAMKALVAEPGTRPIIDFDRRSEGVILSGNYWHIKGL
FT                   DFTRSAGNTKGFTVGGSHNIVENSRFYENGDTGLQISRTDGSEHIADWPSYNLILNSTS
FT                   FDNRDPSENNADGFAAKLTVGVGNVFRGCIAHNNIDDGWDLYTKVGTGAIGPVLIEDSI
FT                   AYNNGFLTDGTVGAGDKNGFKLGGEGIRVPHIIRGSMAFGNGAYGFTSNSNPGVIAEQN
FT                   IAFNNGGGNLDFTTYPNIQPDFTIDGFISYQHDASARDRYPEELASDRNFLFNGQYSEN
FT                   KNGVRLTDANFKSLEPTIPYERDDAGNIIWGDFLSFIPPSEEDEEKEIIEANVSFSPPI
FT                   FLLATGRGKGVALVTLALPGPYKAKDIDVSSLILNGEVTPVRTMQTGNRMMLKFQRSDL
FT                   ARVLERGHKVEIQVTGMLQTGESFVGTTHIFVK"
FT   CDS_pept        524647..525771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0495"
FT                   /note="BH0495"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04214"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04214"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFI4"
FT                   /protein_id="BAB04214.1"
FT                   /translation="MASYESRVVWALIEIEELMESVIYWLAQRYDSSSGGFFYAQSSEH
FT                   VNVKIPDIESTAQALNILERYDLLSGMPDDVRQQLIGFFQMKQQDTGYFLDDNPMMAED
FT                   DVMVARALSYSLGALKKLGGKPLHRLPNTAGALPSYMKTPEAYGEWLRSVSLSNSWRGC
FT                   DRLCVSGVYIKQLTEEKRPMYLHEAFSYFASIQDPVTGLWGQGNDYVKISGTFKLFTFY
FT                   QQFQRQLPNEGAIYQSVMKTLTEKPAKDMCYVRNSVNLLAAMEREIELPDVTIVLEAIG
FT                   LQLKRLKQKDGGFSREISGSLPAPNVGQVKKEEKYSELPQPVILGAGLMEGDMNATTQA
FT                   VLIHRLCYQLAKRPFPFAKMAGVPFYSLIKSKEA"
FT   CDS_pept        525864..526190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgF"
FT                   /product="pectin degradation protein"
FT                   /note="BH0496"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04215"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04215"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025499"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFI3"
FT                   /protein_id="BAB04215.1"
FT                   /translation="MDFELWEYPEPGIKRKLYKPGEKLMIMKVVFEEGAEGASHSHPHE
FT                   QLTYCLKGDMEFTIKGKVKRIQEGEVLTIPPHAVHGAKALAPSIILDVFTPLREDLLSD
FT                   TSSV"
FT   CDS_pept        526280..527023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0497"
FT                   /note="BH0497"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04216"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04216"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFI2"
FT                   /protein_id="BAB04216.1"
FT                   /translation="MGGPYKIIALDMDGTLLSSNHQISEGNRRAIEEARNHGVHVILST
FT                   GRSFMTSKEYMESLALDSYHITVNGSEIWHTSGELIERQMLHGQHIETMWKLKEQHNTT
FT                   FWAVSTEKVWRGEFPENIHEHEWLKFGYDVPNQEIREQIEKELQAHSELEVTNSSPTNL
FT                   EINAMGVSKAKALATVCERLGLTMANVLAMGDSLNDLAMIEEAGCGVAMGNAQEIVKEA
FT                   ADWVTGTNDEDGVAQAIRKFVLDNS"
FT   CDS_pept        complement(527081..527230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0498"
FT                   /note="BH0498"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04217"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04217"
FT                   /db_xref="GOA:Q9KFI1"
FT                   /db_xref="InterPro:IPR010070"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFI1"
FT                   /protein_id="BAB04217.1"
FT                   /translation="MYGYGPVAGAGFDCGFGYGPVAGYHGGKGFALIVVLFILLIIVGC
FT                   SWFK"
FT   CDS_pept        527424..528080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0499"
FT                   /note="BH0499"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04218"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04218"
FT                   /db_xref="GOA:Q9KFI0"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFI0"
FT                   /protein_id="BAB04218.1"
FT                   /translation="MEGKLMMEFTWQIGIIVVITVVLLVGWVVYRLKEKKRYDVAKITI
FT                   RDIDRMDGHEFEDYLFVLLAGLGYNETYQTKKSRDFGADLLFNDSSGARTVVQAKCLSD
FT                   ALGVKAIQEVFTAKVYYQAEKAIVITSTETISDPCRRLASAAEVKLIEREALQEIIALF
FT                   KREQMKQAQDVIEAPPEKIKTTPEDSYVYPEQDQQVIRSGEFYYKKPSSFFKRSG"
FT   CDS_pept        528100..528651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroI"
FT                   /product="shikimate kinase"
FT                   /note="BH0500"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04219"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04219"
FT                   /db_xref="GOA:Q9KFH9"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KFH9"
FT                   /protein_id="BAB04219.1"
FT                   /translation="MKRIPSIRERNIVLIGFMGVGKTSVGEQLAKRLFRDFIDVDQEIE
FT                   KTWKMKISDIFRLKGEEAFRKIEREMTIDYCTNTSLKVISLGGGAYMQDAIRTACLDHC
FT                   IVIYLDLSWSLWKERLNVLIDNRPVLQDKKVEEMEQLFTKRQPTYQKNSFQVETDGREV
FT                   AEIVSYLEEVIKLGWEIYGS"
FT   CDS_pept        529226..531406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /product="ribonucleoside-diphosphate reductase alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="BH0501"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04220"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04220"
FT                   /db_xref="GOA:Q9KFH8"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFH8"
FT                   /protein_id="BAB04220.1"
FT                   /translation="MTMTINKELHWQERLKERFPQLEVEDVLSQGASLESMRMKAMDEI
FT                   SAEQPEWTFITARIYLEELYNSVKEQRGLAKPYTQFYELIEVLVDKGIYEKDLLNRYTK
FT                   EEINELGEHLNQEKDELFTYIGLKTLADRYLARLYDRTLMELPQERFMVIAMSLMKKEV
FT                   NSQRLSLVKEAYWALSNLYMTVATPTFANAGKAVGQLSSCFIDTVDDSLRGIFDSCTDA
FT                   ATVSKSGGGLGIYLGKIRAKGSSIKNYQNVSSGVLPWMKQLNNVAVSVDQLGQRQGAIA
FT                   VYLDIWHKDIFSFLDAKLNNGDERQRTHDLFTAVSLPDLFMEAVEARDNWYLFDPHEIR
FT                   QKMGFSLEDSYDEQKGSGTFRERYEACVNNPDLSRTEVPAIEIMKRIMISQLETGSPFM
FT                   YYRDEANRMNPNKHEGMVYGSNLCTEIIQNMSPTTVVEEKTEDGKILITKQPGDYVVCN
FT                   LSSLSLARVVEDDVLERLIPIQVRMLDNVIDVNRIEVKQAEQTNQKYRAIGLGTYGWHH
FT                   LLAKKGIAWESEEAIRYADELYETINYLTIQASMKLAEEKGAYPMFGGSDWETGEYFER
FT                   RQYTTDKWTELAEQVKEKGLRNGYLLAVAPNATTALIGGTTASIDPIFQKTYVEEKKNY
FT                   RIPVTAPDLSPETTWYYKSAYHIDQTWSIRQNGARQRHVDQSISFNLYVSNTIRAKELL
FT                   ELHLLAWKEGLKTTYYLRSTSMEIEDCESCAS"
FT   CDS_pept        531421..532458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /product="ribonucleoside-diphosphate reductase beta
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="BH0502"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04221"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04221"
FT                   /db_xref="GOA:Q9KFH7"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="PDB:2RCC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KFH7"
FT                   /protein_id="BAB04221.1"
FT                   /translation="MEQLQKRKIYDTTASNASTGILNGKSSNVLNWDDVRFSWAYPLYK
FT                   NMLANFWTPFEINMSHDAKQFPTLTETEQEAFKKIIGLLAFLDSVQTDYSMRAAEYLTD
FT                   SSLAALMSVLSFQEVVHNQSYSYVLSSLVPKATQDEIFEYWKHDDVLKERNEFIIDGYE
FT                   KFVDNPTPKTFLESIVYDVILEGLNFYSGFAFFYNLARNQKMVSTSTMINYINRDEQLH
FT                   VYLFTNIFKELLVEFPELNTEETKTFVKTTLMKAADLEKDWFRYIIGDKIPGINPEDME
FT                   TYISFIANKRAVQLGMEKPYPEIKHNPMKWIRAYEDVNSGKSDFFEQKSRQYAKVSADN
FT                   GFDEL"
FT   CDS_pept        complement(532524..533048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0503"
FT                   /note="BH0503"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04222"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04222"
FT                   /db_xref="GOA:Q9KFH6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFH6"
FT                   /protein_id="BAB04222.1"
FT                   /translation="MENATLILPSLAYQNAYLDMLKEWGNSGETPIPFTLRLNPIPFEH
FT                   LLKTLKDYQHGVNLPANRVANTTYWLVHEQKRLIGAINIRHTLNDWLHHRGGHIGYGIR
FT                   PSERGKGYATLMLKLGLEKAAALGLEKVLITCDKENLPSARTIQRNGGVLDSEVVDERG
FT                   IAIQRYWIKLT"
FT   CDS_pept        533329..533718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0504"
FT                   /note="BH0504"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04223"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04223"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFH5"
FT                   /protein_id="BAB04223.1"
FT                   /translation="MMKLTKEVLQPFPQFIGQKPQRIVEEASCITFDINESLSLIFKAR
FT                   SEHCLTVRIQQYQYVDWSRYQLQVRELISHLESLALELDFTEIEFESSRRTTLLKILVQ
FT                   QGYNNRYGGVRGNGLEGRYVKMLVQ"
FT   CDS_pept        complement(533734..535053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0505"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="BH0505"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04224"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04224"
FT                   /db_xref="GOA:Q9KFH4"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFH4"
FT                   /protein_id="BAB04224.1"
FT                   /translation="MPLFTRQSKPSKRESYFSHQFEQAAVKFELPAESELSAQLRMIHL
FT                   TLDDLKRMKALQPLVEENMEVLADAFYSNIIKQPNLNEIIETHSSVERLKETLKQHILE
FT                   MFNGEIDQAFLQKRLQIAQAHVRIGLQTKWYVSAFQQLTDSLIQLLEQHLQSPSDIVLA
FT                   TRSLLKLLNLEQQLVLEAYENENKRIEAEHERQKRELIQHLTAAAQELAAISQQTSAAN
FT                   KQLVHRSETVVASANEGTDLAIKAETLSLNGKAQITTQSSNMDAILQSVKHIQTISTDL
FT                   NDRSIEITEFVDVVKGIADQTNLLALNATIEASRAGEKGKGFAVVANEVRKLADQTKAS
FT                   TNTVSQLIEKTTEQIASVVESIGTIYQLVSEGSKGMDSTAGTFHSITEAMNEVKTKNEQ
FT                   MKTDLQQLLSVTKELDESSLQVSQSANQLNRLTTEVESGG"
FT   CDS_pept        complement(535186..535968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0506"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /note="BH0506"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04225"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04225"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFH3"
FT                   /protein_id="BAB04225.1"
FT                   /translation="MKNLHGKRAIVTGVSRLSGIGAAICREFAKRGADVFFTYYFHYDQ
FT                   TLGVKGENDEPMRLAKELESHGVAVAHLELDLSEDNAYVQIFNAFEQRFGTTADILVNN
FT                   ACVSVNDSYETITSENLDAHYVINVRATTLLTSEFAKRFSKGHGGRIIQLTTGWSQGPM
FT                   ANELSYAITKSTVEALTYTLKTELAKKGITINAVNPGPTNSGWMSDQLKQELLPRFPFG
FT                   RLGEPKDAANLIAFLASDDAEWITGQVIHSEGGFQNTL"
FT   CDS_pept        complement(536032..536283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0507"
FT                   /note="BH0507"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04226"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04226"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFH2"
FT                   /protein_id="BAB04226.1"
FT                   /translation="MVDKDHITIRDEQGNEHEYEVEAVFEMGGQHYTMISSGQEMEIMR
FT                   IEEHNGSQSLVNATEDEIEQLVAAYEIAINADENFPEQ"
FT   CDS_pept        complement(536355..536663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0508"
FT                   /note="BH0508"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04227"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04227"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFH1"
FT                   /protein_id="BAB04227.1"
FT                   /translation="MDYNTMCPKYEAAIDLLGKKWTGLIIRVLLAGPKRFKDIKAQIPG
FT                   MSDRILTERMKELEQLEVVIRHVYPEKPVRIEYELTEKGKDLTPVIEAIQQWGEKWA"
FT   CDS_pept        536863..537009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0509"
FT                   /note="BH0509"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04228"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04228"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFH0"
FT                   /protein_id="BAB04228.1"
FT                   /translation="MMMSRQERENMIEFLTQRKDFSTEKLMVMTDAEIEHLYERAYSHH
FT                   ERG"
FT   CDS_pept        537081..537182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0510"
FT                   /note="BH0510"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04229"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04229"
FT                   /db_xref="GOA:Q9KFG9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFG9"
FT                   /protein_id="BAB04229.1"
FT                   /translation="MRLSNKALFILITVIVLMYGFGYWIIGHFILTR"
FT   CDS_pept        complement(537226..538584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0511"
FT                   /product="magnesium (Mg2+) transporter"
FT                   /note="BH0511"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04230"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04230"
FT                   /db_xref="GOA:Q9KFG8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFG8"
FT                   /protein_id="BAB04230.1"
FT                   /translation="MANMTEDQLLVLMIKYLKDSKRGALQQMLDELHPYDVAQLYRSLP
FT                   DKHHHKFLTFLTPDQIADLIQELDSDMQIEILHRLGIERSSKVMNLMDNDDLADLLNEL
FT                   SVERIQEFLDAMKDDESEKVQSLMGYDPETAGGLMTNQFIWIKEDYTVRQAVDKLKDYA
FT                   SFSENIYYLYVINEEKKLVGVVSYRDLLIAHIDDKIKDIMFNRVVSVPVDMDQEEVART
FT                   IERYDFIAIPVVDQQNTLLGIITVDDVIDVVIREANEDIEKLSASGKDIDFQTKALTAS
FT                   ARRLPWLVLLLFIGLVSGSIISNFEETLEQVVALIFFMPMIAGMTGNTGTQSLAVVVRG
FT                   IVTQNLDRKTIIHLVFRELRVGILIGLTCGVLIFVIGTIWINITLGFVVGVSLLLTLIT
FT                   GTLAGTIIPLFLYRMGVDPAVASGPLITTLNDIFSLMIYFGIATAFLTQLQGL"
FT   CDS_pept        538835..539884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0512"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="BH0512"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04231"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04231"
FT                   /db_xref="GOA:Q9KFG7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFG7"
FT                   /protein_id="BAB04231.1"
FT                   /translation="MSFIQLRDLTKTFSHTLKPAVDSVHLTIEKGEIIALLGPSGCGKT
FT                   TTLRMIAGFEQPTSGSIKIGGEVVYENQFTVPPEKRGIGMVFQDYALFPHLTIAKNVMF
FT                   GLSKWGTRAKRERAKEVLELVGLADYAARYPHELSGGQQQRVALARALAPKPHVVLMDE
FT                   PFSNLDAGLREKMRFEVTTILRKANATAIIVTHDQKDAFAVADRVVVMNEGVIQQIATP
FT                   REMYRCPKNCFVAQFVGKTNLLSGRLCEDMRHVDTHIGRVSLPAQSEVMLENVKVSIRP
FT                   EGCKLAEEGRFTGKVERVTYSGEYQEVVVNLGAGTTEPMILYAPIDQDVQPGIVVSFDI
FT                   TPELVALVE"
FT   CDS_pept        540227..541345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0513"
FT                   /product="iron (III) transport system (iron (III)-binding
FT                   protein)"
FT                   /note="BH0513"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04232"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04232"
FT                   /db_xref="GOA:Q9KFG6"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFG6"
FT                   /protein_id="BAB04232.1"
FT                   /translation="MAKRFRLLFFALMAVALFALAACGATEEEGNEEPAAEETEETTEG
FT                   AEEEEQEEQVAEGTGELVVYSSRNEDFVNALLEKFEQDTGITVQPLHAGDNAVNRIKGE
FT                   AGNVQADIFISNDIGALEHLRLEGLLEGSDPEGVESIDEKYRAEDNSWIALSARTRVLM
FT                   YNKDLISEEEMPKTIEELTDPKWEGDFAITRGGNGGMIAHVSALRQELGDEETKEWISQ
FT                   VKDNAGAILEGHGDIRRAVGAGEFKFGLVNNYYYHQQLREPTDNNVGVIYPDQGDDEMG
FT                   AVVNAAGVGLIKDAPNGENAQAFLEWILLPENQREFSFESLEVPINPEIEAPEGAATIS
FT                   DYKTHDMPLSKLGEVWEDTRELIEEAGLDLDL"
FT   CDS_pept        541380..543041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0514"
FT                   /product="iron (III) transport system (permease)"
FT                   /note="BH0514"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04233"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04233"
FT                   /db_xref="GOA:Q9KFG5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFG5"
FT                   /protein_id="BAB04233.1"
FT                   /translation="MNVDPHNQKKKVGHRSPTSRRLFNTYWLKLWNGSPPGAVLLSFAA
FT                   VTGLLMAIPIVYVVWESLFAGADRWLRLLDTRIPQLLWNTLSLTVMVTLFAVAIGVSLA
FT                   WLVNRTSLPGRKMWQWLLALPLVIPPYVGAVTYIIIFGPRGWLWRYWKQEEWLQQRFGD
FT                   YPIDVYTFAGIFFVLTMFTYPYVYLIAGASLRKMNRNFEEVARAQGMTTGQVFWRVNLP
FT                   FLRPAIGAGAILVALYVLSDFGAIAMMRYTTFTAAIYYQMGSYDNVSATVLSVVLILLT
FT                   LIILWIEARTRKKQKYYQTTNSYHEPEILSLGKWKWPAFFFVAGVFTISVLLPVIVLVY
FT                   WTVIGVGGGVLDAKFWGYAWNSLKVSGLAALFCMLLALPVVYLRSRYPSKVSHFIEKLS
FT                   YAGYALPGVIVALGIIYLFNQYIPVLYNTFYLIAIAFVVRFLPQAMQSTDASLSLISPR
FT                   IDEAARSLGQPPWKVMFTVIIPSILPGVLAGGALVFVSSIKELPATLLLRPPGFDTLAV
FT                   RIWVETSEATYYTAAPAALLIVLVSALPLRYLLKKY"
FT   CDS_pept        543447..543764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0515"
FT                   /note="BH0515"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04234"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04234"
FT                   /db_xref="InterPro:IPR016772"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFG4"
FT                   /protein_id="BAB04234.1"
FT                   /translation="MSSIMIVGADHLGTIPKKLNEIGFSEIMHVTGRKVKAVKKEIPSH
FT                   VDLILVLTDYINHNLTSVLKKRASEQDIPICYAKRSWCSIYKVIGQCDAYCPKRNSCQF
FT                   K"
FT   CDS_pept        544053..544955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaA"
FT                   /product="surface adhesin A precursor"
FT                   /note="BH0516"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04235"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04235"
FT                   /db_xref="GOA:Q9KFG3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KFG3"
FT                   /protein_id="BAB04235.1"
FT                   /translation="MKKVCFSFVIMVIALIAAGCGAEDTGTSEDGEGLKIVTSFSILGD
FT                   VLENIAGERSSVTYIVPIGEEPHEYEPVPSDFQAVSDADVFYVNGLGLEEWLQRLVENT
FT                   SDVDVVEVSPTIDALPLEESDGLDPHAWLDVKNVMKYVEVIRDDLVERDPDGAEIYVAN
FT                   AEAYLQDLQELEEWIHDQVTTIPEEQRTIVISENAYRYFGEAYGFDTVGIWELNSHEEG
FT                   TPGQISRVVDIVKELDLPAVFVETTVNKSFMTTVSNDSGVDIAGEVYTDAVGLEGSGAE
FT                   TYIDMMKHNVDTFVSGLSQ"
FT   CDS_pept        complement(545016..545762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0517"
FT                   /note="BH0517"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04236"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04236"
FT                   /db_xref="GOA:Q9KFG2"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFG2"
FT                   /protein_id="BAB04236.1"
FT                   /translation="MFIRNESFYTFRRSYPIITALVFIHIALFVWIHLLPGGAWVYATG
FT                   VGFNLAVSQGEYWRLITPVFLHVSIGHLVFNSFALVIFGPALERMLGKGKFLFVYLLSG
FT                   FIANVATYYLGGLAYPYHLGASGAIFGLFGIFVYMVIYRKDLIDPANTQLVITIIIIGL
FT                   VMTFLSSNINVFAHLFGMIGGAALAPIVLAKARPFYAFAVAADDREVRFDPNRWKKRRF
FT                   TRGIGKKILWVGLGLLIAIGILSRLF"
FT   CDS_pept        545984..546343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0518"
FT                   /product="holo-(acyl carrier protein) synthase"
FT                   /note="BH0518"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04237"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04237"
FT                   /db_xref="GOA:Q9KFG1"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KFG1"
FT                   /protein_id="BAB04237.1"
FT                   /translation="MIIGTGIDIVELERIQSMVEKHPRFVKKILTENEQEVFARLSRRR
FT                   RLEYIAGRFAAKEAFVKAVGTGISAEYGWHDLEVLSDERGKPVLSVNLDATIHVSISHS
FT                   QSYAIAQVILERLSS"
FT   CDS_pept        546530..547534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0519"
FT                   /note="BH0519"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04238"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04238"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFG0"
FT                   /protein_id="BAB04238.1"
FT                   /translation="MRKVSWFMIIGLMFAVLLTGCGEKSQDEVVTDLEKRLADMSGYKT
FT                   HATMTLQTGKDPQTYDVEVWHQEKNYYRVALENENKDQSQIILRNDDGVFVLTPSLNKS
FT                   FRFQSDWPTNSSQVYLYESLIQDILIDGERTFTSTEDHYVFETKTNYQNKNLHAQEITL
FT                   NKRDLTPVQVKIMNADLELLVQVDFRDFELEASFNEGDFEMERNMTGAQIDEPTMAEPS
FT                   EPFVVHYPMYEPQGSEYIGSKEIETEDGKRVVLQYGGEQSYTIIQEQSRIVPASTPMHA
FT                   DGEPVDLGFTVGVMSEDSIMWSYNGVDFFLAAPDMDQEEMMAIARSVYGTQEK"
FT   CDS_pept        547762..548928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0520"
FT                   /product="alanine racemase"
FT                   /note="BH0520"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04239"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04239"
FT                   /db_xref="GOA:Q9KFF9"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KFF9"
FT                   /protein_id="BAB04239.1"
FT                   /translation="MEHFYRDTWVEVDLDAIEQNVTNALRLYKDREMNLMAVVKANGYG
FT                   HGAVEVSQAALRAGASYLSVAFLDEALALRKAGIDAPILVMGLVGAEHVQLAIKHRITL
FT                   TVYQLDWLEQAISRLHTRDKLAIHLKLDTGMGRIGLRRKEDIRSCMDFIASHECFELEG
FT                   VFTHFATADEKDLTYFKKQCQRFNQWLEYIREWQLPIRYVHCGNSAAGLRFPEKNFNMF
FT                   RFGIAMYGLTPSPEITDELPFPLKQAFSLKSRLSNVKKLPKGEGISYGATYVTEGAEWI
FT                   GTLPIGYADGWIRHHSNAGGHVLIDGKRAPFVGRICMDQCMIRLPKKHSIGDTVTLIGE
FT                   SDGKQITMDEVAKRLNTINYEIPCVISWRVPRIYFRDGQIISVKNNLL"
FT   CDS_pept        549113..549400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0521"
FT                   /note="BH0521"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04240"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04240"
FT                   /db_xref="GOA:Q9KFF8"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFF8"
FT                   /protein_id="BAB04240.1"
FT                   /translation="MSFVSESSTKRIVVNLPQHLLNEVDGVIKQEKVNRSEFFSQATKM
FT                   YLRERKKRQIREKMQQGYLEMAKINLNIASEAFLAEEEAEHTLDRLVSGV"
FT   CDS_pept        549404..549754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0522"
FT                   /note="BH0522"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04241"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04241"
FT                   /db_xref="GOA:Q9KFF7"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFF7"
FT                   /protein_id="BAB04241.1"
FT                   /translation="MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVA
FT                   AITAQIQKAKLPTHVEINAKRYGFDRDSVILLEQIRTIDKQRLTDKITHLDDDMMSKVN
FT                   DALLISLGLIDF"
FT   CDS_pept        549935..550750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbR"
FT                   /product="positive regulator of sigma-B activity"
FT                   /note="BH0523"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04242"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04242"
FT                   /db_xref="GOA:Q9KFF6"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR014792"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFF6"
FT                   /protein_id="BAB04242.1"
FT                   /translation="MESFIVSFVNEKKDELVKQWESELHQIRSEIYLDKISDDLFLRTS
FT                   QEFMEHTFAAIQTSQQEAGERLAPFTERLIQGGWPLIYFTKGLQAFRRTVLAVLAEEKD
FT                   LQQVLKYFYEVEEWVDRMVNELVHDYTGSWEDTIEMQKLSLLELSAPLMPVFEGVTVMP
FT                   LIGTIDTQRAKLIMENLLDGVIKHRSQVVLIDITGVPVVDTMVAHHIIQAAEAVRLVGA
FT                   QCILVGIRPEIAQTIVNLGINLQQFPTKSTLQKGIEAALEQLGKKMVDK"
FT   CDS_pept        550765..551121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbS"
FT                   /product="negative regulator of sigma-B activity
FT                   (antagonist of RsbT)"
FT                   /note="BH0524"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04243"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04243"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFF5"
FT                   /protein_id="BAB04243.1"
FT                   /translation="MRIPILKLKQYLLISIQVELDDQTALRFQEDLLTKIHQEGSEGVV
FT                   IDLTSVETIDSFIAKVLGDVVNMANLMGAKVVLTGIQPAVAITLIDMGIKLENVPTALD
FT                   LDQGLEKLQQELEG"
FT   CDS_pept        551126..551545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbT"
FT                   /product="positive regulator of sigma-B activity (switch
FT                   protein/serine-threonine kinase)"
FT                   /note="BH0525"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04244"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04244"
FT                   /db_xref="GOA:Q9KFF4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFF4"
FT                   /protein_id="BAB04244.1"
FT                   /translation="MKAHSCSVEIRNEWGIVAARQEGRALAKQVGFGNVDQARITTAIS
FT                   ELARNIYLYAERGQIVLEEVERLGKHGMTKGIKIISEDKGPGIEDIKQVMEDGFTTSGG
FT                   LGAGLPGVKRLMDEFYIESTKGQGTVITAIKWLRS"
FT   CDS_pept        551560..552573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /product="indirect positive regulator of sigma-B activity
FT                   (serine phosphatase)"
FT                   /note="BH0526"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04245"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04245"
FT                   /db_xref="GOA:Q9KFF3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014787"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFF3"
FT                   /protein_id="BAB04245.1"
FT                   /translation="MKHTKDLLNEQYRTILTRYLQNKSEQGLYQAEQLSKQLLEQKVSP
FT                   EELVSLHRTVLSDLFPSLSKDVQDSFEFLLEVMVGYGLAYREHQSLRDRQQELESEIDV
FT                   AANMQQTLLPKEKLNVPSLDIGIISVPAEKMSGDFYHYIQYENDCIGFAIADIIGKGVP
FT                   AALCMSMIKYGMDSLPEQRLQPAALLENLNKVVEQNIGDSMFITMMYGYYDARAHQFHY
FT                   SSAGHEPGFYYRAATDTFEDLKAKGLVLGVSRKAVFHEYKRDVNLDDFIVFLSDGVTEC
FT                   RVGDEFIERDEVVSYLRKYKQLPAQDMVEKVYQELAQIQGYNLRDDFTLMIVRRKV"
FT   CDS_pept        552645..552977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbV"
FT                   /product="positive regulator of sigma-B activity
FT                   (anti-anti-sigma factor)"
FT                   /note="BH0527"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04246"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04246"
FT                   /db_xref="GOA:Q9KFF2"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFF2"
FT                   /protein_id="BAB04246.1"
FT                   /translation="MNLDIYLEKDQDTVLLNVEGEIDAYTAQELREKLLPLTEIKGRQV
FT                   VVHLADVHYIDSTGLGIFIGALKSAHQHGSFLKLTGITPRVRRLFDITGLDEVIEIDDH
FT                   EREEAR"
FT   CDS_pept        552974..553462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbW"
FT                   /product="negative regulator of sigma-B activity (switch
FT                   protein/serine kinase, anti-sigma factor)"
FT                   /note="BH0528"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04247"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04247"
FT                   /db_xref="GOA:Q9KFF1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010193"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KFF1"
FT                   /protein_id="BAB04247.1"
FT                   /translation="MRVHQPETIEMTVPAKSEFVGVVRLTVSGIANRLGYTYDDIEDIK
FT                   IAVAEACTNVVDHAYDEGGTMGLSFHLYEDRMEIIVTDQGQSFDMDAFRESLGPIDGSK
FT                   PIQDLKEGGLGLFLINTLMDKVEMKEDSGVVLAMTKFLQRDEVDNRVDGISATQTEQR"
FT   CDS_pept        553422..554207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigB"
FT                   /product="RNA polymerase general stress sigma factor(sigma
FT                   B)"
FT                   /note="BH0529"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04248"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04248"
FT                   /db_xref="GOA:Q9KFF0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014288"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFF0"
FT                   /protein_id="BAB04248.1"
FT                   /translation="MSMESLQHKRNNDEVYDWIESYQQGADEEIQTKLVKHYEPLVHSL
FT                   ARKFSRSRAHDDDLIQVGMVGLLAAFERYDPKYGRSFESFAVPTIIGEIKRFIRDKTWS
FT                   VHVPRRIKELGPKIKKAADELASELQRSPRVEEIADFLGVSEEEVLETMEMGKSYQALS
FT                   VDRSLEADPEGGEVTLLDLVGQEDGGYEKADQQMLLEKAFQVLDEREKQILLCTYFEHL
FT                   SQKETGHRLGISQMHVSRLQRRALKKLRDSIRVELSECI"
FT   CDS_pept        554208..554828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbX"
FT                   /product="indirect negative regulator of sigma-B activity
FT                   (serine phosphatase)"
FT                   /note="BH0530"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04249"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04249"
FT                   /db_xref="GOA:Q9KFE9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFE9"
FT                   /protein_id="BAB04249.1"
FT                   /translation="MVETYNHDRATIVVWQRTKKGNDCCGDAHVVVNQDEYTLCAVVDG
FT                   LGSGQGASESALAAVQTIKEHAAENLPTIMERCNESLFSKRGAVLTILKIDYLQQHIKY
FT                   TNIGNVCFHLCAPSGKRVRPLPVQGYLSGKKDLTVEEKVFPYEEGSVFILHSDGVKDEK
FT                   FLLYSVLDSTVTPDLFIEMLEEKGSTDDLTILVGKLSKPARSE"
FT   CDS_pept        554948..557134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0531"
FT                   /note="BH0531"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04250"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04250"
FT                   /db_xref="GOA:Q9KFE8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFE8"
FT                   /protein_id="BAB04250.1"
FT                   /translation="MSVPLGFEEHTIKTLAKELSLKPNYIKQVIQLLHEGNTVPFIARY
FT                   RKELTGGMDEVKIREVSEKWTYANQLHERKEEVIRLVEEQGKLTDEWKKTVEQAQKLQE
FT                   VEDLYRPYKQKRRTRATVAKEKGLEPLAEWLFSLPRDGDPLQEAEVYLSVEHELTKVED
FT                   VLQGAQDIIAEWIADDADLRKRIRSLGFKEGSVIAKVKKEELDEKGVYEMYYDYEEPVR
FT                   TLVPHRTLALNRGEKEDVLRVTIRFPVDRIIEMSEKTFIRRFGSPAVPYVKAAIEDGYK
FT                   RLIEPSIEREIRHELTEKAEEQAIHIFAENLRSLLLQPPIKGKVVLGLDPAYRTGCKLA
FT                   IVDETGKVLDIQVIYPTPPKNEVAAAKKIVKKLIADYGVEMIAIGNGTASRESEQFIAD
FT                   LIKDLPQTIYYLIVNEAGASVYSASEIGREEFPDLQVEERSAVSIARRLQDPLAELVKI
FT                   DPKSVGVGQYQHDVSQKRLNESLTFVVETVVNQVGVNVNTASPSLLQYVAGLSKTVAKN
FT                   IVKKREEAGRFTARAQLKDIPRLGAKTYEQCIGFLRIMDGDNLLDATAIHPESYKVTDK
FT                   LLSEVGATAADVGIEDLKKKLQALDVSAMAATLDVGVPTLKDMIDALIRPTRDPRDEVA
FT                   KPLLKQDVLQLEDLLPGMELQGTVRNVVDFGVFVDIGVKQDGLVHISKLANRYIKHPLE
FT                   VVTVGEIVTVWVEDVDIKKGRIALTMLRPEDENL"
FT   CDS_pept        557430..557885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0532"
FT                   /note="BH0532"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04251"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04251"
FT                   /db_xref="GOA:Q9JWQ2"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JWQ2"
FT                   /protein_id="BAB04251.1"
FT                   /translation="MTEQELQQLVEDISLKSFGMKFRHKARFNPRLRTTGGRYLLHSHD
FT                   IELNPKHLELFGLDELIGIIKHELCHYHLHLQKKGYHHRDADFKLLLKEVDAPRYCAKI
FT                   PHAQNSVKTRHLYVCTGCGTRFERKREVDTSRYVCGKCNGRLKKIKG"
FT   tRNA            558019..558093
FT                   /gene="trnG-Asn"
FT                   /product="transfer RNA-Asn"
FT   tRNA            558096..558186
FT                   /gene="trnG-Ser"
FT                   /product="transfer RNA-Ser"
FT   tRNA            558197..558271
FT                   /gene="trnG-Glu"
FT                   /product="transfer RNA-Glu"
FT   tRNA            558305..558380
FT                   /gene="trnG-Val"
FT                   /product="transfer RNA-Val"
FT   tRNA            558388..558464
FT                   /gene="trnG-Asp"
FT                   /product="transfer RNA-Asp"
FT   tRNA            558492..558574
FT                   /gene="trnG-Leu1"
FT                   /product="transfer RNA-Leu"
FT   tRNA            558590..558673
FT                   /gene="trnG-Leu2"
FT                   /product="transfer RNA-Leu"
FT   tRNA            558683..558759
FT                   /gene="trnG-Arg"
FT                   /product="transfer RNA-Arg"
FT   tRNA            558780..558856
FT                   /gene="trnG-Pro"
FT                   /product="transfer RNA-Pro"
FT   tRNA            558863..558936
FT                   /gene="trnG-Gly"
FT                   /product="transfer RNA-Gly"
FT   tRNA            558976..559052
FT                   /gene="trnG-Ile"
FT                   /product="transfer RNA-Ile"
FT   rRNA            559243..560794
FT                   /gene="rrnF-16S"
FT                   /product="16S ribosomal RNA"
FT   rRNA            561522..564460
FT                   /gene="rrnF-23S"
FT                   /product="23S ribosomal RNA"
FT   rRNA            564869..564984
FT                   /gene="rrnF-5S"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        565572..566828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0533"
FT                   /product="transposase (11)"
FT                   /note="BH0533"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04252"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04252"
FT                   /db_xref="GOA:Q9JWR9"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWR9"
FT                   /protein_id="BAB04252.1"
FT                   /translation="MLERILSRENLIQALERVEKNKGSYGVDEMDVKSLRLHLHENWTS
FT                   IRNEIIEGSYFPKPVRRVEIPKPNGGVRKLGIPTVMDRFLQQAIAQILTQLYDPTFSER
FT                   SFGFRPHRRGHNAVRQAKQWMKEGYRWVVDIDLEKFFDKVNHDRLMRKLSSRIQDPRVL
FT                   QLIRRYLQTGVMERGLVSPNTEGTPQGGPLSPLLSNIVLDELDNELEKRGLKFVRYADD
FT                   CNIYVRSKRAGLRIMESVTSFIENRLKLKVNREKSAVDRPWNRKFLGFSFTRGKDPKMR
FT                   VSKESVKRLKQRIRELTSRRHSMKMSDRLRRLNRYLTGWLGYYQLVDTPSILAQIDAWI
FT                   RRRLRMIRWKEWKTTSARQKNLVRLGIKKAKAWQWANSRKGYWRVAHSPIMDYALNSEY
FT                   WKGQGLMSLAERYQTRRWT"
FT   CDS_pept        567600..568748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0534"
FT                   /product="NAD-dependent methanol dehydrogenase"
FT                   /note="BH0534"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04253"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04253"
FT                   /db_xref="GOA:Q9KFE7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFE7"
FT                   /protein_id="BAB04253.1"
FT                   /translation="MNINKFVTPEIIFGGHAIRQAGDACVRLGAKKVLIVSDRGVANAG
FT                   WLEKVMELCKESHLPFATFVGVTTDPKDREVEQGCQVFVQHECDAIIGVGGGSVLDVAK
FT                   AIAILATNGGAISDYEGIDKIKKPLPPMIMIMTTAGSGSEVSQFSIIVDSNRKKKMTIV
FT                   SKTLVPDIAIIDPYTLVTKDSSLTATTGMDVLTHAIEAYVSIAATPLTDVQAKNALILC
FT                   AQYLRPSVASKTNTEAKEAMAMASLQAGLAFSNAILGAAHAISHAIGGKFPLPHGEINA
FT                   ILLPYVMDFNFIATPKRFLDIATCLGIDTRGLTEREAGNAAIHFVKELSFDIGIPTRFR
FT                   EVGITQEMIHHISEVALEDACMITNPRDMNVEQVKQVLKNVL"
FT   CDS_pept        568761..568880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0535"
FT                   /note="BH0535"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04254"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04254"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFE6"
FT                   /protein_id="BAB04254.1"
FT                   /translation="MLEDKQKMIARLTGVDSSKKTYYTELKKTVEQLKKKIFN"
FT   CDS_pept        568898..570406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cckA"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="BH0536"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04255"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04255"
FT                   /db_xref="GOA:Q9KFE5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="PDB:3O5Y"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFE5"
FT                   /protein_id="BAB04255.1"
FT                   /translation="MKSIKIDMSLDDIINNMIDKLKLLVHFDRISFLLLANETLKLSHV
FT                   YPKGSHSLDIGSTIPKEQSLYWSALDQRQTIFRSLTDTQDNFYEKQYLAILDLKSILVI
FT                   PIYSKNKRVGVLSIGRKQQIDWSLDDLAFLEQLTDHLAVSIENVELYGQVLRSKQEWED
FT                   TFKAVDDMIIVFDQEGNVIQFNDAVQHFLQSTKLTKISLLAEHCEPLVKETFKSQKAGH
FT                   EEIHFRNQIICELSTYPLVNNEQVIYGVIAYIKDVTEKRKMEVQLIHSGKLAAIGEMAA
FT                   GVAHELNSPLTAILGNSQLILRDVKGHDPLFPLLTDIKNCGNRCKRIINSLLTFSRQEE
FT                   FVFEACAINDAVNETLNLLKYQLQKEEVVIKTDLQEDIPLIEGNQAQIEQIIINLLLNA
FT                   KDALEEALSDKKEVLIKTWFQYNEVHLSVTDNGIGIEEERLAEIFHPFHTTKSSKEGTG
FT                   LGLSVSIGIAKSHGGTIDVHSKHKKGSTFILRLPAASTKIGGAV"
FT   CDS_pept        570403..571854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0537"
FT                   /product="transcriptional regulator"
FT                   /note="BH0537"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04256"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04256"
FT                   /db_xref="GOA:Q9KFE4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFE4"
FT                   /protein_id="BAB04256.1"
FT                   /translation="MTSILIIDDEVEVGNFLSHLFMSKGYNVTVVNSGKEFNEIDFSHQ
FT                   PFHAAMIDLKLPDANGLVLLKHLKRRQPHCKVIIMTGYSTIKTAVEAMKLGASDYIEKP
FT                   FDDIDLLEAQVDDLLISNVTSNEQRILDLAINVGLIVGQNETMRQLIQTAYKVAGKNVN
FT                   VLIEGETGTGKEVLARFIHQASQRSYESFIGVNCGALSESLLESELFGHEKGAFTGATQ
FT                   MRKGLFEIASKGTLFLDEIAEASTSIQVKLLRVLETREFMRLGGERIFRTNTRLLAATN
FT                   EDLQEAVQQKKFREDLFYRLNVVHLQIPPLRERKEDIPLLMEHFLKRYPGIEITFSDDA
FT                   VKTMQSYEWPGNIRELSNCITRIVTLADSGHVKITADHLPFTGQRSVTSKKLTASSRSE
FT                   TLGEGMDEHIEKWMDEALCFYSQKEDIDLEEVLAQVKQLESQLGKALILQTLEATHGNR
FT                   KEAAKRLQISTRKLRYLLNEKVNTE"
FT   CDS_pept        572072..572668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0538"
FT                   /product="NADP-dependent alcohol dehydrogenase"
FT                   /note="BH0538"
FT                   /note="incomplete"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04257"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04257"
FT                   /db_xref="GOA:Q9KFE3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFE3"
FT                   /protein_id="BAB04257.1"
FT                   /translation="MGEITERRMMKAAVVDKFKQQLEIKEVPVPSLEYGEVLVKIKACG
FT                   VCHTDLHAAHGDWPVKPKLPLIPGHEGVGIVEEIGEGVTSIKVGDRVGIPWLYSACGEC
FT                   EYCLTGRETLCPDQLNAGYSVDGGYAEYCKAPANYVVKIPEHLDFAEVSPIFCAGVTTY
FT                   KALKVAEAKAGDWGRHLWNRWTRSRCSTVCKSDGL"
FT   CDS_pept        573140..574636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaS"
FT                   /product="NADP-dependent aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="BH0539"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04258"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04258"
FT                   /db_xref="GOA:Q9KFE2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFE2"
FT                   /protein_id="BAB04258.1"
FT                   /translation="MQKISTNDSKLNPRLVAFLNGGPKKLFINGEWVDSFSGQSFETMN
FT                   PATGETLALVAEAGSEDIDFAVKAARKAFDEGPWSKMSAAERSRLIYKLADLIEDHKEA
FT                   LAQLETLDNGKPIRETANADIPLVIEHFRYFAGWATKIVGQTIPVQGHYFNYTRHEAIG
FT                   VVGQIIPWNFPLLMAAWKLGAALATGCTVVLKPAEQTPLSALYLGELINEAGFPKGVVN
FT                   IVPGFGHSAGTPLVNHPAVDKVAFTGSTDVGKLIMKQASESLKRVTLELGGKSPNIILP
FT                   DADLSKAVPGSLMGIMFNQGQVCCAGSRLYVQKKQYDHVVADLVSLTNEIQQGDGLLEQ
FT                   TTMGPLISNQQQSRVKNYIDRGVEEGAELLTGGNIPYDQGYFVAPTIFADVDHSMTIAK
FT                   EEIFGPVVAAMPFDSIDDLIDKANDSDYGLAAGVWTQDIKKAHYIAHRIKAGTIWVNCY
FT                   NVFDAASPFGGYKQSGIGREMGSYALENYTEVKSVWVNMD"
FT   CDS_pept        574664..574738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0540"
FT                   /note="BH0540"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04259"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFE1"
FT                   /protein_id="BAB04259.1"
FT                   /translation="MIHASLLILIFKNARDATRADLIF"
FT   CDS_pept        complement(574741..575460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0541"
FT                   /product="Mg2+-transporting ATPase"
FT                   /note="BH0541"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04260"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04260"
FT                   /db_xref="GOA:Q9KFE0"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFE0"
FT                   /protein_id="BAB04260.1"
FT                   /translation="MLYELLIKLSLSLVLGLLIGIDRQMKHKPLGLRTSMVICVASCLL
FT                   TIVSIEHISRSGLIFHNTNNVDPMRLAAQIVSGIGFLGAGVILRRNNDVISGLTTAAMI
FT                   WAASGLGIAIGAGFYFESFFAVILILIAVNVIPIMFRWVGPASLRHRDVGVKMVLTEQA
FT                   NIANVIEAINQTSDATKTFRKRKDRVDIRNLKMKDLEANKQQLQFTLSIPSHQYSVEFF
FT                   YKLKAIPSVDSVELGDL"
FT   CDS_pept        575658..576803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0542"
FT                   /product="cystathionine gamma-synthase"
FT                   /note="BH0542"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04261"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04261"
FT                   /db_xref="GOA:Q9KFD9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFD9"
FT                   /protein_id="BAB04261.1"
FT                   /translation="MREKKFATKSVHFTEKEISKNRSKSKPIYQTSAFVFQDLDDMESF
FT                   YRGEKEYLYTRYGNPNSDDLGKGVASLEQAEDGVATSAGMSAILVALLALLEKGDHLIA
FT                   ANDLYGGTYQLLAEELPKLGIDVSFVPFQEREVVKRAIRKETKVLYSETVTNPLLRVED
FT                   IHQVVELGKEHGLSTVIDNTFATPYFVQPLTCGVDVVVHSATKYIGGHSDVTAGVVVGS
FT                   AEIIQQVRQKVATLGCNLSPFEAWLASRGLKTLALRMERQGENAQALATFFADHPGVSQ
FT                   VFYPTTVSKRGNGAIVTIRLAEKVEAATFFESLDWVKIAPTLAGVETTVSYPIQTSHRT
FT                   VPESLRQELGIDKQLVRISVGIEDIEDIMAAFDKAIKKAGS"
FT   CDS_pept        complement(576822..576980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0543"
FT                   /note="BH0543"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04262"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04262"
FT                   /db_xref="GOA:Q9KFD8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFD8"
FT                   /protein_id="BAB04262.1"
FT                   /translation="MAKIFWQGARIMILTPVGLVLTALFLPVLLFTDQIPLLQDFFEFI
FT                   FHTHNKS"
FT   rRNA            577146..577261
FT                   /gene="rrnI-5S"
FT                   /product="5S ribosomal RNA"
FT   tRNA            577380..577453
FT                   /gene="trnH-Met"
FT                   /product="transfer RNA-Met"
FT   CDS_pept        577614..578600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0544"
FT                   /product="thiamin-monophosphate kinase"
FT                   /note="BH0544"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04263"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04263"
FT                   /db_xref="GOA:Q9KFD7"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFD7"
FT                   /protein_id="BAB04263.1"
FT                   /translation="MRDEFSLIRSISPANVHQPSLHVGIGDDAAIYEGAPEMEEVLCVD
FT                   TMVEEIHFRRDTLTPFQIGYKSLAINISDLAAMGATPKFYLVSIAVPPQWSDREIKTLY
FT                   RGMAECAAPYRMDLIGGDTVSTNAKLVVTVTAVGHVPKGTRLLRQRARPGDVVFLTGTV
FT                   GQSAAGLELLNKKGLHGPFTEEEELLVLAHQQPQPQVEAGHLFARSGYRIALNDVSDGV
FT                   ASEANELAEASKVKLVLKANTIPLHPAMETFSKEQQLEWALFGGEDFQLIGTAAVDAFA
FT                   SLQQLAIQRGISLTEIGYVEAGSPVVELEEGTARSVLKKSGYNHFAK"
FT   CDS_pept        578612..579085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0545"
FT                   /note="BH0545"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04264"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04264"
FT                   /db_xref="GOA:Q9KFD6"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFD6"
FT                   /protein_id="BAB04264.1"
FT                   /translation="MKRLMMITQSPEATMAFAQKLADKLLAGDVITLEGDLGAGKTSFT
FT                   KGLALGLGIKRVVKSPTFTIIREYKGRLPLYHMDVYRLNEEEEDLGFDEYFHGDGVTVV
FT                   EWASLIEGRLPPVRLAITITHAGENERQLSFTAYGERWEEVLKELLDHEDVSD"
FT   CDS_pept        579066..579776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0546"
FT                   /product="glycoprotein endopeptidase"
FT                   /note="BH0546"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04265"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04265"
FT                   /db_xref="GOA:Q9KFD5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFD5"
FT                   /protein_id="BAB04265.1"
FT                   /translation="MKTLAIDTSTYVMGVAILDGNQLVGEVTTNLKKNHSLRLMPAIES
FT                   LMKEVGVAPNELERIVVAQGPGSYTGVRIGVTTAKTLAWSLGISLVGVSSLEVMAQHGY
FT                   YAKELIVPLIDARRGQIYSGTYRWNGKEVDVVEADRLILAGDLARMLAKAGEDVLLIGQ
FT                   DVSMHYDTFAAVLGEKVKRAPFTHSLPRPAELGRLGQQRSPIENLHAFAPSYLQLAEAE
FT                   AKWREAKRQDENNG"
FT   CDS_pept        579769..580224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0547"
FT                   /product="ribosomal-protein (S18)-alanine
FT                   acetyltransferase"
FT                   /note="BH0547"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04266"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04266"
FT                   /db_xref="GOA:Q9KFD4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFD4"
FT                   /protein_id="BAB04266.1"
FT                   /translation="MAEKKERIRFMTVDDVDAVVRVEEQTFTVPWSREAFINEVTNNQF
FT                   ARYVVYEVGEQIVGYCGVWVVYDESHITNIAIHPDYRGEKRGEALLRYILEFARLLGAK
FT                   KLSLEVRISNEIAQRLYRKFGFQAGGIRKNYYTDNQEDALVMWVMLS"
FT   CDS_pept        580206..581237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0548"
FT                   /product="glycoprotein endopeptidase"
FT                   /note="BH0548"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04267"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04267"
FT                   /db_xref="GOA:Q9KFD3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KFD3"
FT                   /protein_id="BAB04267.1"
FT                   /translation="MGDVVMNERELILAIETSCDETSAAVIENGTTILSNVVSSQIDSH
FT                   KRFGGVVPEIASRHHVEQITVIVEEAMHEAGVDFADLAAVAVTEGPGLVGALLIGVNAA
FT                   KAIAFAHQLPLIGVHHIAGHIYANRLLKELEFPLLALVVSGGHTELIYMENHGEFEVIG
FT                   ETRDDAVGEAYDKVARTLGLPYPGGPHIDRLAVNGEDTLQFPRAWLEPDSFDFSFSGLK
FT                   SAVINTLHNAKQRGENVQAEDVAASFQASVIDVLVTKTKKAAEEYKVRQVLLAGGVAAN
FT                   KGLRTALEEAFFKEPIDLVIPPLSLCTDNAAMIGAAASIKFKQQTFAGMDLNGQPSLEL
FT                   END"
FT   CDS_pept        581566..583722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0549"
FT                   /note="BH0549"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04268"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04268"
FT                   /db_xref="GOA:Q9KFD2"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFD2"
FT                   /protein_id="BAB04268.1"
FT                   /translation="MKWFYSCLLASMLILGCSSLAEAFEHETSNLILLLVPSLSFDEVE
FT                   WLLEHGQHSDMWETGHLAAMNIRSDGPYSYLNSTVTLSLGARGEGVSDWNAFERGELVL
FT                   GQPVEAIMQQWLSQKQESQLYHPYLPQLVKKNAQGHLVGRLGTLLKQHDVTMNVFGHSD
FT                   TATEPHRYGSLFVMDGQGRATGDLQGTVRALMSAPHGMAMNEEALLSKLRDQTDSKAFT
FT                   VIEWGDLYRLFDQKKNMPSAIFAEKRAKELYRLETFIHNVTTGSASDVWLLAPIMHDEA
FT                   YKQKKRLAPTYFWGSGFKGSPYSASTRRSDVLANVDVAPTILSYFHISPDPQMTGRPLL
FT                   FQVDSVENDKEAIVSEVNKRFTIFRTRGAVLSSYITMLVVMLLVASIGSWVKKGNPRWR
FT                   LGMKMILASAVSTPLWLLVLTPFVHEVGPYLFVLTVIGCSLILGWTATQLSAQPIWLLG
FT                   FLLVAAISIDLMNGGPFIATSYLGYDPIIGARYYGIGNEFAGLYIAAAVLLITGAVWQT
FT                   ELWKRLVTVFVVSGFTLMMLGMSQFGANAGATLSAGIACAFVGYTLIGKQLSKWNLVIV
FT                   SGGALLITLLLLFVLQMNSPSTHIGDAYERLLSGDIQYVLQTMKRKVAMNMTIFRYSNW
FT                   TQLFVTSYLLLGVLIWTQSAKKYDAGQSLFLKGGIVASVALLLLNDSGVVAAATSMFFI
FT                   VSTNYYWLLAQMQNGKMMSEGKEM"
FT   CDS_pept        complement(583767..585695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0550"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="BH0550"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04269"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04269"
FT                   /db_xref="GOA:Q9KFD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFD1"
FT                   /protein_id="BAB04269.1"
FT                   /translation="MIVLQCVNITKSFGAETILSNIKLEVKTGDRVALVGRNGAGKSTL
FT                   LKIIADKLSYDSGDLIIPKGVEIGYLEQHTGLESDLTIWDEMLSVFEPLQQMERRLRKM
FT                   EEQMANPALLNNASSYEKLLEEYDSLQVEFKDRGGYQYEADIRNVLAGLQFADFPYHET
FT                   KIATLSGGQKTRLALGKLLLTKPDLLILDEPTNHLDIDTLSWLEQYLSAYPGAILIVSH
FT                   DRYFLDKLVTQVYEISRTKSTKYVGNYSHYLDEKALRYEQELKEFEKQQKEVAKLEDFI
FT                   QRNIARASTTKRAQSRRKALERMTKLDRPNSDEKSASFFFDIERQSGNDVLRVRDLTFS
FT                   YDGDPLFSRLDLDLNRGESVALIGPNGAGKSTLLKLLTKKLQADQGTIEYGSHVKIGYY
FT                   DQEQANLHSNKQVLYELWDDYPLLPERDIRTVLGNFLFSGEDVLKVVSDLSGGEKARLA
FT                   LAKLMMEKANLLIMDEPTNHLDLDSKEVLENALIDYPGTLLFVSHDRYFLNRMATRIIE
FT                   LDGGQPSVFLGDYDYYLEKKQEIKERERLDESPSHAAAASSKKGSFEQDKEQKKRERQR
FT                   QRRIEQIEASIEELEKQLSTHEEALCNPEVFTDHEKALSHQQTIDEAKKAVDALMEEWE
FT                   LLHAEEG"
FT   CDS_pept        585858..586493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0551"
FT                   /product="DNA-binding protein"
FT                   /note="BH0551"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04270"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04270"
FT                   /db_xref="GOA:Q9Z9P6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9P6"
FT                   /protein_id="BAB04270.1"
FT                   /translation="MNNEPTKIPQATAKRLPLYYRFLENLHASGKQRVSSSELSEAVKV
FT                   DSATIRRDFSYFGALGKKGYGYNVNYLLTFFRKTLHQDELTKVMLIGVGNLGTALLNYN
FT                   FSKNNHTQIVMAFDVDREKIGNTVSGVKIENLDNLENKITSDVSVAILTVPAAVAQKTA
FT                   DRLVNAGVKGILNFTPARIAVPEHVRVHHIDLSVELQALIYFLKHYPL"
FT   CDS_pept        586522..586719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0552"
FT                   /note="BH0552"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04271"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04271"
FT                   /db_xref="GOA:Q7AJY2"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AJY2"
FT                   /protein_id="BAB04271.1"
FT                   /translation="MPGGLGAGSILIIALVALLIFGPKKLPELGKAAGNTLREFKNATK
FT                   GLADEDDDVKKKNENQQNGQ"
FT   CDS_pept        586732..587493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0553"
FT                   /note="BH0553"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04272"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04272"
FT                   /db_xref="GOA:Q9Z9P4"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9P4"
FT                   /protein_id="BAB04272.1"
FT                   /translation="MNERDMSLMDHIAELRRRILIIVVFFVIALVVGFFLATPMITYLQ
FT                   GAPTAQDLPMNAFKLTDPLRVYMTFAFTSAFILVFPIILYQLWAFVSPGLHENERKATL
FT                   AYIPIAFFLFLGGLSFAYFILFPFLIQFIGGLAERLHINELYGINEYFTFLFQITMPFG
FT                   VLFQLPVVVMFLTRLGIVTPEFLRSVRKYAFFVLLVVAGFITPPELISHLMVTVPLLLL
FT                   YEFSIWVSHLTYRKVQKLEKLRQEEYRQEEG"
FT   CDS_pept        587660..589084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0554"
FT                   /product="multidrug resistance protein (efflux
FT                   transporter)"
FT                   /note="BH0554"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04273"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04273"
FT                   /db_xref="GOA:Q9KFD0"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFD0"
FT                   /protein_id="BAB04273.1"
FT                   /translation="MKNIPKKWMVVCAVLFGSFTMILNNSMLNPAIPQLMNVFEADAVA
FT                   TGWVITIFMVAMGMTMPLTGYLGDKIGKKEAYILGLGIFVLGSLLGALSWNLPSLIVFR
FT                   GLQGIGGGVMMPLSMTLIFDAFPRNERGLATGVWGVASMMAPTIGPTLGGFIVETSNWK
FT                   YLFLVNIPFGLLGIIAAVIYLPKIARSGQIKLDRWGFLFVTAGVGSILLAFGRMSDLTH
FT                   LTEWINGVLLLLGALCLYVFVQVEKRAEQPLLDLSLFRIPAYSLSIWVAGISSIGLFAG
FT                   IFLVPLLLQQVYDYGPIMTGLVFLPSALFTGLTMSIGGRMLDKRGPSGIMTAGMMIAAV
FT                   GTFALGYLHLETGLWYIFAWMAIRGVGMGLTTMPATTTGMNAIPEGLISRGSAMNNVLR
FT                   QMSSAFGIVFISVFFEVRRGQLALVSTSFEEATLQAINEGFFIVGFLTALSIPAAYWLE
FT                   KKAKQGEQERVNSTAS"
FT   CDS_pept        589266..590408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0555"
FT                   /note="BH0555"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04274"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04274"
FT                   /db_xref="GOA:Q9Z9P2"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9P2"
FT                   /protein_id="BAB04274.1"
FT                   /translation="MNTIVIAPDSFKESMTALQAARAIEKGFRRVIPNANYRLIPMADG
FT                   GEGTVQSIVDALQGERKVVKVEGPLGDTVEAEYGLSGDRKIAVIEMAQASGLHLVPKEK
FT                   RNPLWTSTYGTGQLLIDALDEGVEQIILGIGGSATNDGGAGMAQAVGVRLLKENGEPIG
FT                   KGGGKLKELARIDMSKVDPRIQQVKLQVACDVDNPLVGEKGAAVVYGPQKGATRATIRE
FT                   LDEQLLHFANIIEEELGKEVASIPGAGAAGGLGAGLIAFLDAKLIPGVELVLQATNFHE
FT                   LVKDADFVITGEGRIDQQTVYGKTPIGVAKAAKQYGVPVIAIAGSLGQGYEAVFEHGID
FT                   AAFSLVPRIMSLDEAMQQGDSLLEQAARNIAVVSSWNKST"
FT   CDS_pept        590464..590667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0556"
FT                   /product="mercuric transport system (mercuric-binding
FT                   protein)"
FT                   /note="BH0556"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04275"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04275"
FT                   /db_xref="GOA:Q9KFC8"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFC8"
FT                   /protein_id="BAB04275.1"
FT                   /translation="METTLNVKGMSCQHCVKAVEENVGQLTGVEKVTVQLDKGTVNVSY
FT                   KEDQVSIDKIKDTIEDQGYDVE"
FT   CDS_pept        590740..593160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0557"
FT                   /product="copper-transporting ATPase"
FT                   /note="BH0557"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04276"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04276"
FT                   /db_xref="GOA:Q9KFC7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFC7"
FT                   /protein_id="BAB04276.1"
FT                   /translation="MKNQKELTLDIQGMTCAACSNRIEKGLQRMDGVQEANVNLTLERS
FT                   TVVYDPEKVQPEQVIEKVEQLGYKVVIDRVEFDVVGMTCAACANRIEKKLNRLEGVHKA
FT                   VVNLALETATVEYRPESVSPSDLEQAIEQIGYTLKRKTGDAEEGDVRERELQKQKRRFW
FT                   ISAVLTLPLLWSMVTHFEFTSFIWMPHLFMDPWVQLLLATPVQFYIGAPFYVGAYKALR
FT                   HKSANMDVLVALGTSAAYFYSMYLGYDWLYGTREGMMPELYFEASAIIITLIVLGKYFE
FT                   ARAKGRTSEAIRKLLGLQAKTARVIREGKEEQIPLEEVKTGDLLLVKPGEKIPVDGEVV
FT                   EGYSAVDESMLTGESIPVEKDVGDQVIGATVNHNGSLRIRATRVGKDTALAQIVKVVEE
FT                   AQGSKADIQRAVDKVSSIFVPVVVAISVLTFLVWYMVIDPGNVTSALIPTISILVIACP
FT                   CALGLATPTSIMAGSGRSAELGVLFKGGEHLEHTQRIDTVVLDKTGTVTEGKPSLTDFV
FT                   TYGSADEKEMATMLHAAERRSEHPLATAIVDGMKQLGVDRLEADSFSAIPGHGVEAMVA
FT                   GRNVLVGTRKLMAEHQVDYKEALSSAEAREARGETVMFMAVDGILTAHVAVADQLKSSS
FT                   KKAIERLKALGLDIVMLTGDNERTARAVANDVGIEQVIAEVLPKDKSEQIRKLQKQGRT
FT                   VAMVGDGLNDAPALATADVGMAIGSATDIPIEAADLTLLGDDLHRVADAVLMSQKTMRN
FT                   IKQNLFFAFVYNTSAIPIAAAGLLAPWVAGAAMAFSSVSVVLNALRLQRFQIK"
FT   CDS_pept        593188..593490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0558"
FT                   /note="BH0558"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04277"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04277"
FT                   /db_xref="GOA:Q9KFC6"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFC6"
FT                   /protein_id="BAB04277.1"
FT                   /translation="MAHEHKSPSHPRDEKEKEQLMNRLKRIEGQVRGIQKMIDDDRYCI
FT                   DILVQLSAIDAALKKVSLNLLERHTSHCVVDAVEKGKSEEAIAELMDVFERFSKI"
FT   CDS_pept        complement(593533..593730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0559"
FT                   /note="BH0559"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04278"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04278"
FT                   /db_xref="GOA:Q9KFC5"
FT                   /db_xref="InterPro:IPR025426"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFC5"
FT                   /protein_id="BAB04278.1"
FT                   /translation="MKISPTFLTLLYFTMAGLVTFFAIHVVNENGWNLWAWIMIAMAAY
FT                   NVIIAIRFYQLGKQLKKRDR"
FT   CDS_pept        complement(593727..594440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0560"
FT                   /note="BH0560"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04279"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04279"
FT                   /db_xref="GOA:Q9KFC4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFC4"
FT                   /protein_id="BAB04279.1"
FT                   /translation="MNKRYWLVILTYGLTQVSAFIGVPLLLILGFQQEQIPGIWSFISF
FT                   PIGLAIILWLLRPDFRNRHMIRNRSSRGEAVAWSILGVILVFVAQAIAAYIEMTVFGIE
FT                   PGSENTEMIVEVTRAFPAFIIVTSIIGPILEEIVFRMIIFGALYKRFNFWIAALLSSFI
FT                   FAAVHLDFTHLLVYTAAGFAFAFLYVKTKRILVPIVAHVAINVYVVLVNLIFYDKILDL
FT                   QRQLEELQMFIGGLL"
FT   CDS_pept        594759..595043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /product="class I heat-shock protein (chaperonin)"
FT                   /note="BH0561"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04280"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04280"
FT                   /db_xref="GOA:O50304"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:O50304"
FT                   /protein_id="BAB04280.1"
FT                   /translation="MLKPLGDRVVIEQVETEEKTASGIVLPDTAKEKPQEGRVVAVGTG
FT                   RVTENGEKIALEVKEGDSVIFSKYAGTEVKYDGKEYLILRESDILAIIG"
FT   CDS_pept        595136..596770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /product="class I heat-shock protein (chaperonin)"
FT                   /note="BH0562"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04281"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04281"
FT                   /db_xref="GOA:O50305"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:O50305"
FT                   /protein_id="BAB04281.1"
FT                   /translation="MAKDIKFSEDARRSMLRGVDKLADAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLK
FT                   NVTSGANPMVIRKGIEKATQVAVEELSKISKPIEGKDSIAQVAAISSADDEVGKIIAEA
FT                   MERVGNDGVITIEESKGFSTELEVVEGMQFDRGYASPYMVTDSDKMEAVLDNPYVLITD
FT                   KKISNIQEVLPVLEQVVQQGKPILIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGD
FT                   RRKAMLEDIAILTGGEVITEDLGLDLKSANITQLGRASKVVVTKENTTIVEGAGESDKI
FT                   AARVNQIKAQIEETTSDFDKEKLQERLAKLAGGVAVLKVGAATETEMKERKLRIEDALN
FT                   STRAAVEEGIVAGGGTALVNVIKAVSSIGAEGDEATGVNIVLRALEEPVRQIAHNAGLE
FT                   GSVIVERLKKEEAGFGFNAATGEWVNMVEAGIVDPTKVTRSALQHAASVSAMFLTTEAV
FT                   IADKPEENEGGGGMPDMGGMGGMGGMM"
FT   CDS_pept        597785..598153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0563"
FT                   /note="BH0563"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04282"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04282"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFC2"
FT                   /protein_id="BAB04282.1"
FT                   /translation="MIVVDKRKYKMGINEVAKEIHVQVHGLMREEDVEGYMKDLQDTIH
FT                   KVPKQEYTFVVDATYQTPVPSKVVPQLGQTMQFYSSLGFKDIIVVKPSSKIAQVQIRNA
FT                   LERIEFPGTFVDRIAHSM"
FT   CDS_pept        598205..598915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0564"
FT                   /note="BH0564"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04283"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04283"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFC1"
FT                   /protein_id="BAB04283.1"
FT                   /translation="MQKTEALYTYKIITKEQTALIEQAADCLARSFIGVDVSGKWVQEP
FT                   MVGQLNLRYDDFYQFTKDYLDSTVEQGYCAVALDHDHHVVGVLAGDTNAPEIIGEDVFE
FT                   GSFYDMNVILRVLEDVDKRFMEDFKERNGKELEDGELLHLFMLGVTAEYNRHDIIQQLG
FT                   NKLITKASSQGLKAILAEATNAKSIRVMEKYHNMKKYKDVEGNEIVHKYEENARLKDIP
FT                   SDIADGTYILIKEL"
FT   CDS_pept        598961..600166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0565"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="BH0565"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04284"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04284"
FT                   /db_xref="GOA:Q9KFC0"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFC0"
FT                   /protein_id="BAB04284.1"
FT                   /translation="MFIMEAIMVVLIVILLGTTVYFAYRYFSLKHQPIHKEITNGMKEI
FT                   VAGKLVNKMDEKSSNHAVFNQLIEFVSRVREKFLLFSKNVHEKGENLAEIGEYATEKAD
FT                   IVRAAIDEVGRGLNKQLVATEENAMSMEEMTQAIEDLSQRSNEISELSNTTLDLTQEGS
FT                   EKLKDSLEKMKQLNQTINTTYDAINKLGEKSHEIGMIVKVITGISEQINLLALNASIEA
FT                   ARAGEHGKGFAVVADEVRKLAEQSRQSSSEVSNIVKNIQEETGIVVGSMQKGTEEFEDT
FT                   NTTIVEVGAMFEKILTATRTIAENNGNSSASTEELSAASQQIMTTIEEIASISRESVEM
FT                   FEELTEISDDELSTLEKLVQEAKPLLALKQDVNQLLLAWDREDETEDMNQETEDKISVA
FT                   VS"
FT   CDS_pept        600398..602041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0566"
FT                   /product="2,4-diaminobutyrate decarboxylase"
FT                   /note="BH0566"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04285"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04285"
FT                   /db_xref="GOA:Q9KFB9"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFB9"
FT                   /protein_id="BAB04285.1"
FT                   /translation="MAEIHKLFPSMDGNDFQREELLSYFKTILTKIDELKDPNKLTLGE
FT                   MPAYTEDYYNRMIHKAGIPKAGMEIEEVIQKLIKLVEGHRYVNRNYVANAAPLPNIASI
FT                   IGNLVMVLVNGNNLWDVEGSAAAAAEVEVTSMLSKLIGYDENVSSGYTTWGGQGAVFNS
FT                   LRLAIARYAPDSNETGVPENLYCFCSELSHYSLYKSLEATGIGVRNLVRVKVNDDHSMD
FT                   VQDLKEKMEHVIAKGGVPLYVLATMGTTDTFGIDDIREMKRIAVELEDKYHLQSIYIHA
FT                   DSAMGGMYAFFNDYDFEGNPLGLEDNVQEVLKSYQQKFIHIQLADSLVFDFHKLGQTPY
FT                   VTSLFLVKNREDLKYMDLDEVETPYVGNRGYGSYHTGYTLECSRMGSALAIYASLLAFG
FT                   KEGYQELLANYIRVNLAFREGLTKEVANVAITNEISPITTFRLYPEKTKWHEELSGLLP
FT                   VEEVMEINQFNEEFAEVIGAQRDQIYFGNTKKQRLVNVANATKRISVYAHKFFTISPYS
FT                   TLEEVHRYVEFLKEHQDLYLKTKSIAYNLN"
FT   CDS_pept        602403..604022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nikA"
FT                   /product="nickel transport system (nickel-binding protein)"
FT                   /note="BH0567"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04286"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04286"
FT                   /db_xref="GOA:Q9KFB8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR011980"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFB8"
FT                   /protein_id="BAB04286.1"
FT                   /translation="MCTLNRKLILLFVISLISSILVGCAESESGTVSNEGEENTEKSIT
FT                   FSWPRDIGPMNPHVYNPSQLFAQSMIYEPLVSYTEGGELQPHLADSWTISEDGKEYTFK
FT                   LREGVQFSDGTPFNAEIVKKNFDTWIEHSSLHSWLGVMNVLEKTEVVDEFTFKMVLKEP
FT                   YYPALQDLAVVRPVRFLGEAGFPDDGDTSQGIKEPIGTGPWMLSDYKQDEYAVFTRNPN
FT                   YWGESPKIDKVTVKIIPDAETRVLAFESGELDLIFGEGVISMDAFNQLKESGQYGTDLS
FT                   EPVGTRSLLLNTSNEKLADLRVRLALHHGFNKQAMVEGVTLGLEEKADNILSTNFPYTD
FT                   IDVEPIEYDVEQANAYLDEAGWELPAGKTVREKNGEQLELELIYDKTDPLQKAMAETMQ
FT                   AEWAAIGVKLDITGLELTTQIQRRRAGDFDVDFWYNYGAPYDPHSFINVVAEAGWGVAE
FT                   AHSNLSMKEELDEQVRATLASTDETERQELYGSILNTLQEQSVFVPISYIKKTVVYQEN
FT                   VNEFIFPANRDEHPFNGIDVSN"
FT   CDS_pept        604039..604983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nikB"
FT                   /product="nickel transport system (permease)"
FT                   /note="BH0568"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04287"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04287"
FT                   /db_xref="GOA:Q9KFB7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR014156"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFB7"
FT                   /protein_id="BAB04287.1"
FT                   /translation="MVSYIAKRIFAVIPIVLFAIFIMFVFIRLSPVDPAEAYLTAANIH
FT                   PTEELLAEKRHEFGLDQPMAVQYVQTIVKVFQLDFGHSYVTNQPVWDEVTARMPATLQL
FT                   AVSSIFLAVLISIPLGFLSAIYKNSLIDRFSRLLSYLGASIPQFWLGYLLIFFFSVKLN
FT                   LFPVEGRGSWAHLVLPTVTLSLALIAIYTRLLRASVLEQMQESYVLYARTRGIKEKVIM
FT                   VKHVLKLAISPVITGLGMNVGKLLTGTIIVEQVFSWPGFGRYFVDAIFNRDIPVIQCYV
FT                   LLAACLFIVCNLIVDLVQLAMDPRISSKGRAEY"
FT   CDS_pept        604980..605813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nikC"
FT                   /product="nickel transport system (permease)"
FT                   /note="BH0569"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04288"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04288"
FT                   /db_xref="GOA:Q9KFB6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR014157"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFB6"
FT                   /protein_id="BAB04288.1"
FT                   /translation="MISSMQIALKSQKTVVVCSVILFVFFLLAILAPWIAPHDPIQVNL
FT                   ALKLLPPSWEYPLGTDQLGRCNLSRLLFGARVSLGFATLIFISSLGIGLLVGAIAGYRG
FT                   GWIDSVLMRFCEGVMAFPNLVLVLGLVGLFGPGLWQVVLALVMVQWVYYARMFRSMIVS
FT                   LKEQNFITAARISGSSPWKIIRRHIIPNVLPPIVVIGTLEMGWAIMDISALSFLGLGIQ
FT                   PPTPEWGAMIHEGKSFIRSHPELMLYPGIMILLVVMTFNVLGESLSGRFGIKRRF"
FT   CDS_pept        605829..606659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0570"
FT                   /product="oligopeptide ABC transporter (ATP-binding
FT                   protein)"
FT                   /note="BH0570"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04289"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04289"
FT                   /db_xref="GOA:Q9KFB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014138"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFB5"
FT                   /protein_id="BAB04289.1"
FT                   /translation="MIKNDHHVLKVRNLNVKVKSDQGMLPLVQGLQFELKRGKVLGLVG
FT                   ESGSGKTMTCMSILQLLDRKTTCIEGSIQLQGRELNGLKAEDMRTIRGREIGYIMQNPM
FT                   NAFSPVFTIGNQFIETIRTHTELTKRQAFELAVASMETVHLPKPSELMRRYPFQLSGGM
FT                   LQRVMIAISMCLRPSVVIADEPTTALDVTNQLQVLKELDRLRLESDSAILLISHDLGVI
FT                   AELADEVAVMHKGRIVEKADVFQLFDHPQHEYTKKLLQARPTLPIHEQAREFAL"
FT   CDS_pept        606683..607498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0571"
FT                   /product="oligopeptide ABC transporter (ATP-binding
FT                   protein)"
FT                   /note="BH0571"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04290"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04290"
FT                   /db_xref="GOA:Q9KFB4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014137"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFB4"
FT                   /protein_id="BAB04290.1"
FT                   /translation="MSLLEVRDVTHTYRTSLLFWRAKQRAPVLTNVSLSIEEGMCMGLL
FT                   GTSGAGKSTLGKVILGLAKPQKGTVFFQGQDLYQMDPKSRRRVRRDLQVVFQDCYSSVN
FT                   PRMTAEQIIGEPLENYERLSASEQKRKIAHLLDMVGLRSDDMRKYPREFSGGQLQRINI
FT                   ARAIALKPKLIVLDESVSSLDMVNQTVILELLRELKAAFGLSYLFITHDIKAAYSISDE
FT                   LAVMEKGQLIEQCKDKAQLFSSKHPAVKNLLSSILSEHPRHRSISTGSV"
FT   CDS_pept        complement(607609..607728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0572"
FT                   /note="BH0572"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04291"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFB3"
FT                   /protein_id="BAB04291.1"
FT                   /translation="MIAWIDGILAGLLLIAYFLSKGYTAWKLLGRPSKTSGVG"
FT   CDS_pept        607889..608773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0573"
FT                   /note="BH0573"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04292"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04292"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFB2"
FT                   /protein_id="BAB04292.1"
FT                   /translation="MRPLRAIRKVNLEQLVENENIQNISVDYNGNLVILSVTKDGGDTL
FT                   HSIFHVTASGVRKIFVPPVKEAFLHVQPLREHWLLVNGRVMDNQTHNAFVYDDQQGLVT
FT                   SFHLGDGIEHVQTTDQGDIWVGYFDEGVFGDTIGTSGLLCFDQKGDIVFDFDALVKLNK
FT                   KIPLIDDCYALNVITNDIVYVYYFGDFPIVALRHKSEYELWKDQLLKRPPIEGSQAFSI
FT                   WEDHVLFSHGYKEKGTVHLYSFTQKSVKSYLPVNEEGEVIHYEFATGRQHLLYLVTENT
FT                   VYQIDLKLCLSSF"
FT   CDS_pept        complement(608830..610023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrA"
FT                   /product="chromate transporter"
FT                   /note="BH0574"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04293"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04293"
FT                   /db_xref="GOA:Q9KFB1"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFB1"
FT                   /protein_id="BAB04293.1"
FT                   /translation="MSVQKGNNIKTLLEILIVSTRLGLTSFGGPIAHLGYFHEEYVRRR
FT                   KWLDEKSYADLVALCQFLPGPASSQVGIGIGVMRAGVLGGVVSFLGFTLPSVIALIVFA
FT                   LLLLTFGFQDAGWIHSLKIVAVVVVAHAILGMAKNLTPDVKRKTIALFAVILTLLWQTA
FT                   FTQVGVILIAGFVGYLLFRNETIDEKLEHSSFPISHRFAAVCLTLFFGLLIALPLLREV
FT                   TNQSWIAMFDSFYRAGALVFGGGHVVLPLLEREFVPTGWLSEAEFLAGYGAAQAVPGPL
FT                   FTFAAYIGAVIDGWQGGLIATVAIFLPAFLLILGTLPFWNSLRRNPKVKGALMGVNAAV
FT                   VGILIAALYHPIWTSSILSATDFAFAALLFAMLVFWKLPPWVIVLTGAIGGYLLSLL"
FT   CDS_pept        complement(610042..610350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0575"
FT                   /note="BH0575"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04294"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04294"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFB0"
FT                   /protein_id="BAB04294.1"
FT                   /translation="MEDKILRKLFLGFIQIHILHHAKEHPIFGLWMLEELKEHGYDMSA
FT                   GTLYPILHSMEADGLLVKQEQKVEGKIRKYYTTTAKGESVLKEARSKAYELFKEIKE"
FT   CDS_pept        610548..610724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0576"
FT                   /note="BH0576"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04295"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04295"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFA9"
FT                   /protein_id="BAB04295.1"
FT                   /translation="MNLLSDVVLRLALSIPVEPINVEMVKRGIKKFGFVVSFAYQAVTA
FT                   GLELVISPDRNGH"
FT   CDS_pept        complement(610774..611328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0577"
FT                   /note="BH0577"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04296"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04296"
FT                   /db_xref="GOA:Q9KFA8"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="PDB:2HTI"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFA8"
FT                   /protein_id="BAB04296.1"
FT                   /translation="MNAIRYTKRECKDEKKITEFLNKARTGFLGLSTNDQPYVIPLNFV
FT                   WHNHAIYFHGASEGRKIKMIEANPEVCFTICEDLGTIVSPVPAHTDTAYMSVIIFGTIE
FT                   PVSAIEEGTEAMQQMLDKYVPGYYHSPLAASHVEKYRSSLGSRTAIYKISCRERTAKVN
FT                   EPIESLKFYPGRNVSVDKDSR"
FT   CDS_pept        611438..612847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0578"
FT                   /product="transcriptional regulator (GntR family)"
FT                   /note="BH0578"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04297"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04297"
FT                   /db_xref="GOA:Q9KFA7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFA7"
FT                   /protein_id="BAB04297.1"
FT                   /translation="MIQITPFLDSKRKTPLYVQLYQYIKEGIESGQLKSDTFLPSIREL
FT                   ALHLRVSKNTVEGAYQQLIAEGYVESIPRVGLKILELEATFLCDKGGKQLQNVTMGEIQ
FT                   REHKSIEFDFVYGEIDTAHLPLKVWKRHVQEVLKGASEELLMYGDPFGDWHLRQELSHY
FT                   LLQSRGVSCRPEQVVITAGTQHAVSLLCQLLSLHGSTVAFEDPGYNGVRSVFINQGCRI
FT                   APIPIEADGLSLSRLHESHANIVYVTPSHQLPCGMILPVHKRSLLLEWAYEHEGYIVED
FT                   DYDSEFRYQGQPIPALKALDQNEKVIYLGTFSKSFLPSIRVSYMVLPGELVPLYQQKLA
FT                   NYNQAASQLIQRALYTFIKDGDFQRHIRRMKKVYQSKHHTLLKSVKTYLGDRVTVIGEK
FT                   SGLHVLLNVPGREDHELIEKAMACGVKVYSTKTFWYNPKNQCSSFIMLGFGKLSEEAIK
FT                   KGIRRLQQAWF"
FT   CDS_pept        613097..614458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0579"
FT                   /product="cytochrome P450 hydroxylase"
FT                   /note="BH0579"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04298"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04298"
FT                   /db_xref="GOA:Q9KFA6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFA6"
FT                   /protein_id="BAB04298.1"
FT                   /translation="MPTNTMPTGPKGNPVLGNTIEFGKDPLQFITRCSQEYGEIVRLRF
FT                   ERERDTFLLNDPKHIQYVFMNKGGEFSKGYQQDPIMGLVFGNGLLTSEGSFWLRQRRLS
FT                   QPAFHPKRIADYADTMVGYCERMLNTWMDNDTRDINDEMMQLTMAIATKTLFDLDLHKG
FT                   DTQEASRSLDTVMTAFNEQMTNVFRHVLHLIGLGKLVPPVSRELREAVESLDKMIYSII
FT                   EERRKHPGDRGDLLSMLISTYDEDDGSYMTDRQLRDEIITLFLAGHETTANTLSWAFYL
FT                   LSQHPHVEEKLYQEVSQVLGNRPATLEDMPKLSYAEHVIKETLRVQPTVWLISRRAEKD
FT                   VTLGDYHISAGSEIMISQWGMHRNPRYFNDPLTFLPERWDNNDNKPSKYVYFPFGGGPR
FT                   VCIGERFALMEATLIMATIVREFRMELVDELPIKMEPSITLRPKHGVTMKLRKR"
FT   CDS_pept        614532..615113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0580"
FT                   /product="transcriptional regulator (TetR/AcrR family)"
FT                   /note="BH0580"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04299"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04299"
FT                   /db_xref="GOA:Q9KFA5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041603"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFA5"
FT                   /protein_id="BAB04299.1"
FT                   /translation="MKQQKLDRRVEILTVAREVLAEKGLEATKVSEIVKRAGIAQGTFY
FT                   LYFESKNALIQALAEEMMGKVFAAVSQSLLESKTFEQGVKHGLRAAFCSMSEYLDIYNI
FT                   LINGCAVVVADQKDLRTLFDPYYELLETYIEKWQADGAVDAKLDPKITSRLIVSLTDQA
FT                   VDDYYIQESATTVETYIENLTRFVVKALKA"
FT   CDS_pept        complement(615114..615719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0581"
FT                   /product="two-component response regulator"
FT                   /note="BH0581"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04300"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04300"
FT                   /db_xref="GOA:Q9KFA4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFA4"
FT                   /protein_id="BAB04300.1"
FT                   /translation="MIRIVIAEDQTMLLGAMTALLQLEDDIKIVAQARNGLEALAAIEK
FT                   HQPDLCILDIELPNMTGLEVAKRIREQEWDCKMMIVTTFARASYLQQAMDLKVEGYLLK
FT                   DEPIEFLVEAIHKVMNGERVLSPDLAMHLFLKEENPLTEREQEVLRLTKGGKTTEQIAT
FT                   VLYLTNGTVRNYISTAIQKLEVENRHQAIQKAEEKGWI"
FT   CDS_pept        complement(615716..616840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0582"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="BH0582"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04301"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04301"
FT                   /db_xref="GOA:Q9KFA3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFA3"
FT                   /protein_id="BAB04301.1"
FT                   /translation="MFRKIYPEDQINNYLIIDVIVIVSLFYNVLSVDSPVPIGVSLSLL
FT                   AAFLFTYYMMLWYKDIRLLFAALTACFIFALFAIFYKPWLLLYGFIVSDFLGRAHAKRL
FT                   MWIGVVGLFAMHISTAYALYGHWFTFYSPVQLPILILQLVLPFMIRIREKSKLLKEELD
FT                   TANQKLERYIQEEERHRIARDLHDTLGQSLTMITMKSQLATRLVEKDADQAKKEMTEVM
FT                   NTSRRVLKQVRELVTTMKFVSLEEEVSHAKEILSLQNITLEVIQEGATPQLLKVAESML
FT                   ALSLREAVTNIIKHSRATHCTIVKEYANNEYKLQVIDNGIGKIDQMQTGNGITSIRERI
FT                   HLLQGNVCLTSLPNGGMSITMTIPIHNAKRGATL"
FT   CDS_pept        complement(616818..617993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0583"
FT                   /note="BH0583"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04302"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04302"
FT                   /db_xref="GOA:Q9KFA2"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFA2"
FT                   /protein_id="BAB04302.1"
FT                   /translation="MLNGQSRIRLLDILRGFAILGTLGTNIWLFAYLGDLSYVLTYDHS
FT                   RWWASSDDFIRLLVLFLVNGKFLGLLTTMFGVGLELKYRQALRHGSPWPGMYIWISLIL
FT                   LLEGLLHFTLVMEYDILMSYAFTAIIVSFIVKRGDQAIKRALKWVGGFHLLLVSLILLV
FT                   SVLIYLSGGTLALGSMGHTIALYQHGSWLEQLLYRINHFWILRSEAIFVLPMNVFLFLS
FT                   GVLFMRAGAFSPDQHGKRIRRKLLAVGMYVGIPLNLLIFVPGGIFDLSVRYLFAPILSL
FT                   GYMALIAFIFEKSKHLWIWGRLEDIGRMALSCYVLQNILASIIFYGWGFGLGGSVNSLT
FT                   VVTIWLLISVLLASFATVWHHFFSLGPMETARKYLAGLPRRSIKHVSKDLS"
FT   CDS_pept        618209..618313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0584"
FT                   /note="BH0584"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04303"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04303"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFA1"
FT                   /protein_id="BAB04303.1"
FT                   /translation="MKKRSLVFLAKGVGHSTAVFFRTANHGRSMSNSG"
FT   CDS_pept        618452..619000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0585"
FT                   /product="ribosomal-protein (S5)-alanine
FT                   N-acetyltransferase"
FT                   /note="BH0585"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04304"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04304"
FT                   /db_xref="GOA:Q9KFA0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KFA0"
FT                   /protein_id="BAB04304.1"
FT                   /translation="MKREGENIVVKLASVEDVEQLLALEVRNKEFFQQFTGLRDSAFYT
FT                   YEGQKERIIREMEAAKADTGYLFLICLKESDEVIGEVSLTEVVRGNLQSCWIGYFLDKV
FT                   HNGKGYMTEAVKLVVDYAFTELAFHRIEAGVMPHNIGSINVLLKAGFQKEGLARKNVKI
FT                   NGRWEDHQTLAILEGETVS"
FT   CDS_pept        619132..620052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0586"
FT                   /note="BH0586"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04305"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04305"
FT                   /db_xref="InterPro:IPR032791"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041444"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF99"
FT                   /protein_id="BAB04305.1"
FT                   /translation="MLEHFYSKSGITLQRVAEELLICDLGERIPKISDLAEKFQVGRGT
FT                   IQTSLKKLEEADCIKLESRGHLGTFLREKDTVKLLQYSGLERIIGVMPLPYSKKYEGLA
FT                   TGMTAQFEQLSIPLNMAFMQGAHPRLEGVKEGRYDFAIVSKFSALHELNNNEGVMLSLS
FT                   FGPQTYLSSHAVIFSDEKAKQIEDGMKIGVDKNSLDQQILTNAEAEGKKVEFVQLNYMH
FT                   LLDHLKANTIDATVWNIDEIGVTPFNVQPLTSETALSYETEMTEAVVVIREDNKKLDYI
FT                   LNLLSLPTISEVQAKVENGDLIPKY"
FT   CDS_pept        620108..620455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0587"
FT                   /note="BH0587"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04306"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04306"
FT                   /db_xref="GOA:Q9KF98"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF98"
FT                   /protein_id="BAB04306.1"
FT                   /translation="MQSLKARLDVLRDTNTITERASLIAERTVEQFVTDENADSYTMLI
FT                   THLAMAVTRIDRLEPLSPPPESIMKEIYESRDLEEAKRRVAWIEETMGDTLPQEEKEFL
FT                   IMHFVSALSMN"
FT   CDS_pept        620477..620836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0588"
FT                   /note="BH0588"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04307"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04307"
FT                   /db_xref="InterPro:IPR021238"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF97"
FT                   /protein_id="BAB04307.1"
FT                   /translation="MKIVIGGQVDKKEIESLIQEKAGERVETIVKSDLDAAMAIKSNEA
FT                   DYYFGACHTGGGGALAMAIAILGKNRCATISMPGKPPVKEEVDNAVQQGAKAFGFTGDH
FT                   KERAVEYLIESLLKP"
FT   CDS_pept        620868..622157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0589"
FT                   /note="BH0589"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04308"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04308"
FT                   /db_xref="GOA:Q9KF96"
FT                   /db_xref="InterPro:IPR019733"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF96"
FT                   /protein_id="BAB04308.1"
FT                   /translation="MLEIMLMVCIGALAAVMANLGIAVFNDGIRPIVPENLEGRMTRKE
FT                   LGVTAFAMSFGLVIGFGIPISIAGSIILIHSILLGSDIIGLALDRGKVKTTIAAIIGGL
FT                   YGAGIYMGLQVVVDLFTMLPLNFVDAFNKVGDPVVVSFMVFPAIAIALQFGVKKGIIAF
FT                   AIAAFARQLIVFTNGAELIKIGSTPVVLSPEGIALVVGMFLLIFFAMREKSEETNLSTL
FT                   ATLFTDRVARIKKHRWILMLSGGLVAAATNLLLIAGDPISLNLLAEGKMSEGGIAALAK
FT                   AIGFVPLIASTAIATGVYGPIGFTFVFAAGIFAPNLGIALLIGALIIFLEIQLLTKLAT
FT                   FLDRYPGIRASGENIRTAMSRVLEVALLIGGANAADAIVPGFGFFAIAGFYLINEIAGR
FT                   PIVRMAIGPVGAIIVGIVGNLLVLLGLYTP"
FT   CDS_pept        622184..624223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0590"
FT                   /note="BH0590"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04309"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04309"
FT                   /db_xref="GOA:Q9KF95"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF95"
FT                   /protein_id="BAB04309.1"
FT                   /translation="MYIETVRGKIKPEEFGVCACHEHLHIDLSRIKNDSDTALVEVALV
FT                   LSDLKSFVSHGGQAIVDVTNDGMGRDVEKLVVMSEALDLHIVASTGCYKDPFIPEEKQM
FT                   WTREQFAEWMIDEIMYGISGTTVKPGVIGEIGSSLNEFKPVELELFYGAIEAAKTTKLP
FT                   LSTHTTLGTLAMEQIRLFDSESLPLDQVIIGHQDLNDDDEQVLKVLSTGAYVALDTIGK
FT                   ENYRSDEARLNSLLLFLEKGYEDQLLLSSDVTRTSHLLVHGGQGYDVVLRSFIPKLRAK
FT                   GADEATIQKLLVKTHKKHLASRKKAKRMTNEQSSILKNMTVEEATQLQHRLVDEISKEF
FT                   SNNEFFQVGDVGLHPGYKRPKMTAKVEHVLQQTFDAEACALVRGSGTGAIRLVLSVLLE
FT                   PGDACIVHTGPMYPTTKETFRMMGIQPVAVNFNKPQSILEALKHHEEAKVFFVQHARQQ
FT                   PTDTYDLREVIHYVKQHRPDLPIVVDDNYCAMKMKGIGVQYGADYSTFSGFKLLGPTGI
FT                   GIILGKKSGVEQIHVRNYSGGGQVQGFEAHELVRSLVMAPVMLALQNQQVEELYTRLNQ
FT                   GEVKGLKQIYVTNSQSKNVIVELEKPIAEAVIRSAATYGAATYPVGAESRFELLPMIYR
FT                   VSGTFLEKRPELKAYGLRINPMKASASTVIRILTCSLADAARDC"
FT   CDS_pept        624226..625386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0591"
FT                   /note="BH0591"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04310"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04310"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF94"
FT                   /protein_id="BAB04310.1"
FT                   /translation="MFLPMTLKRNEGLIRAAVKLHQEGNIPANTYVVDLDSFESNVKVI
FT                   QQTAKRYDVSLYYMTKQLGRSGFIGQIIEQQGIEKAVAVDIDEAIQLKERSCQIGNIGH
FT                   IVQPSRSQWKFVLTKLNPEVVTIFSYERAKQLSEAAVNVGKVQDVILRIVYSHDAVFPG
FT                   QYGGFLIEELEGQLQKLQRLKGISVVGITSFPIFELNPDNNDYQFTPNMTSLLQGKKLL
FT                   EASGIQVKQVNAPSATSCRTIPMLSEIGVTHGEPGHALTGTTPLHAYQEDLPEVPCMVY
FT                   VSEISHMDDTHAYTIAGGFYSRSGMEGALFGAHADAAVAQRAKVDLVSPTNIDYYGALD
FT                   RCKEMNVGDSVIYAFRTQIFVTRAHVAFVRNIKQKPEVVYFQKRGM"
FT   CDS_pept        625389..626582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0592"
FT                   /note="BH0592"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04311"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04311"
FT                   /db_xref="GOA:Q9KF93"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF93"
FT                   /protein_id="BAB04311.1"
FT                   /translation="MKKVTLLVLDGFGVGAMADCEKVKPEDVNANTYKHLREAVDIHIP
FT                   TLYQLGLGNIVDHLDTARAAYGRCDLAHHGADTFMGHQELMGSKPGVPQKRLMSEVGAT
FT                   IKKNLEKHGYDVRDPVEGAPVLLVNEAVVVGDNLESEVGNIINVVGDFRKLSFEQTIEV
FT                   GKVVRSSVDTSRVIVYGNKEKTSIDLILSTIKERHPGQWGVDSPKANVYGEGYQVLHLG
FT                   YGVDYEKQFAHLAEKQRLPVYRIGKTADVIQASGYHNPVVSTRKVLEVYQHEYSKSERD
FT                   SVFLVNVQETDLAGHKEDCLWYKEVIEEVDRFLASFIDELDEEDLLIITADHGNDPTIG
FT                   HSNHTREQTPVIIVGPQVRPISIGTRQTMADLAATMADYMGVAPPQYGTSFLHQILR"
FT   CDS_pept        complement(626735..627370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0593"
FT                   /note="BH0593"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04312"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04312"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF92"
FT                   /protein_id="BAB04312.1"
FT                   /translation="MTTIGCYHAHYSNCQLIDHVLSHDQIELRHFVDPGLAMIANDLPE
FT                   HMIREKVEQQLEWIRASKVDHILVTCTFFSSFINQTDMDTPIMTMDDVLYHVVRSSEIP
FT                   IILVFTNPETVAPTMNKLSFQLNKDQHVATPKQHVIPNTFDLLLHGHVTDYHEIVFQEL
FT                   SRLASNHPGKQIVAAQLSMTEAANRAKAQFPNIQNLTDELGRMMIPSL"
FT   CDS_pept        627526..628371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0594"
FT                   /product="transcriptional regulator (AraC/XylS family)"
FT                   /note="BH0594"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04313"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04313"
FT                   /db_xref="GOA:Q9KF91"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF91"
FT                   /protein_id="BAB04313.1"
FT                   /translation="MDWLKRMNGAMAYIEEHLTGDIDYREVARIACCSEYHFKRMFSFI
FT                   AGVTLSEYIRRRRLTLAAFELKNSQMKVIDVAVKYGYHSPDAFTRAFQSVHGITPTEAR
FT                   NNGHSLKAYPAMTFHISIKGGTEMNYRMEQKEAFRVVGMKKRVKLVHRGTNTDITDMLG
FT                   TISDETYMQIENLSTLEPGGILNVCTNFSEGLEDEGELDYYIAAATIKKCPEHLVELEI
FT                   PTFTWAVFTVEGSWEDVQEMWGRIYSDWFPTSDYEHAEGPEILSSANEKSEIWIPVVKK
FT                   "
FT   CDS_pept        628697..630607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglP"
FT                   /product="PTS system, beta-glucoside-specific enzyme II,
FT                   ABC component"
FT                   /note="BH0595"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04314"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04314"
FT                   /db_xref="GOA:Q9KF90"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KF90"
FT                   /protein_id="BAB04314.1"
FT                   /translation="MKYEQLAKDIIQHVGGKENVISVVHCITRLRFKLKDEGKANTDVL
FT                   KNMDGIVTVMKSGGQYQVVIGNHVPDVYKDVVEIGGFQNQAETETEDEKKYQGLFNKFI
FT                   DIIASIFTPVLGVLAATGMIKGLNALFLSTGVLEEANGTYQLLHAIGDSLFYFFPIFLG
FT                   YTAAKKFGATPFIGMAIGASLVYPTLVVLTEGEPLYTLFTGTIFESPVHITFLGIPVIL
FT                   MSYATSVIPIILAAYFASKVEARLRKIIPDVVKTFLVPFFTLLIVVPLTFIVIGPIATW
FT                   AGQLLGQFTLWVYNLSPIIAGAFLGGFWQVFVIFGLHWGLIPIAINNLVVQGSDPVLAM
FT                   VFAASFAQIGAVAAVWLKIKQQKVKTLSVPAFISGIFGVTEPAIYGVTLPLKRPFIISC
FT                   IAAAVGGAIIGLFRSQGYIIGGLGIFGIPSFLHPADGMDAGFWGIVIAVVVAFVLGFIL
FT                   TYLFGLKSGNASDEQTETKAHTSTGTGEKEEISSPFNGSVITLSEIKDEAFSSGALGEG
FT                   IAIEPSEGKLFSPVSGMVTALYPTHHALGITTDRGAELLIHIGLDTVQLDGKFFTAHTI
FT                   QGAQVEKGDLLIEFDIKEIKAAGYAVTTPVIVTNHKQYGQLFLTDKQQVNAGDRLLELT
FT                   R"
FT   CDS_pept        630702..632135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gblH"
FT                   /product="beta-glucosidase"
FT                   /note="BH0596"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04315"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04315"
FT                   /db_xref="GOA:Q9KF89"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF89"
FT                   /protein_id="BAB04315.1"
FT                   /translation="MSKHSFPEGFLWGGAIAANQAEGAYLEDGKGLTLVDLLPTGQKRW
FT                   DVMLGKLDSFTPLEGEFYPSHEAIDFYHRYQEDVALLAEMGFKAFRLSISWARIFPNGD
FT                   DPEPNEKGLQFYDDLFDELLKYNIQPVVTMAHFDVPVHLIESYGGWRSRKLVGLFETYA
FT                   KTILSRYKDKVKYWMTFNEINMLLHLPFVGAGLVFKEGENKKQIQYQAAHHQLVASSLA
FT                   VKACHELIPDAKIGCMLAAGATYPYTCHPNDVFEAMTKDRESFFFIDVQSRGEYPGYAK
FT                   RFFRDHNIVIDMEEGDEALLKNHTVDYIGFSYYASRVTSTDPEVLKNITSGNVFGSVEN
FT                   PYLEKSEWGWTIDPKGFRTTANQLYDRYQKPLFVVENGLGAVDDVTLEGEINDEYRIDY
FT                   LRKHIAEMAEAIADGVDIIGYTSWGPIDVVSASTGEMKKRYGYIYVDRDNEGKGSLKRM
FT                   KKKSFHWYKKVIETNGEKR"
FT   CDS_pept        632507..633163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0597"
FT                   /note="BH0597"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04316"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04316"
FT                   /db_xref="GOA:Q9KF88"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF88"
FT                   /protein_id="BAB04316.1"
FT                   /translation="MKTQFAVIGLGRFGGSVCRELYQLGHEVLAIDTNESKVNEFTTHA
FT                   THTVIANATDEKALTSLGIRNFDHVVVAIGDNIQSSVLCTLLLKELGVPNVWVKAQNDY
FT                   HHRVLEKIGADRIVHPEQDMGVRIAQHLSSEKIIDYIELSDEYSIVELVATSKVADQTL
FT                   ADLDIRATYGATVLAIKSGEHMNVSPLPTDIIRLNDILIVIGHNNDLNRFEREGL"
FT   CDS_pept        633166..634512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0598"
FT                   /product="Na+-transporting ATP synthase"
FT                   /note="BH0598"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04317"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04317"
FT                   /db_xref="GOA:Q9KF87"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF87"
FT                   /protein_id="BAB04317.1"
FT                   /translation="MARLLSKSALKGKVIHLSPPQILALSFLVFIMIGTLLLKLPIAST
FT                   TYISWVDAMFTATSAITVTGLVVVDTGTDYTVFGQVVIMILIQLGGLGLMTFAVLAVMM
FT                   LGKKIGLQQRILIQEAMNQTSLGGLIRLVRVLLLFTLVMETIAFILLSIRWVPEFGWRE
FT                   GMYQSLFHTISAFNNAGFSLWSDSLSAYVGDPAINLIITILFITGGIGFTVLADLWYKK
FT                   TFRALSLHSKIMLLGTLALNCIAFIAIFILEYANPHTLGGLAQSDRFWGAYFQAVTPRT
FT                   AGFNTLEIADMTTASIVLILLLMFIGAGSASTASGIKVTTFFVMILATWSFLKGRAETV
FT                   VFERTIKLHTILRALAIIVISMMIVFIAVFILAITEDAPFIVKVFEVFSAFGTVGLSMG
FT                   LTGELTTLGKMTIMVVMFIGRVGPLTMAFTLARPKQSNIRYPEDEVFTG"
FT   CDS_pept        635205..635888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0599"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="BH0599"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04318"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04318"
FT                   /db_xref="GOA:Q9KF86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF86"
FT                   /protein_id="BAB04318.1"
FT                   /translation="MIQLKNVSVTYQALHETLTILQDITLTVASGEWLSIVGPSGSGKT
FT                   TLLKLIAGALQPVSGTVTINERSITDLAHTDRQAFIRTQVASVYQQFRLLPQFNVLENV
FT                   MLPLVPYESRKTIRPRATELIDQVGLSHRMTHYPHQLSGGEQQRVSFARALLTEPAILL
FT                   CDEPTGNLDQANRDNILDLLSQLHAQGQTIVLATHDDVVARRGDRTISIDNGTIHKGEL
FT                   GHASL"
FT   CDS_pept        635875..638346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0600"
FT                   /note="BH0600"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04319"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04319"
FT                   /db_xref="GOA:Q9KF85"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF85"
FT                   /protein_id="BAB04319.1"
FT                   /translation="MLRYSFRSIKRNFASSLLLVGALVAIFVASPLSFSMLSSIQAEVD
FT                   ANIKQYARGSYDLLIRPIGTQTAVETTLGVVEENYLALGEGGISLNEWETIKALDGVEV
FT                   AAPVASLGYFAGETHTVAVEFPNNSSFIEGRFQTSDGLHTYPLQAGGSYYVLEQEGYYY
FT                   GYEYVQQGNEEIPGSGGPPFFSMPVTYHLIVGIDQQEEEKLTGFNFSALNNSIPEGFRF
FT                   YFDLDVERHIKIIYLKDATTPLTVQVDVAPIDWETADTERLKDELGLTYDEPLFISEQF
FT                   PSLFTQFQDRHIGPIETYTFDLSEHMPPFSYDPVSLDYDGSMHEPIENAYGVSESSRFY
FT                   QASPIDYDIQAGGRLKVKQVGDYEGIPIYRTIQEQGGAAYELHGIGKIPFLLYPVGHFT
FT                   TAEYEHSLSASPLGIYQQAPSVLSDGTMLHETIAPGSFVNAPAHGLMALEDAAFIKGDA
FT                   PIDAIRIRVAGITAYDQEAVDKMSQVATEIAKLGDYQIDVIAGASPAPMTMDVEGIGEV
FT                   VQPWTSLGAAATIRDGWNGTNVLIAGLFLFVSISYLANRFHFRRHTKKEEQELLLDLGW
FT                   KKRHIRWLYLMENSSLIFLSAAIASLILLAYIWLYQADWFILIFFVAVVVLTFLFSLIY
FT                   VSMMRGVQKISFRRLKGQTVWIRNLFYYRRLLTLSIIQLASVALLLAFVVSSIAATIAQ
FT                   TGGTYLGVYINDAVFIPLVSIMVAALFLAVLTVGESTSAFLLLRKEELQTLRDIGWRIK
FT                   DVHRLCLKESAVWTTGAIMGGVVISLLTVSVFYSLSLSFLLFAGVAVVLLSSIAIVTAG
FT                   GMIRSSLRKMA"
FT   CDS_pept        638595..639635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0601"
FT                   /note="BH0601"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04320"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04320"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF84"
FT                   /protein_id="BAB04320.1"
FT                   /translation="MKKLSKRSLLSAIVGVSLLVTAACGGGSDSTGADEAGEVEEKERP
FT                   SSVVIGTASQGGVYYIYGGGLAQLLDRELGVSSNVEVTGGPVHNMQLVNEQEQDIGMIT
FT                   MGPGYEGVLGEGEWTGGETYDNVRVIFPMYTTPFHWWSLESSGVTSIEDMDGMRVGVGP
FT                   SGGTSGTYLPIIHEVLGLDITPVLAGANDMVSQQLDGQLDVIGFAAGLPIPAVAEVEAQ
FT                   RDIHLFGIDGENRDKVLEALPYFEPYTIPADTYDQLDEDLETIAMFNFGITYSEMNADF
FT                   VYELVKAYHENNDLLMTTHSSAEEAVPEAILRNEVVPLHVGAIRYYEEIGIDLPESVYP
FT                   AEWENE"
FT   CDS_pept        639749..641707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0602"
FT                   /note="BH0602"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04321"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04321"
FT                   /db_xref="GOA:Q9KF83"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF83"
FT                   /protein_id="BAB04321.1"
FT                   /translation="MADEQKVNSVVSEDKAKELEEAVEGPSNARSLTGWVGILFTVIAV
FT                   GGALFHLYILNFHPIEPWIFRSVHIALGAVLGFLLFRGWKTDSNRVHVVDWLLIAATLF
FT                   VTFYIYQNVSALLFRVGVMPQPMDTIVAVLGLLIILELTRRTSGWTLPILSGVFIAYAF
FT                   LGPWLPGFLNHGGYSFDRFVTYIYSLDGVFGVTVDVSSKYILLFIVFGAFLQMSGVGRF
FT                   FIDFSFSLAGGMRGGPAKVSVISSGLMGMMNGTSAGNAVATGSLTIPLMRRVGYKGQFA
FT                   AATEATASAGGQIMIPIMGAGAFIMAEITGIRYSEIIIAAAIPAFLYFLSVYFMVDFQA
FT                   IKNGMKGLSRKELPPLKGILKQSYLFIPVVLLIASLLMGYSIIRSGTVSILACLIVSWI
FT                   HPTTRMGLKKVLGALELGMKNVIQLLAVCACAGIIVGVIALTGVGLRFSSMLLGIADAN
FT                   KLLALLFAMGISIILGMGMPTTAAYAVAAAVVAPGLIQIGIEPLHAHMFVFYYAVMSAI
FT                   TPPVALAAYAAAGVAGTDPFKTGVDAFKLGLAAFIVPFMFIYSPAIMMEGEIMSIALAT
FT                   ITASVGVYLLAAAVQGWFAGKAALTVVRLLLIVAAVCLIHSSWVYDFVALGIVAIAFIL
FT                   QRTVNKQTPLDPKASTA"
FT   CDS_pept        642042..643766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0603"
FT                   /product="endo-beta-1,4-glucanase (celulase B)"
FT                   /note="BH0603"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04322"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04322"
FT                   /db_xref="GOA:Q9KF82"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR005102"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016282"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR040946"
FT                   /db_xref="PDB:4UZ8"
FT                   /db_xref="PDB:4UZN"
FT                   /db_xref="PDB:4V2X"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF82"
FT                   /protein_id="BAB04322.1"
FT                   /translation="MKWMKSMAWLAVVLVVSFVAPAVSSAHEDVKTLDIQSYVRDMQPG
FT                   WNLGNTFDAVGQDETAWGNPRVTRELIEQIADEGYKSIRIPVTWENRIGGAPDYPIDPQ
FT                   FLNRVDQVVQWALEEDLYVMINLHHDSWLWIYEMEHNYNGVMVKYRSLWEQLSNHFKDY
FT                   PTKLMFESVNEPKFSQNWGEIRENHHALLDDLNTVFFEIVRQSGGQNDIRPLVLPTMET
FT                   ATSQPLLNNLYQTIDKLDDPNLIATVHYYGFWPFSVNIAGYTRFEENSKQEIIEAFDRV
FT                   HHTFVARGIPVVLGEFGLLGFDKHTGVIQQGEKLKFFEFLIHHLNERDITHMLWDNGQH
FT                   FNRHTYEWYDQELFDMMRASWEGRSSVAESNFIYLKQGDRIADATVSLQLHGNELTGLR
FT                   ANGQRLTPGQDYELNGERLTVKAHVLSAIASSGTLGTNGMVTAEFNRGADWHFRVNTYR
FT                   TPVLQSTQGHVSNFSIPASFNGNSLATMEAVYVDGGNAGPQDWTSFKEFGYAFSPSYDA
FT                   NEMKLTEAFFREVRDGEVRLTFHFWSGETVNYTIIKNGNQVTGIAAQTTNSKNKNKK"
FT   CDS_pept        644079..645035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0604"
FT                   /product="methanol dehydrogenase regulatory protein"
FT                   /note="BH0604"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04323"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04323"
FT                   /db_xref="GOA:Q9KF81"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF81"
FT                   /protein_id="BAB04323.1"
FT                   /translation="MNETMQRIARVIENVERVVVGKRQEIELSLVALFASGHVLLEDVP
FT                   GVGKTMLVKAIARSLGADFKRIQFTPDLLPSDVTGVSIYNQKTQQFEFRPGPIMANVVL
FT                   ADEINRTSPKTQSALLEALEEGSVTIEGKSLVLSKPFFVMATQNPVEYAGTYPLPEAQL
FT                   DRFLFRLQLGYPKPDEELDVLKRLEKKHPIQELSPVMETEEVIQLQEEIKDVFVEDNVK
FT                   AYIVEIVNLTRKHQKVELGVSPRGSIAMMKAAQAYAMIQGRDYVIPDDIKTLAPFALSH
FT                   RLILTAEAKMSGTDHEEIIHDVLQQAKVPVIRKELLT"
FT   CDS_pept        645036..646193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0605"
FT                   /note="BH0605"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04324"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04324"
FT                   /db_xref="GOA:Q9KF80"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF80"
FT                   /protein_id="BAB04324.1"
FT                   /translation="MKKSKLFGVLHHTFKVLLLVGLLVASFTYAMFQGGFVSWFLFYSV
FT                   VTVTVLTLIVFLFSFQGFDVERSLSQKTAQAGGELTVTIYLRRRSWRPFFYIRVKDLVP
FT                   LSIGRTEGAGALFFFGLQREWSYQYVISNIRRGEHRFENVHLVFGDLFGLIEKETTVPV
FT                   ESSVLIYPNVHHVKELPPIQNRTFSQGKRANRQQEEERSLAGVRDYVPGDRLSTIDWKQ
FT                   SARALKFVTKEFESYDGEGIVVAFDAYLETLSPTSFETAVELAASLMYKVLQQRPSLEV
FT                   AVRRIGWQTMTIDTHMLTLPLTLLAKLQPTEEGPKAKDPVYLSWRGATVFYVCTELSEA
FT                   IVEAARTLQMQHVNVQICLVGKHRKNQEFAEQLKQHRIQIHTFEP"
FT   CDS_pept        646214..648403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0606"
FT                   /note="BH0606"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04325"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04325"
FT                   /db_xref="GOA:Q9KF79"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF79"
FT                   /protein_id="BAB04325.1"
FT                   /translation="MVEKKTMNLGRDFFLYGLGFLLLMEWLLPLPSITDTGYIHVFVIF
FT                   TSLFFLITFLQLPLAVSMVVKLGLSIYGIYLIFYESPFFALDWLLLFVAEMGVNLGFIV
FT                   GGNFYALTDMFRSFLFFVLLSIMSYLLFYWIVYMRRALFFLVLTIIYITVLDTFTAYDA
FT                   SMAIVRTFVVGFVLLGLVTIYRKMEREGVRVGSRYLPLRLGLMLVAVIGISSILGFAFP
FT                   KLDPQWDDPMPFMRAAVGLDPYSDSVEVVQRIGYGDSDGQLGGGFIDDETTVFYVTAPE
FT                   AQYWRGETKDFYTGRGWETTTPEQVQPQAPLRTATENLVSVEQRRAEVQFEDGQARYEH
FT                   LFYPGQLDSSETAGIVVDAYTEKATTYSGSSPTVLTKYEIDYYYPTYYIDQLQQSSEVD
FT                   PQNIQDYYLQLPDSVPQRVYELAEGIVSEYENRYDQAKAIENYFQRSGFRYETTDVPIP
FT                   EDGQDYVDQFLFETQAGYCDNFSTSMVVLLRSVGIPARWAKGFTAGTLVDSTNEQNVYE
FT                   IRNSNAHSWVEVYFPEVGWVPFEPTRGFTNEFDFTESPVDNQQNTEIEQTDREEPLETV
FT                   ENEEQEVEDAFAELEEASTEEVAISPENGAGGLPFPLWWLALPLLILCMALFAGNKKLV
FT                   GLALIGYFRVTRKEDAFVHAYKRLLWYLNYIGLGKKQGETLREYAVRIDQEWSTETMTT
FT                   LTFEYERLLYSSDVPANCWEHVKGDWLQLMRKISS"
FT   CDS_pept        648683..650224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /product="GMP synthetase"
FT                   /note="BH0607"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04326"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04326"
FT                   /db_xref="GOA:Q9KF78"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KF78"
FT                   /protein_id="BAB04326.1"
FT                   /translation="MEQLSEEMIVVLDFGGQYNQLITRRIRDLGVYSELHPNTITAEQL
FT                   KEMKPKGIIFSGGPNSAYAEGAPKCDPAIFDLGVPILGICYGMQLMTQHFGGKVDAAEH
FT                   REYGKATITVENQSKLFQGLPVEQTVWMSHGDLIVAPPEGFVVDAQNPSCPVAAMSDEA
FT                   RNYYGVQFQPEVRHSQFGDDMLKNFAFAVCGCEGNWSMENFIELEMEKIREQVGDKQVL
FT                   CALSGGVDSSVVAVLIHKAIGDQLTCMFIDHGLLRKGEADSVMKTFSEGFNMNVIKIDA
FT                   KDRFLSKLEGVSDPEQKRKIIGNEFIYVFEEEASKLKDMDFLAQGTLYTDIIESGTATA
FT                   QTIKSHHNVGGLPEDMRFELIEPLNTLFKDEVRKLGTELGIPDEVVWRQPFPGPGLGIR
FT                   VLGEITEEKLEIVRESDAILREEIKKAGLDREIWQYFTALPNMRSVGVMGDARTYDYTV
FT                   GIRAVTSIDGMTSDWARIPWDVLEIISTRIVNEVKHVNRVVYDITSKPPATIEWE"
FT   CDS_pept        650516..651820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0608"
FT                   /note="BH0608"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04327"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04327"
FT                   /db_xref="GOA:Q9KF77"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF77"
FT                   /protein_id="BAB04327.1"
FT                   /translation="MDRYFGFKEHGTTYGRESIAGLTTFLSMAYILFVNPLILGDAGMD
FT                   VQAVFMATALAAAIGTLIMGILAKYPIALAPGMGLNAFFAYSVVIGMGIDWQLALFGVF
FT                   VSGIIFILITVFKIREVIINAIPAELKNAAAAGIGLFIAFIGLKNAGIVVSDEATAVSL
FT                   GHILNGPTLLACFGLIVTVLFMVRGIQGGIFYGMILTAIVGLISGIITYTGGGIVSTPP
FT                   SLAPTFGQAFNIQMADVFSVQFLIVVLTFLFVDFFDTAGTLYGVANQAGFIKDNKLPRA
FT                   GKALLADSSATSIGAILGTSTTTAYIESSAGVAAGGRTGFASIVTAGLFVLAMFFSPLL
FT                   SVVTEQVTAAALIVVGILMASSLRFIDWTKLEIAIPSFLTVVAMPLTYSIATGIAFGFL
FT                   FYPITMIVKGRGKEVHPIMYALFFVFLAYFIFLSE"
FT   CDS_pept        652141..653964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0609"
FT                   /product="sulfite reductase (NADPH)"
FT                   /note="BH0609"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04328"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04328"
FT                   /db_xref="GOA:Q9KF76"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010199"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF76"
FT                   /protein_id="BAB04328.1"
FT                   /translation="MQLQVMNSPFNEEQVELLNRLLPTLNASQKAWLSGYLTAIQSADT
FT                   ATVLEAVPAAAPAANTAQPVSKEVTILFGSQTGNAQGLAENAGKTLKEQGFQVTVSSMS
FT                   DFKPNQLKKLKNLLIVVSTHGEGDPPDNALSFHEFLHGRRAPKLEDLRYSVLALGDTSY
FT                   EFFCKTGKDFDQRLEALGATRLQPCVECDLDFEEPAAKWLEGVITRLSEGQGQTVPAQP
FT                   TAPEAKAVETVYSRKNPFRAEVLENINLNGRGSNKETRHLELSLEGSGLTYEPGDALGI
FT                   FPENDPELVDLLLNELKWDANEVVAVDKQGERLPLKEALTSYFEITVLTKKLIQQAAEL
FT                   LDNEKLRALTASENAQQLKAYIDGRDLVDFVRDFGPINASPQEFVSILRKMPPRLYSIA
FT                   SSIAANPEEVHLTIGAVRYHAHGRDRKGVCSILCAERLQPGDTVPMFIQPNKNFKLPES
FT                   PETPIIMVGPGTGVAPFRSFMQEREEAGATGKSWMFFGDQHFVTDFLYQTEWQKWLKDG
FT                   VLTRMDVAFSRDTEEKVYVQHRMLEHSKELYKWLEEGAVFYVCGDKTNMAKDVQEALLE
FT                   IIEKEGGKSREEAEAYLAEMKKQKRYQRDVY"
FT   CDS_pept        653993..655711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0610"
FT                   /product="sulfite reductase (NADPH)"
FT                   /note="BH0610"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04329"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04329"
FT                   /db_xref="GOA:Q9KF75"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KF75"
FT                   /protein_id="BAB04329.1"
FT                   /translation="MGNERLKAPEGPPSDVERIKEESNYLRGTLKESMLEPISAGISDD
FT                   DNRLMKHHGSYLQDDRDLRNERQKQKLEPAYQFMLRVRMPGGVATPEQWLVMDELAQKY
FT                   GNGTMKLTTRETFQLHGILKWNMKKTIQAIHSALLDTIAACGDVNRNVMCTSNPYQSEI
FT                   HQEVYEWSKKLSDDLLPRTRAYHEIWLDEEKVAGTPEAEEVEPMYGPLYLPRKFKIGIA
FT                   VPPSNDIDVFSQDLGFIAIVEDDKLVGFNVAIGGGMGMTHGDKATYPQLAKVIGFCKPE
FT                   QIYDVAEKIITIQRDYGNRSVRKNARFKYTVDRLGLETVKNELENRLGWSLDEAKPYHF
FT                   DHNGDRYGWVKGVKGRWHFTLFVEGGRVTDYADYKLMTGLREIAKIHTGDIRLTSNQNL
FT                   IIANVTSQKKKKINELIEQYGLTDGKHYTALRRSSIACVALPTCGLAMAEAERYLPKLI
FT                   DKIDEIIEENGLKNEEITIRMTGCPNGCARHALGEIGFIGKAPGKYNMYLGAAFDGSRL
FT                   SKMYRENIGEEEILKELREILPRYAKERKEGEHFGDFVIRAGIIKETTDGTNFHD"
FT   rRNA            656197..657748
FT                   /gene="rrnG-16S"
FT                   /product="16S ribosomal RNA"
FT   tRNA            658205..658281
FT                   /gene="trnI-Ile"
FT                   /product="transfer RNA-Ile"
FT   tRNA            658293..658368
FT                   /gene="trnI-Ala"
FT                   /product="transfer RNA-Ala"
FT   rRNA            658720..661658
FT                   /gene="rrnG-23S"
FT                   /product="23S ribosomal RNA"
FT   rRNA            662067..662182
FT                   /gene="rrnG-5S"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        663032..664288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0611"
FT                   /product="transposase (11)"
FT                   /note="BH0611"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04330"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04330"
FT                   /db_xref="GOA:Q9JWR9"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWR9"
FT                   /protein_id="BAB04330.1"
FT                   /translation="MLERILSRENLIQALERVEKNKGSYGVDEMDVKSLRLHLHENWTS
FT                   IRNEIIEGSYFPKPVRRVEIPKPNGGVRKLGIPTVMDRFLQQAIAQILTQLYDPTFSER
FT                   SFGFRPHRRGHNAVRQAKQWMKEGYRWVVDIDLEKFFDKVNHDRLMRKLSSRIQDPRVL
FT                   QLIRRYLQTGVMERGLVSPNTEGTPQGGPLSPLLSNIVLDELDNELEKRGLKFVRYADD
FT                   CNIYVRSKRAGLRIMESVTSFIENRLKLKVNREKSAVDRPWNRKFLGFSFTRGKDPKMR
FT                   VSKESVKRLKQRIRELTSRRHSMKMSDRLRRLNRYLTGWLGYYQLVDTPSILAQIDAWI
FT                   RRRLRMIRWKEWKTTSARQKNLVRLGIKKAKAWQWANSRKGYWRVAHSPIMDYALNSEY
FT                   WKGQGLMSLAERYQTRRWT"
FT   CDS_pept        664912..666435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0612"
FT                   /product="nitrate transporter"
FT                   /note="BH0612"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04331"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04331"
FT                   /db_xref="GOA:Q9KF74"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF74"
FT                   /protein_id="BAB04331.1"
FT                   /translation="MSLVEIFRFRNERIKILHLTWIAFFISFFTWFNMAPLATTMMESM
FT                   DWLTREHIAALAIINVALTIPARLIIGMLLDRFGPRIVYSSLLVLMAIPAFMFAFGDTW
FT                   TQLMISRLLLSSIGASFVVGIRMVAEWFPPKDVGFAEGIYGGWGNFGSAVAAMVLPWFA
FT                   ITMFGGPEGWRYAMAFTGVVCLIYGVIYYLFVRDTPEGKTFVRAKRTGAMEVSSWKDLI
FT                   WLIVWTIPLHAALGVLAWRLEGMGFLSETILYTIYLVLAVALVYQVYTILKVNVPLLKK
FT                   GIPEDDRYSFKNVAALNSTYFANFGAELAIISMLPMFFQLTFSLTPAQAGLIASSFAFI
FT                   NLFARPLGGILSDRMGSRRNIMLVYMAGITIGLVGMGFMDSNWPLVVAILITVFTSVFI
FT                   QGAEGATFAVIPMIKKRMTGQVAGMAGAYGNVGATIYLTLYTFVTPQQFFFILAGGALA
FT                   SFVICYFWLEEPENSFASEYALSSVDEQVVQEAEVSEAEESVVVQKKVL"
FT   CDS_pept        666465..668888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasD"
FT                   /product="assimilatory nitrite reductase (subunit)"
FT                   /note="BH0613"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04332"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04332"
FT                   /db_xref="GOA:Q9KF73"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF73"
FT                   /protein_id="BAB04332.1"
FT                   /translation="MKEKLVVVGNGMAGIRTVEELFERGGHERYEVTVVGEEPHVNYNR
FT                   ILLSSVLASEANMEDIELNSLDWYRENDVTLYRSEKVTKLDRKKKVVLTDKGQKIAYDK
FT                   VILATGSHPFMLPLPGSDLEGVIAFRNIEDCETMIETAKNYKKAVVIGGGLLGIEAARG
FT                   LLNLGMEVEVVHIFDYLMERQLDRTAANILRTELENQGMKFLLEKHTEAIIGKGRVERV
FT                   KFKDGTETRADLVVMAVGIRPNHEVASASGIEVNRGIVVDDYMQTSDPDVYAVGECAEH
FT                   RGMVYGLVAPLWEQGKILANALMDNKDEKYEGSVLYSKLKVSGVQVFSVGEFQEQDDAK
FT                   SVSMLDEFAGIYKKIVTRGDKIVGSILVGDTSESTILLNQIIKGVPFEGSPMQLLRSHV
FT                   GSADDGVSAVSMLSNEDQVCGCNGVSKGAIIDAIKTQGCASVADVGACTTAGRSCGTCK
FT                   PMIADLLAEELGETANEKETMCGCTDLSHEEVVAAIREKGLTHTREVMNVLGWKEEHGC
FT                   SKCRPAINYYLAMVHPLEHEDERESRFVNERLHANIQKDGTYSVVPRMYGGVTNPDELR
FT                   RIADVAEKFNVPLLKITGGQRIDLLGVKKEDVPSVWKELDMPSGYAYGKALRTVKTCVG
FT                   EDFCRFGTQDSIGLGIAIEKKFERLNTPHKVKMAVSACPRNCAESGIKDVGIVGVEGAW
FT                   EIYVGGNGGASLRLGDLMCRVKTSEEVLEIIGAFLQLYREEARYLERTSHWVERVGLDY
FT                   IKETLLEHPENRKVLNERMDEALSVLTDPWEEINNDPSLKETLFEEKVAVVTSE"
FT   CDS_pept        668901..669224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasE"
FT                   /product="assimilatory nitrite reductase (subunit)"
FT                   /note="BH0614"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04333"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04333"
FT                   /db_xref="GOA:Q9KF72"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF72"
FT                   /protein_id="BAB04333.1"
FT                   /translation="MNVQASTKTYFIGNVDDFPVKLGRDISIDGVKIAVFKLESGQIKA
FT                   IQNKCPHKGGPLAEGIVSGEHVFCPLHDWKISLQDGMVQYPDEGCVTTFKTTVTDGKVY
FT                   VHM"
FT   CDS_pept        669252..671483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasC"
FT                   /product="assimilatory nitrate reductase (catalytic
FT                   subunit)"
FT                   /note="BH0615"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04334"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04334"
FT                   /db_xref="GOA:Q9KF71"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF71"
FT                   /protein_id="BAB04334.1"
FT                   /translation="MEEMIQFFREKQKQQGKEARYDTRCPFCSVQCSMTLTEEKLVATS
FT                   RFKAIPNKQDPTSEGRLCIKGVHAHQHTVHRERIRQPLVKTGGAFVETSWEVALGLIAE
FT                   RFKRLQKSYGQDAVGVFGGGSLTNEEAYLLGKFARLALGTRYIDYNGRYCMSSAAAAAN
FT                   LTFGVDRGLTNELREVEDAECIVLAGTNLAECQPTLMPYLRRAKKNGAFIIVLDPRETG
FT                   TTKIANLHLKPKPGTDGAIAAGMLKVLIEEELIDRTFIEARTNGFEQVESELQEIALAE
FT                   LALAAGVPEEQIREAAIRFGEAQTGMIFTARGVEQQATGTADVRQFLHILLATGKIGRY
FT                   ACGYGAVTGQGNGQGGREHGQKADQLPGYRSIESPEDRAYIASVWNVEEKDIPRKGVSA
FT                   FELFQKIDQQDVRGMFIMGSNPVLSSPHENLVKRALSRLDVLVVVDMFISETAEYADII
FT                   LPTTSYLEDEGTMTNFEGRVVHRPGSKPPFGKAKHDWQILCELAEALDRSHGFQFSSPE
FT                   EIFNELCLASKGGKADYSGLSYEKIKGEGVLWPCPTKEHEGTGRLFEDRFYTEDGRAQF
FT                   GSVHCPVDSENDEYPILLTTGRVLTQYLSGTQTRRSDALLFKEPEPFVLLHPETASSYQ
FT                   IQDEDWVMVRSPYGEAKLKARQSEGIREDTVFVPFHWAGSVSINHVVAPELDPTSRMPA
FT                   FKRTKVKLKKIIEEKGESWYSGQKNDRQESENTDDILDPVHSGGVAKNR"
FT   CDS_pept        671434..672078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0616"
FT                   /note="BH0616"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04335"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04335"
FT                   /db_xref="GOA:Q9KF70"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF70"
FT                   /protein_id="BAB04335.1"
FT                   /translation="MTYSIQSIQVGLPKTVDYKGKEVTTSIFKEPVTGPVKLMKTGVEG
FT                   DQQADLINHGGVDKAVCVYPLDHYSYWGDKLGGSLGPAAFGENLTVIALTEEQAHIGDT
FT                   FRVGEALVQVSQPRMPCFKLNVKHGVTKFPLWIQETGWSGYYLRVLEEGNVRVGDTFSL
FT                   VDRVEGHPTVLEVNQLYYPKDINKEQLRRMSQLPELADAWKKAFSKKLANA"
FT   CDS_pept        672163..673260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcsA"
FT                   /product="naringenin-chalcone synthase"
FT                   /note="BH0617"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04336"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04336"
FT                   /db_xref="GOA:Q9KF69"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF69"
FT                   /protein_id="BAB04336.1"
FT                   /translation="MASIVSVSSYPPPYLLKQETTTEFAKELFQEDFRDIERLLKSFSN
FT                   GQIEERQFAVPLDWFRQDHSLQEKNDTYIKLATMFSVEVVRQCLQSNVFLKKPVAEEEI
FT                   DTIVFVSSSGMATPSIEARMMNELPFSPHTKRVPMWGLGCAGGAAGMSRAYEYCRAFPR
FT                   ANVLVVCVELCSLTFQRQDRTKSNLIGASLFSDGVACALVSGDESDVLGRMKMPTRPLI
FT                   LGSSSTLMPDSEQVMGWDVKDTGLHVVFSRDIPNIIRHWLRPNVERFLETYRLSLEQIE
FT                   AFIAHPGGRKVLEAYEEALSFSDEMTEYSRDILRHHGNMSSPTVLYVLEKFMKDTRDPG
FT                   QYGLMAALGPGFCSELVLMQWEAVH"
FT   CDS_pept        673260..673820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0618"
FT                   /note="BH0618"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04337"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04337"
FT                   /db_xref="GOA:Q9KF68"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF68"
FT                   /protein_id="BAB04337.1"
FT                   /translation="MIWVYAFISLVIVQRLVEVGLANQNAKWIRSKGGYEVGQTHYKYL
FT                   VLLHGFFFVSLITEVTIKGVAFDLWSAIPFAWFLFAQILRLWALSSLGRFWNTRIMILP
FT                   DANVIASGPYRYIKHPNYAVVIIEIAMLPLFFKAYVTAFLFSLLNAIVLYIRIHTEEEA
FT                   LQAATNYEAVFEGKARFTPKLDE"
FT   CDS_pept        complement(673861..674811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0619"
FT                   /note="BH0619"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04338"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04338"
FT                   /db_xref="GOA:Q9KF67"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF67"
FT                   /protein_id="BAB04338.1"
FT                   /translation="MNNFGRDFKDAIEQIDVPHHRLQAAITTGIEKGRRRRSKAQRSLS
FT                   IVASVFLVGLASLVVLSFIKSTQTNHLSFMDSLGYHLPNDIGSIILQDDSEEVLEADGM
FT                   TIEAKPELRLTIDKIQLSPSYQLIEGTMRTPAEDEVFSNDDLFASVLLLTEENGSYKPL
FT                   TVYNGEIYSNDDDIHFSYDSHSYRFKNIDWSDEYQSITLIPYIDEFEKSLVRGPFYEVS
FT                   RIEAGDHTFDITNLSHKGQHTTLTIEAGEDFHYAFLSFLMFYIPGTDSYYLPLSIEQQE
FT                   NQFVLTYEKLPVEQNLHYSYHETNIYEELIAKIEW"
FT   CDS_pept        complement(674792..675325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigV"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /note="BH0620"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04339"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04339"
FT                   /db_xref="GOA:Q9KF66"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014300"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF66"
FT                   /protein_id="BAB04339.1"
FT                   /translation="MLPMVSLFKRLSRPPFEELVEKEKDKLYRVAFTYVRNEHDALDVV
FT                   QEAVVKGYEAYDRIKHLDYFSSWMTRIVINTAIDLLRKGKDVIPFCPEKSQMNGWTETH
FT                   IISRLDLFDVLSELKPEETTLLVLRYYHDFTILEIARFMNKPEGTIKAQLHRTLAKVRK
FT                   RMEKGGDTYEQLWS"
FT   CDS_pept        675633..676172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0621"
FT                   /note="BH0621"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04340"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04340"
FT                   /db_xref="GOA:Q9KF65"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="InterPro:IPR022930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KF65"
FT                   /protein_id="BAB04340.1"
FT                   /translation="MVSFFMEHALTMILIILIINVVYVTLFTVRMIFTLKNQRYLAATV
FT                   SMIEIIVYVLGLSLVLDNLDRIENLIAYAVGYGIGVITGMKVEEKLALGYITVNVITKE
FT                   YEPDIPNTLRDKGYGVTNWVAYGREGERLMMEILTSRKSEADLYATIKKLDPKAFIISH
FT                   EPKTFFGGFWVKGIRR"
FT   CDS_pept        676175..676372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0622"
FT                   /note="BH0622"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04341"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04341"
FT                   /db_xref="InterPro:IPR025930"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF64"
FT                   /protein_id="BAB04341.1"
FT                   /translation="MTKKKKQRFEVGEHETIAECLARMEKAGYVPIRRMEKPVFEEKSI
FT                   GGKKEYVPVRQQIVFEGQLK"
FT   CDS_pept        676724..677209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /product="phosphoribosylaminoimidazole carboxylase I"
FT                   /note="BH0623"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04342"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04342"
FT                   /db_xref="GOA:Q9KF63"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF63"
FT                   /protein_id="BAB04342.1"
FT                   /translation="MEPVVGVIMGSTSDWETMQHACEILEELEVPYEKKVVSAHRTPDL
FT                   MFQYAETAQERGLKVIIAGAGGAAHLPGMVAAKTVVPVIGVPVQSKALNGLDSLLSIVQ
FT                   MPGGVPVATVAIGKAGATNAGLLAAQMIGAFDHQVAERVRLRREKVEQAVLESSESL"
FT   CDS_pept        677206..678345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /product="phosphoribosylaminoimidazole carboxylase II"
FT                   /note="BH0624"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04343"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04343"
FT                   /db_xref="GOA:Q9KF62"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF62"
FT                   /protein_id="BAB04343.1"
FT                   /translation="MTIIEPGKTIGILGGGQLGRMMALAARAMGYRIAVLDPNPDGPCA
FT                   QVADVVIEAAYDDMEAAKKLVSVSDVVTYEFENVNLDVANYIEQKGCLPQGANLLRVTQ
FT                   HRAVEKETITTLGLPVALYKYVNEAPDFIELAQTIGFPAVLKTCRGGYDGKGQRVVRTV
FT                   DELKSAYDELKLAGELVLEAWVPFDKEISVIVARNERNDTKTFPVAENIHEANILHQSI
FT                   VPARIGDDLRDKAEQLAIRLAEGLNLIGTLAVEMFVTTSGDIYINELAPRPHNSGHYTI
FT                   EACETSQFEQHVRAICGWPLGHVGLYKPVVMGNLLGEHLPGVLNEISEMKDAKLHLYGK
FT                   AEAKEKRKMGHITVLADDLNRAIDRVGQIQEKACAKIGS"
FT   CDS_pept        678379..679680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /product="adenylosuccinate lyase"
FT                   /note="BH0625"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04344"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04344"
FT                   /db_xref="GOA:Q9KF61"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF61"
FT                   /protein_id="BAB04344.1"
FT                   /translation="MIERYTRPEMGAIWTEENRYQAWLEVEIVACEAWAELGEIPKEDV
FT                   KKIREHASFDVERILEIEQETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTALSY
FT                   LLKQANEIIEADLVRFLDILKEKALEHKYTVMMGRTHGVHAEPTTFGLKLALWYEEMKR
FT                   NLERFRLAAEGVRVGKLSGAVGTYANIDPFVEQYVCEKLGLERAPISTQTLQRDRHAEY
FT                   MATLALIATSIEKFAVEIRGLQKSETREVEEYFAKGQKGSSAMPHKRNPIGSENMTGIA
FT                   RVVRGHMLAAYENVPLWHERDISHSSAERIILPDATIAINYMLNRFGNIVKNLTVFPEN
FT                   MKRNMTRTYGLIYSQRVLLSLIDKGMVREEAYDLVQPKAMEAWEKGVQFRELVEQEERI
FT                   TSVLSPEEIEACFDYNHHLKHVDTIFERLGLTNE"
FT   CDS_pept        679738..680451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /product="phosphoribosylaminoimidazole succinocarboxamide
FT                   synthetase"
FT                   /note="BH0626"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04345"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04345"
FT                   /db_xref="GOA:Q9KF60"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KF60"
FT                   /protein_id="BAB04345.1"
FT                   /translation="MEKHDLLYEGKAKKIYRTDEEGLLWVEYKNSATAFNGEKKASIEG
FT                   KARLNNEISSLIFSYLKEQGVDSHFVKRLSETEQLIHQVTIIPLEVVVRNVIAGSLAKR
FT                   IGIEEGTPLEKPLVEFYYKDDDLGDPLVTEDHIAILQAATKEQVDILKVKAIEVNDALT
FT                   TFFAGIGVKLVDFKLEFGVTADGAILLADEISPDTCRLWDAKTGERFDKDLFRRNLGNL
FT                   QDGYEQILTRIEQKA"
FT   CDS_pept        680481..680735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0627"
FT                   /note="BH0627"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04346"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04346"
FT                   /db_xref="GOA:Q9KF59"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF59"
FT                   /protein_id="BAB04346.1"
FT                   /translation="MYKVKVYVTLKESVLDPQGSAVQKSLHALSFTEVNEVRIGKYMEL
FT                   TLEKGEGDLDERIHDMCQKLLANTVIEDYRYEVEEVIPS"
FT   CDS_pept        680732..681415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /product="phosphoribosylformylglycinamidine synthetase II"
FT                   /note="BH0628"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04347"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04347"
FT                   /db_xref="GOA:Q9KF58"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KF58"
FT                   /protein_id="BAB04347.1"
FT                   /translation="MKFAVIVFPGSNCDADMYHAVKDALGEEVDYLWHTETSVEGYDAI
FT                   LLPGGFSYGDYLRSGSIARFSPIMEDVIRAANEGVPVLGVCNGFQVLLEAGLLPGAMLR
FT                   NEKLTFICKPVELEVQNNDTFFTSEYEQGETITIPVAHGEGNYYCDDETLKQLEANNQV
FT                   VFRYTDRVNGSRNHIAGIVNKAGNVLGMMPHPERAVEQLVGGEDGLRLFKSILRNWRES
FT                   HVVTP"
FT   CDS_pept        681399..683630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /product="phosphoribosylformylglycinamidine synthetase I"
FT                   /note="BH0629"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04348"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04348"
FT                   /db_xref="GOA:Q9KF57"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KF57"
FT                   /protein_id="BAB04348.1"
FT                   /translation="MSLHREPTATEVKEQKIYREMGLTDEEFALVESILGRLPNYTETG
FT                   LFSVMWSEHCSYKNSKVLLKKFPIDGDKVLQGPGEGAGIIDIGDEQAVVFKIESHNHPS
FT                   AIEPYQGAATGVGGILRDVFSMGARPISLLNSLRFGELTSPKVRYLFEEVVAGIAGYGN
FT                   CVGVPTVGGEVQFDPCYEGNPLVNAMCVGLIDHKDIQKGQAKGVGNTVMYVGASTGRDG
FT                   IHGATFASEELSEASEEKRPAVQVGDPFMEKLLLEACLELIKSDALVGIQDMGAAGLTS
FT                   SSAEMASKAGSGIEMNLDHVPQREKGMTPYEMMLSESQERMLIVVKKGREQEIKDIVAH
FT                   WGLHAVEVGQVTDDKKLRLLHKGEVVADVPVDALAEDAPVYHKPSKVPAYYEAFQSEKT
FT                   QWIPTIANVKDTLLSLLQQPTIASKEWVYEQYDYMVQTNTVVSPGSDAAVVRIRGTKKA
FT                   LAMTTDCNSRYLFLDPEVGGKIAIAEAARNIVCSGGVPLGVTDCLNYGNPEKPEIFWQL
FT                   EKSTDGMSEACRELGTPVIGGNVSLYNETNGVAVYPTPVIGMVGLIEDVGHITTQAFKK
FT                   AGDLIYVIGEAKAEFGGSELQKLVNGEISGKAPAIDLAVEKKRQEQLLEAIRAGAVASA
FT                   HDIAEGGLAVALAESMMGEAVGADVVIDGEWTTELFAESQSRFLVSVPKEKQAIFESLV
FT                   EDAIHLGQVTDHPQLNIQDVNGAQVLQASVNEMLEAWKGAIPCLLKSKA"
FT   CDS_pept        683606..685027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /product="phosphoribosylpyrophosphate amidotransferase"
FT                   /note="BH0630"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04349"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04349"
FT                   /db_xref="GOA:Q9KF56"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF56"
FT                   /protein_id="BAB04349.1"
FT                   /translation="MFAEIKGLNEECGVFAIWGHEDAAQVAYYGLHSLQHRGQEGAGIV
FT                   VTDGHQLSVHKGLGLVNDVFNPDIFDSLKGKAAVGHVRYATAGGGGYANVQPLVFRSQI
FT                   GSLAIAHNGNLVNANHLKNQLENQGSIFQSTSDTEVLAHLIKRSGYHHIREQLKSSLSM
FT                   LKGAYAFAVMTERELMVALDPNGLRPLSIGRLGEAYVVASETCAFDVIGAEYVREVEPG
FT                   ELVTINDDGLTSERFVGEAARAICSMEYVYFARPDSNVDTINVHTARKNLGKQLAIEAP
FT                   VEADVVTGVPDSSISAAIGYAEQSGIPYELGLIKNRYVGRTFIQPSQALREQGVKMKLS
FT                   AVRGVVEGKRVVMIDDSIVRGTTSRRIVNMLREAGAKEVHVRISAPPIKHPCFYGIDTS
FT                   TKEELIAATHSIEEMRKQMGADSLSFLSLEGLVKGVGRSNEVSSCGQCLACFTGQYPTE
FT                   IYPDTLHPHDKLLPV"
FT   CDS_pept        685040..686077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /product="phosphoribosylaminoimidazole synthetase"
FT                   /note="BH0631"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04350"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04350"
FT                   /db_xref="GOA:Q9KF55"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KF55"
FT                   /protein_id="BAB04350.1"
FT                   /translation="MSDAYKQAGVDIEAGYEAVARMKKHVLRTARPEVIGGLGSFGGMF
FT                   DLSALNMKEPVLVSGTDGVGTKLMLAFQMNKHDTIGVDAVAMCVNDIVVQGAEPLYFLD
FT                   YIACGKSEPARIEAIVKGIADGCEQAGCALIGGETAEMPGMYDETEYDVAGFAVGAVEK
FT                   ADLVTGADIESGDLILGLPSSGVHSNGFSLVRKILLHDHGYTLDSEIPALGKKLGEELL
FT                   TPTKIYVKTVLQTLKTGKVKGLSHITGGGFYENVPRMLPEGLGAEIDYGSWPVPPIFSF
FT                   IRETGQLSAKDMFSTFNMGIGMAVVVSSDDAPHVIRQIQETGEDAYIIGRVTDTSGVVI
FT                   GGAFE"
FT   CDS_pept        686074..686640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="BH0632"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04351"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04351"
FT                   /db_xref="GOA:Q9KF54"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="PDB:3P9X"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF54"
FT                   /protein_id="BAB04351.1"
FT                   /translation="MKRVAIFASGSGTNAEAIIQSQKAGQLPCEVALLITDKPGAKVVE
FT                   RVKVHEIPVCALDPKTYPSKEAYEIEVVQQLKEKQIDFVVLAGYMRLVGPTLLGAYEGR
FT                   IVNIHPSLLPAFPGLHAIEQAIRANVKVTGVTIHYVDEGMDTGPIIAQEAVSIEEEDTL
FT                   ETLTTKIQAVEHRLYPATLHKLLSK"
FT   CDS_pept        686655..688190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="BH0633"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04352"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04352"
FT                   /db_xref="GOA:Q9KF53"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KF53"
FT                   /protein_id="BAB04352.1"
FT                   /translation="MKRRALVSVSNKEGIVPFAKALVEHEVEIVSTGGTKRALQEAGIP
FT                   VTGISDVTGFPEILDGRVKTLHPNIHGGLLAMRERDEHLAQLNEHHIRPIDFVVVNLYP
FT                   FQQTIAKPEATFADAIENIDIGGPSMLRAAAKNHQHVTVVVDPVDYETVLKELADQGNV
FT                   ATETKRRLAAKVFRHTAAYDAMIAEYLTDAVGEESPESLTVTFEKKQDLRYGENPHQKA
FT                   TFYQKPLGAKASIAHAKQLHGKELSYNNINDADAALSIVKEFKEPAAVAVKHMNPCGVG
FT                   TGETIKEAFDKAYEADPVSIFGGIIALNREVDVETAKTLKEIFLEIIIAPSFSEEALDV
FT                   LTSKKNLRLLTLPLNEENQAEKRITSIHGGALVQEEDTYGFEEAEIKIPTKREPTEAEW
FT                   EALKLAWRVVKHVKSNAIVLADGQMTVGVGAGQMNRVGAAKIAIEQAGEKAAGSVMGSD
FT                   AFFPMGDTVELAAKAGITAIIQPGGSIRDEESIENADKHGIAMVFTGVRHFKH"
FT   CDS_pept        688211..689497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /product="phosphoribosylglycinamide synthetase"
FT                   /note="BH0634"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04353"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04353"
FT                   /db_xref="GOA:Q9KF52"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KF52"
FT                   /protein_id="BAB04353.1"
FT                   /translation="MNVLVIGSGGREHTIAWKFAQSEKVERVYVAPGNDGMSDVATCVA
FT                   ISEQDHDQLVAFAKENKIGLTFVGPEVPLLAGIVDRFQEEGLRVFGPSKRAAEIEGSKS
FT                   YAKQVMKTYNIPTGSYEVFTSFDEAKAYVEAEGVPIVIKADGLAAGKGVVVALTNEEAI
FT                   AALDDMLNQDKFGGAGARVVIEEYLEGEELSLMAFVHGETVIPMVGAQDHKRAFDGDQG
FT                   PNTGGMGAYSPVPQFSDVQLKQAVNEILIPTARALMQEERSFTGILYAGLMMTADGPKV
FT                   IEFNARFGDPETQVVLPRLKSDLVNVIESLLDGQEPELEWDEQAVLGVVLATKGYPGSY
FT                   EKGYTISGLEQLEDDTLVFHAGTKREEEELVTNGGRVLLVAKQASTLREAQAAVYEELN
FT                   KVKSDGLFYRKDIGSKAIAERAVSSQTEQ"
FT   CDS_pept        complement(689457..689573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0635"
FT                   /note="BH0635"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04354"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04354"
FT                   /db_xref="GOA:Q9KF51"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF51"
FT                   /protein_id="BAB04354.1"
FT                   /translation="MTINIQEYATDTLFVYALLIGSIMAIIALFVRKRRARR"
FT   CDS_pept        complement(689636..689914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0636"
FT                   /note="BH0636"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04355"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04355"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF50"
FT                   /protein_id="BAB04355.1"
FT                   /translation="MYPNIGRVNALVRITVGLTTLAWSSARMVKRPNHPCLIMTAMAGA
FT                   MKTAEGITRFCPMTYFLERNDYGFYDEYADEECEHCEHDEEQSKPFM"
FT   CDS_pept        690063..691808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0637"
FT                   /product="adenine deaminase"
FT                   /note="BH0637"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04356"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04356"
FT                   /db_xref="GOA:Q9KF49"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KF49"
FT                   /protein_id="BAB04356.1"
FT                   /translation="MCEQKYRWTKKQIRQQLAVVRGEMAPTLVLKNATYLNSVRGKWLD
FT                   ANIWIYQDRIVYVGQDMPAKLDDETEVVDCGQQVIVPGYIEHHAHPFQLYNPHSFANYA
FT                   AAMGTTTLINDNLMFFLALEKKKALSMIESLDELPSSMYWWCRYDPQTEMNDEEGHFLN
FT                   SKIKEWLEHPLVVQGGELTSWPKVITGDDGILHWMQETRRLRKPIEGHFPGASEKTLTQ
FT                   MSLLGVTSDHEAMTGEEVIRRLDLGYMTSLRHSSIRSDLAKILREMKELGIDDFSRCML
FT                   TTDGSPPSFYEQGIMDRLIKIALDEGIPPKDAYGMATYYVARYYGLDYELGMIAPGRIA
FT                   HLNFLDNVFNPVPTSVLAKGQWVVRDGQRYGSDSVFPWEDFGMKRLTIDWDLSVDELHF
FT                   SMPMGIELVNSVILKPYQVSVEASRDTLAEDHDECFFLLLDKHGKWKIPTMIKGFAKKV
FT                   SGLASSFSTTGDIILIGKCIQDMIVAFNALKQQGGGIVLVENGEVISNIPLEIMGLLSS
FT                   KPMEEVMEEEKKFVKALRERGYEHDDPIYSLLFFSSTHLPYIRVTQRGIYDVHKKTVLF
FT                   PSIMR"
FT   CDS_pept        691963..693021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0638"
FT                   /note="BH0638"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04357"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04357"
FT                   /db_xref="InterPro:IPR021416"
FT                   /db_xref="InterPro:IPR023158"
FT                   /db_xref="InterPro:IPR035328"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF48"
FT                   /protein_id="BAB04357.1"
FT                   /translation="MKKIILLLFLLSATVVLLVGCGGDEELEAHDNVPMKEEGDVEEAS
FT                   TITYPLTGEVAKEQVNRRVIGVTINNHPEARPHSGIQAADLVYEVLSEGEVTRLVALFH
FT                   SEYPERVGSVRSSRPYHIELVQGYGGLLVTHGWSPEAEQLLKAGRADYLNGLFHDGTLF
FT                   QRSPDRKAPHNSYITFANIQKGLTDKGYTLEGDVAPFRFYEEGAEMEGLAIDELTINYF
FT                   DRNRVTYRIQSESGEMTRYNEELQTIDLDTRKPVEVSNLFVVETDHRVLDDQGRREINL
FT                   TSGGRGLLLQGGRLQFVEWRNENGRILPVQNGEIVPFLSGQTWINIVPTSPGLDKMVEW
FT                   NNDEKGVTDDAN"
FT   CDS_pept        693011..693313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0639"
FT                   /note="BH0639"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04358"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04358"
FT                   /db_xref="GOA:Q9KF47"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF47"
FT                   /protein_id="BAB04358.1"
FT                   /translation="MQIDKLRGRELDQLFKSILSLRDLEECYQFFDDLCTINEIQSLAQ
FT                   RLEVARMLREGATYHKIETETGASTATISRVKRCLNYGNDGYKMTLERIKDVEAE"
FT   CDS_pept        693488..695245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adeC"
FT                   /product="adenine deaminase"
FT                   /note="BH0640"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04359"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04359"
FT                   /db_xref="GOA:Q9KF46"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KF46"
FT                   /protein_id="BAB04359.1"
FT                   /translation="MTDRLERKLAIAANQDKADLLIKNGQIVDVFQLETFEGDVVIADG
FT                   EIVAISDPGTYEAHEEVDAKGAFIAPAFIDGHVHIESSMVAPEQFAKVVVPHGVTTVIA
FT                   DPHEIANVAGVQGVEYMLDASEGIPLDVKMMVPSCVPATPFEHSGARLTAEEVAELFRD
FT                   PRIFGLGEVMDYPAVLTRDQEMMAKLKAAHSEGRIVDGHGAGLDSVALNAYTAAGIGND
FT                   HEAVTPEEAKARLQRGMYLLIREGTAAKDFDALMKAITPMNSRRALFVTDDKHLDELVE
FT                   EGSIDHHVRKAIQIGVNPLQAIQMASLNAAECFKLAKKGAIAPGFTADLLFIEDLQSLA
FT                   ITHVFKNGTCVAKNGKLIVPIRETVQPPQRLLESVNMKLVTKEQLELSLQSDEEAHLIQ
FT                   IQPGSIVTKHIREKVAVKDGVFIPSVARDQLKLVVAERHHKRGTVGVGIVKGFGLTKGA
FT                   IATTVAHDSHNIVAVGTNDEDLLAAIKELENIQGGMTIVKDGKVLVSLPLTIGGLMSDQ
FT                   SYDVVCEQIKSVDAAIGALGFVGDFNPFLTLSFLALPVIPEIKLTDQGLFDVTSFSFID
FT                   QQVYAEETN"
FT   CDS_pept        695639..696187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0641"
FT                   /note="BH0641"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04360"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04360"
FT                   /db_xref="GOA:Q9KF45"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF45"
FT                   /protein_id="BAB04360.1"
FT                   /translation="MAKKKADLLLHPVRMRIIQAIMSKKPMSPLELLEVLQDVPQATLY
FT                   RQIKVLEDADILRVVSTHKRRGALEKVYGIDQETLHIPDDELEHTTREEHVRYYLTYQA
FT                   NVLQEVEAYVMSRDPNHYKEDGFGYWQTPLHLTEQEQQEFAEKLVELVQTYAQNEPRSD
FT                   RNTVTMATTFVPHIKGESS"
FT   CDS_pept        696223..696438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0642"
FT                   /note="BH0642"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04361"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04361"
FT                   /db_xref="GOA:Q9KF44"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF44"
FT                   /protein_id="BAB04361.1"
FT                   /translation="MNIADDRLKYVLILLLAGLQVGGIVMVFINLRIAMFLFIGYGLAL
FT                   ILLILLMVWERREEKREELNYDDCDY"
FT   CDS_pept        696419..696739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0643"
FT                   /note="BH0643"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04362"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04362"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KF43"
FT                   /protein_id="BAB04362.1"
FT                   /translation="MMIVTTDRIDGYNVKAVKGYVKGSTVQTKHIGRDITAGLKGLVGG
FT                   EIKGYSEMMDEARKLAIHRMAQDAEAKGANAVIGFRLQTSTVMANAAEIIAYGTAVEVE
FT                   KE"
FT   CDS_pept        complement(696788..697126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0644"
FT                   /note="BH0644"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04363"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04363"
FT                   /db_xref="GOA:Q9KF42"
FT                   /db_xref="InterPro:IPR021493"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF42"
FT                   /protein_id="BAB04363.1"
FT                   /translation="MFFVLKMIVSAFVIAIVTEISRRLPTYGGIIAALPLVSLLSLFWL
FT                   SIQGESETNMNQFTLGVLIGLPATGFLLLIVYFLTKHSVPFIVSLCAGMVAWAVFIYVQ
FT                   DLLKRMFT"
FT   CDS_pept        complement(697111..697521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0645"
FT                   /product="transcriptional regulator"
FT                   /note="BH0645"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04364"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04364"
FT                   /db_xref="GOA:Q9KF41"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF41"
FT                   /protein_id="BAB04364.1"
FT                   /translation="MDLNQYWTDIYYYLHYTHGEEKVTHQMIRIMQHIDKKERVGVRDI
FT                   AHLLQISQNTASEHMKRLIQKGYVEKGRDPKDERKVVLSLTPNGKNILFHHTSLDEKKL
FT                   EAVYTHLSKEEQAMIEAAFRRLSEEAKRCFSS"
FT   CDS_pept        697642..698595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0646"
FT                   /note="BH0646"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04365"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04365"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF40"
FT                   /protein_id="BAB04365.1"
FT                   /translation="MTKLYEPFYRLTIELTECEREIIGSRPFKRLAHLHHYGAAALRTP
FT                   VTHSRYEHTIGVWSLTAHFFPSDQLLRLVALLHDIGHLPFSHAVEQPLGFNHHLLTERL
FT                   IESQEVAKILKKHGFIPQDVIRRLNENTPVSNQEKLLSLDHLDSFLRDTTLAGTCSLIP
FT                   HESLGRLSVRGNGIETDEETALLLASCIVKDHELFLDPFNLAMDALLAEAITLYMADKP
FT                   LVSMENIPHMTDDEVLTLLRGSWNKKVHAHLKLLFSQQPTLVQTDDESSAKLTVTVRKV
FT                   YEDRPLIRHGTAKGREMVEKKLAELQELKGRFSFVY"
FT   CDS_pept        698872..699561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0647"
FT                   /note="BH0647"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04366"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04366"
FT                   /db_xref="GOA:Q9KF39"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KF39"
FT                   /protein_id="BAB04366.1"
FT                   /translation="MMLEFQEWRHVFKLDPNKELNDDDLEAICESGTDGILVGGSDGVT
FT                   LDNTLQLLARIRRFSVSCALEVSNLESITPGFDHYFIPSVVNSGEVKWISGLHHEAVKE
FT                   FGPIMNWDEIVMEGYCIMNPDSKAATLTSAKTDLANEDVVAYARMVENMYQFPVFYLEY
FT                   SGTFGDPQLVEEVSQVLTKTKLFYGGGIRTVEQAEQMAPFADTVVVGNVIYDDVQAALA
FT                   TIAAVKK"
FT   CDS_pept        699605..701848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="BH0648"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04367"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04367"
FT                   /db_xref="GOA:Q9KF38"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF38"
FT                   /protein_id="BAB04367.1"
FT                   /translation="MFGGVTNVQRKIIEKMLAGLNDRQREAVKHTEGPLLLMAGAGSGK
FT                   TRVLTHRIAYLLREKGVAPWNVLAITFTNKAAREMKDRVAQLVGPIADDIWISTFHSMC
FT                   VRILRRDIDRIGYSRNFTILDSTDQLSVIKQILKNNNIDSKKFEPRSILGTISGAKNEL
FT                   KTPEQFMGIAKGPYEETAAEVYVEYQKQLKKNQALDFDDLIMKTTSLFKKVPEVLEYYQ
FT                   RKFQYILVDEYQDTNRAQYMLVKMLGDRHKNVCVVGDSDQSIYKWRGADIANILSFEED
FT                   YQDAEVILLEQNYRSTKTILEAANRVIENNVKRKPKNLWTENEQGAKIGFYKADTEQGE
FT                   AQFVVEKIREAIQDGASYKDIAILYRTNAQSRVMEEMLIKSNIDYNIVGGTKFYDRKEI
FT                   KDVLAYLRLVANPDDDISLQRIINVPKRGIGATTVDKIAAYAERQGISMFAALKEIEQI
FT                   GVTSRAVSKLVEFTEQLGHWVQMQEYLSVTELVEELLERTGYRDMLQNEKTLEAQSRLE
FT                   NIDEFLSVTQEFEKSSDDKSLIAFLTDLALISDIDKLDDEDDGAKPTDAVVLMTLHSAK
FT                   GLEFPIVFLIGLEEGIFPHSRSLFEDDEMEEERRLAYVGITRAEKQLYLTSAQLRTIYG
FT                   RTNANPPSRFIDEIPEDCLEFLNEPQEELPWMKTSRPVTKAKQPSRSVPQMTTTGGEQF
FT                   AWTVGDKAEHKKWGIGTVVSMKGEGDSLELDIAFPPPTGIKRLFAKFAPITKA"
FT   CDS_pept        701864..703873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lig"
FT                   /product="DNA ligase (polydeoxyribonucleotide synthase
FT                   (NAD+))"
FT                   /EC_number="6.5.1.2"
FT                   /note="BH0649"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04368"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04368"
FT                   /db_xref="GOA:Q9KF37"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KF37"
FT                   /protein_id="BAB04368.1"
FT                   /translation="MERNDAERKIEKLRNQLEEYGYHYYVLDKPLVSDAEYDGLMNELI
FT                   ELEEAFPELKSDTSPSVRVGGPPLPHFEKVEHRTPMLSLGNAFSDQDLRDFDRRVRQVV
FT                   GDEVTYSCELKIDGLAISLIYESGRFVRGATRGDGTTGEDITQNLRTIPSIPLRLKEAV
FT                   SLEVRGEAFMPKRSFEALNEAKEAAGEERFANPRNAAAGSLRQLDPKLAAKRHLDAFIY
FT                   AIGSVEGKELHSHHEGLNYLKTIGFKINPESAYCESIDEVIDYVNSWLERRADLPYEID
FT                   GIVIKVDNVNFQEQLGYTAKSPRWAIAYKFPAEEVITTLLDITLNVGRTGVVTPTAELK
FT                   PVTVAGTTVKRASLHNEDLIREKDIRLGDSVVVKKAGDIIPEVVNVLTELRTGEERPFS
FT                   MPTHCPECGSELVRLEGEVALRCINPQCPAQIREGLIHFVSRQAMNIDGLGEKVITQLF
FT                   EHGLIHNVADLYKLNKDELLQLERMGEKSVNNLLASIETSKKSSLERLLFGLGIRFVGS
FT                   KAAKTLAMHFPTMTELRRASYDELIAVNEIGEKMAASIVSYFEKPEVNELIDELASLGV
FT                   NMTYNGPKPIGEEEIADSPFAGKTVVLTGKLQALTRGEAKEKIEALGGKVTGSVSKNTD
FT                   LLVAGEDAGSKLTKAKELNIEIWDEEALVKAISH"
FT   CDS_pept        703910..705088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0650"
FT                   /note="BH0650"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04369"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04369"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF36"
FT                   /protein_id="BAB04369.1"
FT                   /translation="MLKKMGIGLMASVLFLSGCFPFVQDTEDNVVDMGEEGDPQEQEVG
FT                   VVPQASTAENFYSSVLYDGTYIHGRTRGFGSAVVYNRADLDQLELGLTEIAKEHFDPET
FT                   YFFREGQFILRDELNSWLMRESDDNPNGLNPPLGKGDNMREREEDQPRYLSHILEHNYL
FT                   VEDNGEYKLGGIVIGLSMNSVYNFRVEDDQGRYNFYETDISENKMLEEGEKIAQEVVNR
FT                   LRSQEREDGSFNDIPIVIALFREQPRDSVIPGNFVATAVAEPDKELSGLQSINERYYLF
FT                   PSDDANNNARNDSDNFLRFREEVQGFFESYVGIVGKGYYRDNSLQELTIDVPIRYQGKT
FT                   EIVALSQFIADRIEQRFPKNIKVQVYINSVGEKQEAIVVRQPNEEPFIHIFR"
FT   CDS_pept        705383..705754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0651"
FT                   /product="transcriptional regulator (GntR family)"
FT                   /note="BH0651"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04370"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04370"
FT                   /db_xref="GOA:Q9KF35"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF35"
FT                   /protein_id="BAB04370.1"
FT                   /translation="MKIIISNSSKEPIYEQITNQIKASILSGELKEGAAIPSMRKLAKD
FT                   LQVSVITTKRAYEELEKAGFIYSIVGKGSFVAEQNLEVMREKKLKAIEEQLSAVIMNSK
FT                   EIGLSLDDLQQLLKILYEE"
FT   CDS_pept        705761..706627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0652"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="BH0652"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04371"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04371"
FT                   /db_xref="GOA:Q9KF34"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF34"
FT                   /protein_id="BAB04371.1"
FT                   /translation="MENIVELINVTKTFKDFSINKMDLQVKKGFVTGFIGANGAGKSTT
FT                   IKMMMNLLKPDDGEVKLFGMDYTTHEKAIKERIGFVYDGNVFFEGLNLKDIKHIVGPAY
FT                   KRWDDTLFYQYVDKFELPLNKAIKTFSKGMQMKASLAIALSHHAELIIMDEPTAGLDPI
FT                   FRRELLDILQELMIDNDRTIFFSTHITTDLDRIADYIAFMQGGNLVFNQSIHDIDENYA
FT                   LVKGGLDLLDKDTEKAFVHVRRASTGFEALTNNLSAVKNIFGDTVIIERATLEDIMYYM
FT                   KGGVHYV"
FT   CDS_pept        706620..707225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0653"
FT                   /note="BH0653"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04372"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04372"
FT                   /db_xref="GOA:Q7AJY1"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AJY1"
FT                   /protein_id="BAB04372.1"
FT                   /translation="MFNLIRRDIILQKKMLLTFIPFIGFFIFMDSHPALIFLVASIFIP
FT                   FNAYAYDEKAETNILLNSLPYTRKEIIASRYLGAVMYMLLAIGVTSLALFIFNKPFALS
FT                   DIAIGGGLFLLFTACTFPLFYLFKPGHITTVILVSFILLAGIGPSVVMFLAEHLTAITD
FT                   FIVNLSVPALYTGAAIVIITLYAISWGATTFIYQRKAL"
FT   CDS_pept        complement(707726..708640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0654"
FT                   /note="BH0654"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04373"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04373"
FT                   /db_xref="GOA:Q9KF33"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF33"
FT                   /protein_id="BAB04373.1"
FT                   /translation="MTKKTIRLLMPQWQGGNNPHYSFGAELLAWLAPDNDQPLIHVPVQ
FT                   AYDGTPLENENGVNGRKQLLEQLEAAQHIIHAHKPDRIVMFGGDCLVEQAPFAYLNERY
FT                   DGELGLIWIDAHSDLVRYAGYDNGHTLPLGNLLGEGDEEFAKHVKIPLKPENVFIAGLA
FT                   TPTEEETNVISKELQRLGVAPTEPDTEVIQRLGIRTAGTKELMTSTESIKKWIKESNIK
FT                   YLAIHLDLDVLDPKAFRSLLFANPEAPYHFSPAGTMQLRQLLHLMKELSEVTDVVGLGI
FT                   TEHMPWDAIHLKHLLEEIPILNK"
FT   CDS_pept        708747..709088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0655"
FT                   /note="BH0655"
FT                   /note="unknown conserved protein in bacilli"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04374"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04374"
FT                   /db_xref="GOA:Q9Z9W1"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9W1"
FT                   /protein_id="BAB04374.1"
FT                   /translation="MSMAEYKGKVKNIQDTPFGYTLSLIGGKWKMVIIYLLAEDQPIRF
FT                   KELKRQIGTITYKTLSSQLKELEADGLVKRKEYPQVPPKVEYSLTDKAGTLLPILEELC
FT                   EWGVKNQNN"
FT   CDS_pept        709259..709657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0656"
FT                   /note="BH0656"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04375"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04375"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AJY0"
FT                   /protein_id="BAB04375.1"
FT                   /translation="MKYSKATNYALHTVLFLAAATPSKFVGVQQLAERQEVSPTYLSKI
FT                   LTKLAKAGMIESVSGANGGYRLKRDWEEISFLDVIHAIEGTASLFDCDLNHGSECLIQK
FT                   VMVSAEEKMEDYLREQKIADLTKKIAGD"
FT   CDS_pept        709841..710758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0657"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase,
FT                   class II"
FT                   /note="BH0657"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04376"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04376"
FT                   /db_xref="GOA:Q7AJX9"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AJX9"
FT                   /protein_id="BAB04376.1"
FT                   /translation="MEKQQLDVAIIGGGPAGLNAALVLGRARKQVAVIDEGRPRNAVTR
FT                   EAHGFLTRDGISPADFRRIAKEEIIAYPNVSFVADKAVSIAGVDGQFQIVTAEGISFET
FT                   KKLLFAVGMKDRPLDIPGLVEAYGKSAFVCPYCDGWELRDESLVVINKGEELLHFAPII
FT                   SGWTDRFTICTNGPDELTEDQREELRRHQVPVYDSPIRSIDSNDGIVHQVVLQDGTIIP
FT                   CRGIFFKPELIPGSDLPQSIGCDITEAGMVVVDDFGKTSVPGVYSAGDVASKMYQAIAA
FT                   ASMGALTAAAMNNELNMEAWKRNG"
FT   CDS_pept        711006..711704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0658"
FT                   /note="BH0658"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04377"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04377"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF32"
FT                   /protein_id="BAB04377.1"
FT                   /translation="MTLEFSFDAKMGLAYEKNTRISVPTYDTLFEMIQSYFRMQLGEKV
FT                   ASVLVVGAGGGNELSAWGPTNPNWTFTGVDPTVEMLKLAQQKAVQLGLESRVRLIQGTI
FT                   GDLPRHDGTFDAASCILVLHFIHDEQEKLELLETVKAHLKPGAPFVLVSAYGDRDSGEL
FT                   QDRINVWKSFFLDAGKEPAIVDEMVPKVLTQISFLPERQITSLLAEAGFTSITRFYSTG
FT                   LFAGWICHAK"
FT   CDS_pept        712676..712777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0659"
FT                   /note="BH0659"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04378"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04378"
FT                   /db_xref="GOA:Q9KF31"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF31"
FT                   /protein_id="BAB04378.1"
FT                   /translation="MEHSLTTATWILLFVPMPLLILLSILTLKRKEE"
FT   CDS_pept        712785..714290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0660"
FT                   /product="sodium/proline symporter"
FT                   /note="BH0660"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04379"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04379"
FT                   /db_xref="GOA:Q7AJX8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AJX8"
FT                   /protein_id="BAB04379.1"
FT                   /translation="MELATLITFIVYLVGMLVIGLIAYRMTNNLSDYVLGGRRLGGSVA
FT                   ALSAGASDMSSWLLLGLPGALYVGGMGEIWIAVGLAIGAYLNWQFLAARLRNYTEIAKD
FT                   SITLPDFLENRFHDKSKILRIVSALVILVFFTFYTSAGLVGGALLFEASFGMTYIQALW
FT                   IGAIVIISYTFLGGFLAVSWTDFFQGILMFLALIIVPIVAINKMGGFSETLNAVGAIDT
FT                   AYLDAFQGATVIGVASLLAWGLGYFGQPHIVTRFMAVKSLKEIPKARFIGMTWMVLALF
FT                   GAIFTGFVGIAYFSATGPGPEIAGEARETVFILFTQILFDPWVAGFLLAAILSAIMSTI
FT                   DSQLLVSSSALAEDFYKGMLRKNASQKELVWVGRFGVVLIALVAIVLAYNPDSTVLDLV
FT                   GYAWAGFGAAFGPVLLLSLFWKRMTRNGALAGMVVGGATVIIWAELTNWFNLSVEQYPI
FT                   LGLYEIIPGFILASIAIIVVSRLDQEPPQEIQDEFEKAKTKVI"
FT   CDS_pept        714541..715656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0661"
FT                   /product="response regulator aspartate phosphatase"
FT                   /note="BH0661"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04380"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04380"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AJX7"
FT                   /protein_id="BAB04380.1"
FT                   /translation="MVEKLASSEVANRLNEWYDTIKQQDVERASKLRNEVQEAINQMEE
FT                   DQNVLQYFNLIDSRFRQVIEEFDKSKTILKSIKNQTERSETDQLLRYYYFFFNGLYEFY
FT                   KRNYIQAIHYYRQAENFLISIPDEIEHAEFHIQLANAYYGIEQNFFSLSHAKKALNIYL
FT                   NHENYVNRLITTQLTIAANELDLKQYGSAETLYKKAIKTASEHNHAFMEVLGYFNLGIC
FT                   YELQDKLEFARDCFEAALDISYPQENKRDSYLRIKYMLARTLFKMELVDEAMDWFEDAQ
FT                   TLVDATNEETYQAKLKIIYSIYKTYDETSIDNGLEVLREKKLWHDVSDLTTNAARHFKK
FT                   KEMFKLATKYFSEALLAKEKIPMLHKEVESE"
FT   CDS_pept        715653..715784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0662"
FT                   /note="BH0662"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04381"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04381"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF30"
FT                   /protein_id="BAB04381.1"
FT                   /translation="MKNVLLTLIAVSFAFSFVPPEELPNSYGSGGGFTASERNNTGN"
FT   CDS_pept        complement(715942..717216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0663"
FT                   /note="BH0663"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04382"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04382"
FT                   /db_xref="GOA:Q7AJX6"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AJX6"
FT                   /protein_id="BAB04382.1"
FT                   /translation="MNKTFWLTLLTWIFFGIMIGAIVGSATALLLTVNDHLGETRENRP
FT                   WFVLFLPLAGLALGYLYMKAGTSAGNELYKGNNLVIESVQGKGKMLLRLGPLVYLGTFM
FT                   TILFGGSTGREGAAIQMGGSVAEAVNKLFKVKLIDTRILLMGGISAGFGAAFGTPITAA
FT                   IFGMEMASLGRLKFEALVPCLVASFVGHYTTEKFWHVEHEKFIIATVPEVSALTFSKVI
FT                   LLAIVFSLVSVLYCQLRHGIHKLSEKYTMKNHTVRAFVGGLIIVALTYIIGSYDYNGRG
FT                   LDMLEDSFTQDVPPYAFLAKLVFTAVTMGMGFVGGEAIPLFFVGATLGNTLHAFIDLPL
FT                   SFLAALGMIVTFGGGANTPIAAFLLGVEMFNGKGIEFFFVACLTSYLFSGHHGLWPSQT
FT                   IYEPKSRLYGVRKGETIKRTEEMKE"
FT   CDS_pept        complement(717230..717841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0664"
FT                   /note="BH0664"
FT                   /note="unknown conserved protein in bacilli"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04383"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04383"
FT                   /db_xref="GOA:Q7AJX5"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AJX5"
FT                   /protein_id="BAB04383.1"
FT                   /translation="MDFHFIWKAIVIVFGGVLILRLAGRKSISQMTVAQTVMMIAIGSL
FT                   IIQPVGDRNIWITIAITLLLVLTLLFIEYIVLKNDTLERFFYGQSIVVIENGQLQEQNL
FT                   KKLRLTVDMLELRLRQQGIQHMSDVQWATIESNGQLGYSLKPEKQAATKEDMQKLQTLI
FT                   QTALPNAPLQPPMIQPNETGNLFTEAAENKHQTPPPTHLE"
FT   CDS_pept        718070..718360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0665"
FT                   /product="glutamyl-tRNA (Gln) amidotransferase subunit C"
FT                   /note="BH0665"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04384"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04384"
FT                   /db_xref="GOA:Q9KF29"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KF29"
FT                   /protein_id="BAB04384.1"
FT                   /translation="MSRISMEQVKHVAHLARLAITEEEAKLFTEQLGDIIQFAEQLNEL
FT                   DTEGVEPTSHVLDMKNVLREDKPEKGLPVEDVLKNAPDHEDGQIRVPSVLE"
FT   CDS_pept        718379..719836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0666"
FT                   /product="glutamyl-tRNA (Gln) amidotransferase subunit A"
FT                   /note="BH0666"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04385"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04385"
FT                   /db_xref="GOA:Q9Z9W9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9W9"
FT                   /protein_id="BAB04385.1"
FT                   /translation="MSLFDLKLKDVHTKLHEKEISVSDLVDEAYKRIEQVDGQVEAFLA
FT                   LNEEKARAYAKELDAALDRSEARGLLFGIPIGVKDNIVTKNLRTTCSSRILGNFDPIYD
FT                   ATVVHKLREAQAVTIGKLNMDEFAMGSSTENSAFQKTKNPWNLEYVPGGSSGGSAAAVA
FT                   AGEVPFTLGSDTGGSIRQPAAYCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRNVED
FT                   NAYLLQAISGHDPMDSTSANLDVPDYLSALTGDIKGLKIAVPKEYLGEGVKEEVKQSVL
FT                   DALKVLEGLGATWEEVSLPHSKYALATYYLLASSEASANLARFDGVRYGFRSDNADNLL
FT                   DMYKQTRAEGFGDEVKRRIMLGTFALSSGYYDAYYKKAQQVRTLIKQDFEKVFEQYDVI
FT                   IGPTTPTPAFKIGEKTDDPLTMYANDILTIPVNLAGVPAISVPCGFDNGLPLGLQIIGK
FT                   HFDEGSVYRVAHAFEQATDYHTKRPTL"
FT   CDS_pept        719850..721280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0667"
FT                   /product="glutamyl-tRNA (Gln) amidotransferase subunit B"
FT                   /note="BH0667"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04386"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04386"
FT                   /db_xref="GOA:Q9Z9X0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z9X0"
FT                   /protein_id="BAB04386.1"
FT                   /translation="MNFETVIGLEVHVELKTESKIFSASPNHFGAEPNANTSVIDLGYP
FT                   GVLPVLNKAAVEFAMKAAMALNCEVATDTKFDRKNYFYPDNPKAYQISQFDKPIGENGW
FT                   IEIEVDGTKKKIGITRLHLEEDAGKLTHSGNGYSLVDFNRQGTPLIEIVSEPDIRTPQE
FT                   AYAYLEKLKSIIQYTGVSDCKMEEGSLRCDANISLRPVGQEEFGTKTELKNLNSFNFVR
FT                   KGLEYEEKRQAQVLLSGGEILQETRRYDEAANKTVLMRVKEGSDDYRYFPEPDLVALHI
FT                   DDEWKARIRSEIPELPDARKKRYVEELGLPAYDAMVLTLTKEMSDFFEETIAKGADPKL
FT                   ASNWLMGEVSGYLNAEQKELDEVALTPDGLAKMIQLIEKGTISSKIAKKVFKDLIEKGG
FT                   DPEEIVKAKGLVQISDEGELRKYVVEVLDNNQQSIDDFKNGKDRAIGFLVGQIMKATKG
FT                   KANPPMVNKLLLEEINKR"
FT   CDS_pept        complement(721433..722650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0668"
FT                   /product="transposase (01)"
FT                   /note="BH0668"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04387"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04387"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWR0"
FT                   /protein_id="BAB04387.1"
FT                   /translation="MNFTMDLPGLKGVKVTKMEEREGFIALHVEMPRTPHRCPSCGERT
FT                   ERTHDYRIQKVQHLKLFERWVYLFYRKRRYACRCGKRFAEKACFVERYQRQTVEWNQAF
FT                   RLRLIQGKNFTDTANQFQTSVTTAMRRFDQLAAPLVKKVDHLPPRIAIDDYKGDTNAGK
FT                   YQVIIADADTRKPLDILPDRKADTLKRYLQEKGHHVKTVVMDLSYTFKSAVQKALGHPL
FT                   IIGDPFHFCRYIYWALEGVRRRVQKAFHPYHRKRCKRIKHLFQKEREGLDDKQKKKVER
FT                   YLELSPDLREAYELKEHFRQWYQEAKMQGREGRMSEVKQGLYAFYRRVEASPLKEFHRA
FT                   IQTLKNWQTEILNSFAFGLNNGFIEGLNNQTKVIKRNAFGFRRYDRLRSRILLHHQFKH
FT                   QTFGVG"
FT   CDS_pept        722795..723013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0669"
FT                   /note="BH0669"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04388"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04388"
FT                   /db_xref="GOA:Q9KF28"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF28"
FT                   /protein_id="BAB04388.1"
FT                   /translation="MIFAFLTPVSLSFPVVAIVGAIIGIYRIRKKSKTPLLKMAAFIFV
FT                   LGLMAAILNMVYYGLPIIGDVDMIGQP"
FT   CDS_pept        723143..723622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0670"
FT                   /note="BH0670"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04389"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04389"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF27"
FT                   /protein_id="BAB04389.1"
FT                   /translation="MTKEQAVLSGFSFIGRMARTTNEAEMKGEGVISSQWDAFYKEPFV
FT                   DRIPQQKEEAIIALYTDYESDETGEYTFAIGAKVQDEAEAPEGLSKVTVPEATYVKFTS
FT                   RKGPMDQVVMEAWQEIWEWSKANPNKRAFIADFEVYDERAQDPQNGQVDIYISVV"
FT   CDS_pept        723938..725212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0671"
FT                   /note="BH0671"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04390"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04390"
FT                   /db_xref="GOA:Q9KF26"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF26"
FT                   /protein_id="BAB04390.1"
FT                   /translation="MTKHWDVVIVGGGLAGYVAALFLAKANVSVLLVEKGKRVGGRART
FT                   DVIKEHYFNLGPHALYKQGKAKPILDELGVMIQGNSPKLGGLLIEGDKDHIAPFSPIGI
FT                   ATTTFLNWRERKEWLAFMAKLPTIRLESIDDEETFQQWLMRNTTSRKVQSLVYALARLS
FT                   TYCHAPEYVSAKVVVAHLKASTGGVLYLDGGWQSMIDQLHNQAVVAGVHIRTQAQVKQI
FT                   VAEKDRLFTLTLANGEAITSKKVVYTANPKELPDMLQGETLEPTFFDRLRPVTGAALDV
FT                   ALTTLPNPKRLFALGTDQPLYYSVHSNYAKLSKTRESVVLHVFKYSHPDELIDRDEVKA
FT                   ELEQFLERVQPGWRSHLITRRCLPHITVNHRLPQVGDEKELTQLETSVSGLYLAGDWAS
FT                   PDSVLADAAVSSGKRVALEITEKER"
FT   CDS_pept        725217..726074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0672"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /note="BH0672"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04391"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04391"
FT                   /db_xref="GOA:Q9KF25"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF25"
FT                   /protein_id="BAB04391.1"
FT                   /translation="MQISNEDYEQLKPLLFSLGYRLLGSVTDAEDLVQETFLRAYQAEE
FT                   REINNKKAYLCKMMTNRCLDVLKSARRKREQYVGPWLPEPLLITSDDPSEAILQKEGLS
FT                   MAYLRMMEHLTPHERAVFLLREVFTFSYREIASMMEKKEDNCRKLYSRAKEKLSAVKGE
FT                   SLHYENNRSVVDRFIHSFQTEDQGDLLELLSDHVTLYTDGGGKVRAALRPIYTKDHVAA
FT                   FLFGIAKKRPNDFYVEVKNVNGQPALISYADSKLYNVICFYIVGGQIQDIYIIMNPEKL
FT                   PSNG"
FT   CDS_pept        complement(726116..727474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0673"
FT                   /product="PTS system, n-acetylglucosamine-specific enzyme
FT                   II, ABC component (EIIABC-Nag)"
FT                   /note="BH0673"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04392"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04392"
FT                   /db_xref="GOA:Q9KF24"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF24"
FT                   /protein_id="BAB04392.1"
FT                   /translation="MLQFLQRIGRSLLLPIAALPVAGLLLRLGQEDLLNIPFMAAAGDA
FT                   LFSNLALLFAIGVAVGFAKDSHGAAALAGAIGFFVLTEGTQAINETINMGVLGGILSGV
FT                   VAGMTYNRFKETKLPEWLAFFGGRRFVPIMTGLFMLVLAIFFGFVWPTVQGWLDSFGQW
FT                   IIGAGATGVGVYGFFNRLLIPLGLHHVINTLVWFVFGEFNGATGDLHRFFAGDPNAGIF
FT                   MAGFFPIMMFGLPAAALAMILAAKKEKRKATAGLLGGVAFTAFLTGITEPIEFTFMFLS
FT                   PLLYGVHAVLTGTAMAVAYTLEIRHGFTFSAGAIDYFINFGIATKPWLLAFVGLIYAVI
FT                   YFVLFYFLIIKLNLQTPGREKEESMDETETSSADYEEMAKAILAALGGKKNVKDLDFCV
FT                   TRLRLTIHSWLAVDEKALRLAGAKGVVKLNDTTIQVVIGTDVEFVANAMKKRL"
FT   CDS_pept        complement(727569..728825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0674"
FT                   /note="BH0674"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04393"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04393"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF23"
FT                   /protein_id="BAB04393.1"
FT                   /translation="MKRTMALLLAVTLLFGLVSVAHGAGKGKKKGNPHAFSLGVEQLLQ
FT                   NEFHLIEGKKVGLITNPTGVDRELHSIVDVLFEDERVELTALYGPEHGVRGDAQAGEYV
FT                   PFYIDDKTGLPVYSLYGQTRKPTPDMLEDIDVLLFDIQDVGTRFYTYIYTMAYAMEAAA
FT                   ENDLPFIVLDRPNPLGGQKVEGPMLEEPYRSFVGLYPIPLRHGMTVGELALLFNEEFAI
FT                   GADVTVVEMTGWKRHTDFKDLPLEWVLPSPNMPTLDTALVYPGAALIEGTNVSEGRGTT
FT                   KPFELIGAPFVNSTELAATLNDLGLPGVTFRAASFTPMFSKHAGTLSHGIQIHVTDEKS
FT                   FQPVITGLHIVKTIHDLYPDDFRFTAEDQQGISFFDRLIGNGDVRKQIMQGASVEEIVA
FT                   DWGKEIKAFEKTRKKYLLY"
FT   CDS_pept        complement(728850..730910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0675"
FT                   /product="beta-hexosamidase A precursor"
FT                   /note="BH0675"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04394"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04394"
FT                   /db_xref="GOA:Q9KF22"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF22"
FT                   /protein_id="BAB04394.1"
FT                   /translation="MKFGLALSLIIAITMCFAPSSVVEAKRSSSFLLLENVPGFLPSPS
FT                   GDSIRFTPLTIEDGALVKTYQEVSWRSSNRKVATVDNKGTVTLTGKPGRTFIHATHGSS
FT                   SDRIAIHVTPKKGVTLIQEKGPQYDVIETLLDQMTLEEKIGQMMMPDFRTWNGQNVVEM
FT                   LPEIEQMVKEYHLGGVILFRENVVETEQIIHLVNDYQDAAEKLGLLITIDQEGGIVTRL
FT                   QNGTDLPGNMALGATRSEGLASQAGTVIGRELQSLGINMNLAPVLDVNNNPDNPVIGVR
FT                   SFSENPELVGQLGVAYTKGLQSTGVAATAKHFPGHGDTDVDSHLGLPEVPHDRARLDEV
FT                   ELAPFRQAMAEGIDAIMTAHVTFPAIDDTKVISEKDGSLISLPATLSEKVLTDLMRDDL
FT                   GFEGVIITDAMNMNAISDHFGPTDAVIRSINAGADIILMPVGLQTVFPAVVEAVENGEI
FT                   SEERVNEAVKRILTLKLNRGILKTDSSTSIDEQIAEAERVIGSDDHRQIEQQIAEQSIT
FT                   VIKNEQDTLPLSVEEDDYVVVVGSTYSENLAAAFEDASVQTEHILLSSNQSSLTAEQQD
FT                   LVEGASAIIIASHSANIAGRSPSHPHMQLYVSLSESADQPVVAVAIRNPYDIMAYPSVP
FT                   AYIAQYGFRDASFRASVRTIVGDLTPSGQLPVTIPTIEGDVMFEYGHGLSW"
FT   CDS_pept        731204..732091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0676"
FT                   /note="BH0676"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04395"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04395"
FT                   /db_xref="GOA:Q9KF21"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF21"
FT                   /protein_id="BAB04395.1"
FT                   /translation="MKTARLIYNPTSGREQIRKSLAYILERLELAGYETSTHATTGEGS
FT                   ATEAARLAGERRHDLVIAAGGDGTIYEVVNGLAGLEKRPTLGLIPAGTTNDFARALNIP
FT                   RDIEKACDILIEGHTKPVDVGKAGDHYFINIAAGGTLTELTYEVPSKLKTVVGQLAYYI
FT                   KGLEKLPQISPTDVRIEYDGKLFEGEIMMFLVSNTNSVGGFERLAPNASLRDGMFDFII
FT                   VKKTSFPEFLHLAGLALRGEHIKHPKVLYVQANRIKVQAEKSMQLNFDGEYGGLLPAEF
FT                   VNLYQHFQMLCPKD"
FT   CDS_pept        732200..732769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0677"
FT                   /note="BH0677"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04396"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04396"
FT                   /db_xref="GOA:Q9KF20"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018656"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF20"
FT                   /protein_id="BAB04396.1"
FT                   /translation="MQLNRLVHFHKTLGDKTRIRIIALLKGGPLHGQAIAGKLGLTPPT
FT                   ISHHLSKLREIDVVYQRREKNTIYFYLDEKKLERMAGAILMIGGDEMFNFQVDDQEKVR
FT                   VIKNFTLPDGRVKTLPAQRKKKLIILEYMLRGIEQGRVYSEKEINEHIRQFHEDFATVR
FT                   REFVMCQFMFRKNGQYELNPKEMWPL"
FT   CDS_pept        complement(732924..733664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0678"
FT                   /note="BH0678"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04397"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04397"
FT                   /db_xref="InterPro:IPR032693"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF19"
FT                   /protein_id="BAB04397.1"
FT                   /translation="MKYLIMVAVAILLVACGQTEEEQGAVDHIEQLSPIEVELLYEEAL
FT                   ASGENMTFDVLVTQNEAPVEDAREVIVEFWQEGAKEESDMIESTNEGGGVYRVTYEFPE
FT                   DGLYFVQPHVTARDMHRMPLYELTIGEEAADQEKQSFVEYESEIIDLSLFAEDSIQAGE
FT                   ETTLLIVVEHKDKPFTGGVLTLEVWQHEDEAHTWLDTEETDVGQYEVSHTFADAGEYHV
FT                   VFHIEDDTGLHEHIHEALIVDENT"
FT   CDS_pept        733905..734378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0679"
FT                   /note="BH0679"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04398"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04398"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF18"
FT                   /protein_id="BAB04398.1"
FT                   /translation="MGVTYQVEMNAAIETVFRYVSEEDLMREWQCGFMENIYFHKLEGM
FT                   KRKGATFVQRIHNGRKVEEYAGEIIAFHRPSFYGVRLESDYLTMEIFYRLIETEAGGTI
FT                   VHFECIPTFNNWYTKAIRPFLHQSLRTMGRKQLEALKACLEQQWQGMPLESRV"
FT   CDS_pept        complement(734727..735083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0680"
FT                   /note="BH0680"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04399"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04399"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF17"
FT                   /protein_id="BAB04399.1"
FT                   /translation="MPERVTATEAALLLIDKLKQSHGPLMFHQSGGCCDGSSPMCYPEG
FT                   ELRTGANDVLLGKIGGVPFYIAKDQYEYWKHTQLIIDVVDGRGGMFSLEGPEGKRFLTR
FT                   SRVFTESERKALGI"
FT   CDS_pept        complement(735096..736616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldA"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="BH0681"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04400"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04400"
FT                   /db_xref="GOA:Q9KF16"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF16"
FT                   /protein_id="BAB04400.1"
FT                   /translation="MVYKRPNEEGAVVSFKKRYDNYVNGEWTPPVKGQYFENVTPVTGE
FT                   VFCEVARSTAEDIDLALDAAHAAKEQWGKTSPAERANLLNKIADRMEENLEKLAVAETW
FT                   ENGKPVRETLNADIPLAIDHFRYFAGAIRAQEGTLSQIDNDTVAYHFHEPLGVVGQIIP
FT                   WNFPILMATWKLAPALAAGNCVILKPAEQTPASIFVLLELIEDLLPKGVVNIVNGFGVE
FT                   AGKPLASSSRVAKVAFTGETTTGRLIMQYASENLIPVTLELGGKSPNIFFDDVMAKDDA
FT                   FLNKAIEGFVLFALNQGEVCTCPSRALIQESIYDTFMERALARVQAIKQGNPLDPNTMI
FT                   GAQASQEQLEKILSYLAIGKEEGAEVLAGGERNHLPGELANGYYVSPTVFKGTNDMRVF
FT                   QEEIFGPVVSVTTFKDAEEALAIANDTLYGLGAGVWTRDMNKAYRFGREIQAGRVWTNC
FT                   YHAYPAHAAFGGYKKSGIGRETHLMMLSHYQQTKNLLVSYSEDALGFF"
FT   CDS_pept        737094..738662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0682"
FT                   /product="cassette chromosome recombinase B1"
FT                   /note="BH0682"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04401"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04401"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF15"
FT                   /protein_id="BAB04401.1"
FT                   /translation="MFKYYNMDQVILPLDLEVKLQEKDIAYTVNDLVEQIPDEAFASFL
FT                   RETGSPAYHPRMMMKVILCAYTQSVFSGRKMEALLKDSIRMMWLAQGYEPSYRTINRFR
FT                   VHEDVKELLRQCFVQFRCQLVQEKLIEEEAIFIDGTKIEANANKFTFVWRKATEKYSAA
FT                   LVEKSNQMYDELLEKEIIPVLEREDQEELSPKELHEVVQKLDEKVEELDKKIKESAEVE
FT                   ERKQLRSERKRPKQYLKPFKDFLARKQKYQNDMSLFGERNSYSKTDPDATFMRMKDDYM
FT                   KNGQLKAGYNVQIATEGQYTLAFDVFANPTDTRTLIPFLDKIEEHFFKLPQYIVADAGY
FT                   GSEQNYEDVMNRECTPLITYNMYRKEKKKRYKNNDFNSANWEYDEETDSFTCPNGKKLT
FT                   FRYLSNRKDKSGFTRAFKVYESEDCSGCPFRSQCTKAKEGHNRKIHYNEKWEQQKESIR
FT                   QKLSEEKTGELYGKRKIDVEPVFGFLKANLGFTRKSVRGKEKVKNELGFAFMAVNLRKY
FT                   TAMSS"
FT   CDS_pept        complement(738775..739767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lplA"
FT                   /product="lipoate-protein ligase"
FT                   /EC_number="6.3.4.-"
FT                   /note="BH0683"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04402"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04402"
FT                   /db_xref="GOA:Q9KF14"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF14"
FT                   /protein_id="BAB04402.1"
FT                   /translation="MLFIDNQGITDPRINLAIEEYALKNLDINETYLLFYINEPSIIIG
FT                   RNQNTIEEINTEYVESNGIHVVRRLSGGGAVYHDHGNLNFSFITKDDGESFSNFQKFTD
FT                   PVIKALAKLGVTAELKGRNDIIASDGRKISGNAQFSTKGRMFSHGTLLFDSEIDHVVSA
FT                   LNVSKDKIESKGIKSIRSRVANISEFLTEKISIDQFRSLLLESIFDGQANIQEYKLTAD
FT                   DWAEIHELSKERYQNWDWNYGKSPAFNLQHSHRFPVGNIDIRLEVKGGTIQQCKIFGDF
FT                   FGTGDVRDLEDRLVGIRYERADIEQALADVDVKTYFGQVEKDDILNLFY"
FT   CDS_pept        740001..741119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alp"
FT                   /product="prepro-alkaline protease"
FT                   /note="BH0684"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04403"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04403"
FT                   /db_xref="GOA:Q9KF13"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034202"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF13"
FT                   /protein_id="BAB04403.1"
FT                   /translation="MKRRVHVLIMTILMIVLATGTAFADNREDTEDTEEYLVGFKNEAA
FT                   VQAFSNNVTTSAVEVQHEYENLPVIVSELSTEVAQLLENDPSVEFIEKNERVYLDPLVM
FT                   NNIQETDIPKLEERMKRGDGVKIAVLDTGIASHDDLHVIDGVSFVSVEPFYRDLNGHGT
FT                   HVAGTIAAQENDEASTGIAPNVELYAVKVLNGLGAGSIASITNGVDWAISNDMDIINMS
FT                   LGTNTDSEALQRAVERAHDHGILIIAAAGNSGEADKQHTIDYPARYDSVVAVGAVDGNN
FT                   ERASFSSYGEQLEIMAPGVEIHSTFLFNRYERLSGTSMASPHVTGAAALIKSNNPELTN
FT                   EQIRKRLNTTATPLGNPFYYGHGLLNVDAALD"
FT   CDS_pept        complement(741165..741479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0685"
FT                   /product="chaperonin"
FT                   /note="BH0685"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04404"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04404"
FT                   /db_xref="GOA:Q9KF12"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF12"
FT                   /protein_id="BAB04404.1"
FT                   /translation="MAWVILIAAGLCEMVGVLMINQLHRSRSWKAYAGMIIGFGLSFWL
FT                   LAMAMQSLSMGTAYAVWTGIGASGGALLGMLFYDEPRQTLRIICIALILAATIGLKFIG
FT                   "
FT   CDS_pept        complement(741480..741824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0686"
FT                   /product="chaperonin"
FT                   /note="BH0686"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04405"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04405"
FT                   /db_xref="GOA:Q9KF11"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF11"
FT                   /protein_id="BAB04405.1"
FT                   /translation="MNKQWLMVVTAAVFEVGWVIGLKHADHPLEWGGTALAIVISLSLM
FT                   ILAAKQLPVGTVYAVFVGLGTAGTVCAEAVLFAEPLSPMKLLLIVLLLAGVIGLKLASG
FT                   QSSSQQKEVG"
FT   CDS_pept        742108..743484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0687"
FT                   /product="RNA methyltransferase"
FT                   /note="BH0687"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04406"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04406"
FT                   /db_xref="GOA:Q9KF10"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KF10"
FT                   /protein_id="BAB04406.1"
FT                   /translation="MSKQQAPVNKNDVVEVTIEDLTHDGAGVAKVDGYALFIPKALPGE
FT                   RLKAKVVKVKKGYGFGRVLNMIEASPDRVEAPCPVFNQCGGCQLQHMSYDAQLRYKQKQ
FT                   VQDVLERIGKITAVTVRPTIGMNEPWRYRNKAQVPVGEREGGLIAGFYQERSHRIIDMD
FT                   ECMIQHEENDKVIRQVKELARELGIRGYDEEKHRGTLRHVVARYGKNTGEIMVVLITRG
FT                   EELPHKKTLIERIHKAIPHVKSIVQNVNPKRTNVIFGDKTKVLWGEEYIYDTIGDIKFA
FT                   ISARSFYQVNPEQTKVLYDQALEFANLTGSETVIDAYCGIGTISLFLAQQAKHVYGVEI
FT                   VPEAISDAKRNARLNGFANVQFAVGDAEKVMPWWYAQGVRADVIVVDPPRKGCDEALLK
FT                   TILNMKPDRVVYVSCNPATLARDLRVLEDGGYETKDVQPVDMFPWTTHIESVAVLELKN
FT                   "
FT   CDS_pept        744034..744318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0688"
FT                   /product="transposase (05)"
FT                   /note="BH0688"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04407"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04407"
FT                   /db_xref="GOA:Q9JWP9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWP9"
FT                   /protein_id="BAB04407.1"
FT                   /translation="MTKRPRRSYTKEFKDQIVQLHVSGKPRAEIIKEYELTPSAFDKWV
FT                   RQHQNSGSFEEKDNRTPEQEELIRLRKENQKLAMENDILKQAALIMGRK"
FT   CDS_pept        744360..745145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0689"
FT                   /product="transposase (06)"
FT                   /note="BH0689"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04408"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04408"
FT                   /db_xref="GOA:Q9JWR5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JWR5"
FT                   /protein_id="BAB04408.1"
FT                   /translation="MCDVLQMARSTYYYEAKIRDDQDEELSELIVDIFKNSRDNYGQRK
FT                   IKIELRKKGWTVSRRRIGRIMKEQGLVSKYTVAQFKPAKTSCNESEIGNTLNREFNQEQ
FT                   ELKVVVSDLTYVRVQQKWHYICVLVDLYNREIIGYSAGPHKSAELVQRAFASVKYNLQR
FT                   LELFHTDRGSEFKNKLIDQALETFGIERSLSEKGTPYDNAVAEATFKTIKTEFVRGAVF
FT                   SSQQELDLELFDYVHWFNTIRIHGSLDYLTPTEYKLMNL"
FT   CDS_pept        745393..746271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0690"
FT                   /product="transposase (04)"
FT                   /note="BH0690"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04409"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04409"
FT                   /db_xref="GOA:Q9KF09"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF09"
FT                   /protein_id="BAB04409.1"
FT                   /translation="MYQKGVSTREIGHFIEKILGHSYSASTISQVTDVVTEDITQWQQR
FT                   PLKKRYSVLYLDGTYLKLRREDVANEVVYLVVGVTEEGYREILGFYVGGQESANGWRNI
FT                   LLDLYSRGLEEVLLGVFDGLAGLEEAMKAVYPKADVQRCVVHKVRNALHAVRKKDQPAV
FT                   AQDFKPIYQANTYEEAKNRFKEFKENWQKRYPKVVATWEKDLDVLLTFLSYPSTIRPMI
FT                   YTTNIIERTMKEIKKRTKTMNSLPNEKAAEKIVYLQAIDYNERWATRRLRGFGEAYEAL
FT                   QEMFKQRYSGP"
FT   CDS_pept        complement(746734..747849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0691"
FT                   /product="transposase (15)"
FT                   /note="BH0691"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04410"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04410"
FT                   /db_xref="GOA:Q9KF08"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025399"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF08"
FT                   /protein_id="BAB04410.1"
FT                   /translation="MDKITRKTSFGQWFSPINLQLFEEQVKTMKLDRYTKKLTTESFLK
FT                   LLLFAQLHEVESLHALRDCLFDDQLQKGVDLDSISISQLSRRLNGMNPDVFQRLFLDLV
FT                   SQIHAKTHDSQRVMPLKIIDSSTLPLNLTNHKWAQFRKTKAGVKLHLRLVFIEKGIFYP
FT                   EKAVLTTAKEHDRGQLEIMVDDKECMYVFDRGYLDYERFDRMTDDGYFFLSRLRKNAVI
FT                   RAVYDFKRSENSTVLSDQMVLIGTTQNRTENYFRLLRVMDSKGNELQLLTNRFDLSAED
FT                   ISEMYKSRWAIELFFKWMKQHLNIKKFYGQSEWAIQNQVFIALIVFCLHVLVQIETNSR
FT                   RKTLQISRYLRAALWKPAHIWLRKMEGKVVP"
FT   CDS_pept        748063..748341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0692"
FT                   /note="BH0692"
FT                   /note="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04411"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04411"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF07"
FT                   /protein_id="BAB04411.1"
FT                   /translation="MIVKSFDPMNIVSFEERLLHKNFIKVSINNEDYLVRQPAIALCKS
FT                   GLHNIKKLHIILNNEPIERKDSIIIDGIGVLKGRYMKKENVMHLYVD"
FT   CDS_pept        complement(748482..749252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0693"
FT                   /note="BH0693"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04412"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04412"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR018911"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF06"
FT                   /protein_id="BAB04412.1"
FT                   /translation="MPVVRQSHVVYTVQPGDTLSAIAARFGSTVLEIQRANLQDPRFIE
FT                   PNVIFPGWTLVIPVPTVRPFDTTYLPVPGDTLFRISQRFSAHFDLIAGVNRLQDPNLIF
FT                   VGQLLWVPAFVYEIEVGDTLFGISRRFQIPITKILAANEGRPGFSLDFIFVGFRLLLPL
FT                   PSSRNIVVTHPFPGDIMPSRELVEGFARVFEANVLMQIRDDNGVIVSAERFTTALEGPP
FT                   AYGYFSGTVLIDRPPTSPSGQLWVYSAVQSMAVL"
FT   CDS_pept        750012..750341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0694"
FT                   /product="transcriptional regulator (ArsR family)"
FT                   /note="BH0694"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04413"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04413"
FT                   /db_xref="GOA:Q9KF05"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF05"
FT                   /protein_id="BAB04413.1"
FT                   /translation="MDTKTFSALAEQNRLRIVELLRDGPLPVGEIANRVGLRQPQASKH
FT                   LRVLLEAGLVEVKVEANRRIYTLRQEPFQALHEWLETYNTIWNERFNSLDRYLQELQTK
FT                   KQKDT"
FT   CDS_pept        750369..750878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0695"
FT                   /note="BH0695"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04414"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04414"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF04"
FT                   /protein_id="BAB04414.1"
FT                   /translation="MANSMIFKAEGNQLIAERVFDAPRELVFKMFTEAEHLKNWWGPRG
FT                   WDLTVCNIDFRPGGSWHFCMKCVDENQGDFYGYESWGKALYREIVDGEKIVYVDYFSDS
FT                   EGNLSEEMPAAEITLTFIDLGGKTKIVNQVEYPSAEELQKGLDMGMEQGFTETWDRLVE
FT                   YLQDIQ"
FT   CDS_pept        751087..753465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apr"
FT                   /product="prepro-alkaline protease"
FT                   /note="BH0696"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04415"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04415"
FT                   /db_xref="GOA:Q9KF03"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR034202"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF03"
FT                   /protein_id="BAB04415.1"
FT                   /translation="MNKRLKRWSAIMSIVLLVNLLVPVGTFADTDEEEKVDIIVTYKDV
FT                   VSESPDSRLSVYENEQTMKTLPIKTMTVPVSEVERLKEDPNVVSVSLDQPLQLMSDTRE
FT                   LGEHDWNNDMVKAFDAWDDGYTGKGVKVAVFDTGFDGHQDITYAGGHSVFEGEPYTHDH
FT                   HGHGTHVAGIIGAREGTLHQGIAPDVQLYGVKVFSQEKGGNTSDLIAGIDWAIQEGMDI
FT                   INMSLGYTNEVPAVHTAIKQAVAQEILVVAASGNGGKADGSGETIEYPAKYDEVIAVAS
FT                   VDKEMKRTNTSATGVENELAAPGHLIGGLAPGNKYVFMSGTSQATPHVTSLAAILMGKH
FT                   PELSSQQIRALLVEQSLDLGSEGHDRLYGYGLAQYVSSTPPDEEENEESPAENPQEQPS
FT                   DGKENEGSEDQGSTPPDEEENEESPAEDPQEQPSDGKENKGSENQGSTPPDEEENEESP
FT                   AEVPQEQPSDGKENEGSEDQGSTPPDEEENEESPAEDPQEQPSDGKENEESKNPDSAPP
FT                   AGEKEGKQTARVQVKPVNLGGVAIVSNADVASVLDNGTLVVFFDSALDDLTRLALTADQ
FT                   VKELKDRGITLVIAKHDLELVIPHGVFKAGDVVIEFERVVGKGIPYAGQAKSTVYQFKI
FT                   IQNGQQVRHFDEEIEMGFRVDQEKNVNNLKIYYWNESLNEWEKIGGNYQEGFIVARTNH
FT                   FSTYTVFDSAVFEETKSGTPISGGKTNGNSTTEGTTNRGTSKNGTGSEPQAEESNEQNN
FT                   KDGTLPKTATNLYNSLAIGALLLLIGFVLLRKSKRRIVE"
FT   CDS_pept        753625..754323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0697"
FT                   /note="BH0697"
FT                   /note="unknown conserved protein in B. subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04416"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04416"
FT                   /db_xref="GOA:Q9KF02"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF02"
FT                   /protein_id="BAB04416.1"
FT                   /translation="MKQIIALGGGGFSMEPENPLLDTYILDQCTKANPKICFIPTASGD
FT                   SEHYITKFYDFFGKQDCQPSHLSLFRPPTRDLESYLLDKEILYVGGGNTKNLLILWKEW
FT                   GLDSILRKAWKEGILLAGISAGSICWFEEGVTDSYGDGLEPIKCLGFLKGSHCPHYDGE
FT                   TERRPSYHRLVTSNEIQGGIAADDGVAIHYIGEDIHKIVSSRPRAKAYRLQQFDHKMIE
FT                   TELETVFLGA"
FT   CDS_pept        complement(754537..755574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0698"
FT                   /product="pectate lyase"
FT                   /note="BH0698"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04417"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04417"
FT                   /db_xref="GOA:Q9KF01"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF01"
FT                   /protein_id="BAB04417.1"
FT                   /translation="MVEMKKIVSYLFIFVLMLGTAPNAASANSYSFKSTTGWASINADG
FT                   VNGTTGGSGGTEVTVTNAADLERYATANGKYIIKVSGSINLSPKGKYIDVSSNKTIVGL
FT                   NASSEIINGGLKIRGSNVIVKNLTIRGTYVEGDWDGKTNDYDGIQITGKDAHHIWIDHV
FT                   TMRKHGDGLIDIVNGANYVTISNSRFEQHNKSITISGNDNDTNTDKYKVTIQDCWFRGT
FT                   TQRNPRVRFGMVHLYNNYYSDMGKYGRDMGYSSSLGYAIGVGVSAKIYSENNYFENLRH
FT                   PTSFIDTTSKPGYIRDSGSYFVNSGSMTTRASGVTWKPSDYYSYTLRNASQVRSHVINN
FT                   AGAGK"
FT   CDS_pept        756124..756696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0699"
FT                   /product="ribosomal-protein-alanine N-acetyltransferase"
FT                   /note="BH0699"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04418"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04418"
FT                   /db_xref="GOA:Q9KF00"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KF00"
FT                   /protein_id="BAB04418.1"
FT                   /translation="MTGHVKRFPILETKRLILRKITTDDARSILSYLSDKEVMKYFGLE
FT                   PFQTLEDALGEIAWYESILHEQTGIRWGITLKGQDEVIGSCGFHQWVPKHHRAEIGFEL
FT                   SKLYWGQGIASEAIRAVIQYGFEHLELQRIQALIEPPNIPSQRLVEKQGFISEGLLRSY
FT                   EYTCGKFDDLYMYSLLKRDFDKIHRSL"
FT   CDS_pept        complement(756753..757919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0700"
FT                   /product="transcriptional repressor of the xylose operon"
FT                   /note="BH0700"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04419"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04419"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KEZ9"
FT                   /protein_id="BAB04419.1"
FT                   /translation="MDTRGATFIKKMNRRAILEKIIEKQEISRSDLSKITNLNKVTVSS
FT                   QVASLLEEHLIIEKQYAESSGGRKPILLTLNENAAFTLGIDLDIKTLTFMLCNLKGAVI
FT                   KKEQWKLANVDFDDVVNEMISLIQSFLKDIPASKYGVVGIGIGIHGIVDNDETIAFTPG
FT                   HHWSNVNVKQPIEQAVNIPVVVENSTNLCALAENVVSDHEADNLLCISSFSGVGMGLIV
FT                   HNAIYKGFHGYAGEVGHMIIVPEGKPCRCGNKGCWELYASEKALYQEISESTKREHVDR
FT                   DVVLALIEAGDEETLKKLDQFIYYFSLGLNNIINSYNPETIVISSGLMPHLPNIEHKIQ
FT                   SHLHSKISHYKTLKISNLGKEACALGACFIGIKQFLEINTLKLSATKT"
FT   CDS_pept        758153..759178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0701"
FT                   /product="C4-dicarboxylate transport system
FT                   (C4-dicarboxylate-binding protein)"
FT                   /note="BH0701"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04420"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04420"
FT                   /db_xref="GOA:Q9KEZ8"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KEZ8"
FT                   /protein_id="BAB04420.1"
FT                   /translation="MKHFIVALMISSFLVVVAACGSNESSTDTPRESGNGEAKEHNLTL
FT                   AHNLSEDHPVHLGLARFAELVEERSEGQITMEIFPNGVLGDEREVLEQVQAGGVDITKV
FT                   SAAALENFSSQYAVFSLPYVFADEEHFFQSMESEAVAQLFDETEADGFVGLTWYDSGAR
FT                   SFYTVDQPIMHPDDLKGLRIRVMDSQTQIEMMEALGGAPTPMPYGEIYTALQSGVVDGA
FT                   ESNPTALTTGKHGEVAKAFSFDEHARIPDIAVISSAVWNEFTDEQRQFVRDAAKESTEY
FT                   QKDIWAEAVEEAIEEAEAMGVEFHYPDQEPFYQAVQPLHEKYREDEKIAELLDAFDQMR
FT                   Q"
FT   CDS_pept        759320..759853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0702"
FT                   /product="C4-dicarboxylate transport system (permease small
FT                   protein)"
FT                   /note="BH0702"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04421"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04421"
FT                   /db_xref="GOA:Q9KEZ7"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KEZ7"
FT                   /protein_id="BAB04421.1"
FT                   /translation="MLTVLKKIKTVMNRVIMIVASILTIVLVLGALWQVFSRYVLNDPS
FT                   TFTEELLRFLLIWVAMLGTTYAFGSNEHLAIIYLKNKLRDEQRKYLQLFIDFTIIFFAG
FT                   LILIKGGYSLSTSTLNQLSPILRIPMGYIYAILPISGTFIVFYQIINMFERREQTELAQ
FT                   QVVTPSVSPHTRKE"
FT   CDS_pept        759865..761169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0703"
FT                   /product="C4-dicarboxylate transport system (permease large
FT                   protein)"
FT                   /note="BH0703"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04422"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04422"
FT                   /db_xref="GOA:Q9KEZ6"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KEZ6"
FT                   /protein_id="BAB04422.1"
FT                   /translation="MELATQAAFLLFGVFFLLLAIGVPISISIGLASLGAVILVMPLET
FT                   IVFTAAQRMVGGINSFALLAVIFFILSGSIMNNGGIALRLINLAKLIAGRLPGSLAHTN
FT                   VVGNMLFGSISGSAVASAAAIGSVMAPLQAKEGYNKAYSAAVNIASAPVGLLIPPSGVL
FT                   IIYSLVSGGTSISALFMAGYLPGILMGLAVMVVAFFMAKKNDYTVSEKVSGKEAIKIIW
FT                   QAIPSLLLVVVVIGGIVGGVFTATEGAAVAVLYSLALSLIYRSLTWAHFPKILKETIVM
FT                   TGIVLFLVGASSIMSWAMAVTGLPAAISQAILSISDHTVVVLLIMMLTLLVIGTFMDLT
FT                   PAVLIFTPIFLPIALQMGIDPVHFGIMLVFNLAIGIMTPPVGSCLFVGCSVGNVSIEEV
FT                   IKPLLLFFVALVAALFIVVYVPAISLFLPELLGLL"
FT   CDS_pept        761189..763594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0704"
FT                   /product="glucosidase"
FT                   /note="BH0704"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04423"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04423"
FT                   /db_xref="GOA:Q9KEZ5"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KEZ5"
FT                   /protein_id="BAB04423.1"
FT                   /translation="MQKGKRTFSIQTIGEEGIHFTNETGTLDVSVFVLEEHLFRVLFRK
FT                   HHTLTVQATWLVAPGMEDIPYEGRDRLDLTPFSLPGFSYERSENEGTVSIHTERLKAYI
FT                   QLEGFKVTWFEKKDGVWTEVAADRNTQAYNFDGSLGRGIFHYMKRGQEDRYYGLGEKTG
FT                   SLNRHGRRYRMMNLDPMGYDPIYTDPLYKHIPFYLTRTKEKSWYGLFYDNTATSTFDMG
FT                   NELDNYHGFYRFYHAEEGDLDYYMIVGADAAEVVETFSWLTGKTTMLPKWSLGYSGSTM
FT                   TYTDAENAQEQLYQFLDDCKTYDIPCDSFQLSSGYTSIGEKRYVFNWNRSKFPDPKQFI
FT                   ADFHEQGIRLCANIKPCLLQDHPLYEQLKEKGMFINDEDGQEEEVVQFLDDVGAYLDFT
FT                   NPETIDWWKRNVTEQLLEFGIDSTWNDNNEYEIWKPDAKAHGFGKPIDIGKIRPIQPLL
FT                   MMKASFEAQLEFDTKKRPYLISRSGCPGMQRYCQTWTGDNRTSWDSLKYNIKTGLGLSL
FT                   SGIYHVGHDVGGFAGEKPDPELFIRWIQNGIFHPRFTIHSWNEDKSVNVPWMYPEIVKP
FT                   ISDLMRFRVTLIPYLYQLMYESYQAYKPIIRPTFYQFPKDERTFTENDDFMVGDHLLVA
FT                   SVVEKGVHQRDVYLPENGKGWYDFHSERTYEGGQTITLPAPFNQTPLLVEAGAIIPIND
FT                   HEVTFETKNEEARGFLCYPHLTEGNEVFRLYEDDGETNDYKDGVYTFVTVKMDCTKEEI
FT                   RVHIEKEGTFPLPYEKVRVYFPKGEQRTIYVNGSEVCTNARQKIEVSI"
FT   CDS_pept        763623..765041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0705"
FT                   /product="uronate isomerase"
FT                   /note="BH0705"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04424"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04424"
FT                   /db_xref="GOA:Q9KEZ4"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KEZ4"
FT                   /protein_id="BAB04424.1"
FT                   /translation="MTNFLSEDFLLMNEYDRELYYTFAKNMPICDYHCHLSPQEIWENK
FT                   PFENMTKAWLGGDHYKWRAMRLNGVREEFITGGAPDKEKFLAWAKTVPKTIGNPLYHWT
FT                   HMELKTYFHFHQPLDETNGENVWDACNRLLQQEAFTPRALIERSNVRAIGTTDDPTDSL
FT                   LYHQKLQADDTFHVKVIPTFRPDGALKIEQDSFADWVAKLSDVTGESLDTLDAFLHALK
FT                   ERLTFFDEHGCRSSDHDMTEVPFVEVNEQEAQHIFRKRLANEGLTKVENEKYKTFLMTW
FT                   LGKEYAARGWVMQWHIGVMRNNNSRMLHKLGPDTGFDSIGDGQIAHATAKLLDLLDKQG
FT                   ALPKTILYCVNPNANYILASMIGNFTESGVRGKVQFGSAWWFNDHIDGMRRQLTDLASV
FT                   GLLSNFIGMLTDSRSFLSYPRHDYFRRILCQLIGSWIKEGQLPPDMERWGQIVQDICYN
FT                   NVVDYFDMKETVRL"
FT   CDS_pept        765038..766075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0706"
FT                   /product="D-mannonate dehydrolase"
FT                   /note="BH0706"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04425"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04425"
FT                   /db_xref="GOA:Q9KEZ3"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9KEZ3"
FT                   /protein_id="BAB04425.1"
FT                   /translation="MRLTMRWFGPSDKVKLEYIKQIPGMKGIVSAIYDVAVGGVWPKEK
FT                   ILALKNNIERHGLTLDVIESVPVHEDIKLGKPTRDRYIENYKQTLRHLAECGIDTVCYN
FT                   FMPVFDWTRSQLDFKLEDGSEALIYEEDVISRTNPLSGELELPGWDTSYENESLKGVLQ
FT                   AYKKISEEDLWDHLTYFVQAIMPVADEVGIKMAIHPDDPPWSIFGLPRIVTNKANLERL
FT                   LSLYDSPNHGITMCSGSLGANEANDLPEMIRHFGGQGRIHFAHARNIKRTGPRSFQESA
FT                   HLSEAGSVNMVAMLKAYHDIGFTGPLRPDHGRMIWGEKGRPGYGLYDRALGATYLNGIW
FT                   EAVSS"
FT   CDS_pept        766116..766970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0707"
FT                   /product="D-mannonate oxidoreductase"
FT                   /note="BH0707"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04426"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04426"
FT                   /db_xref="GOA:Q9KEZ2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KEZ2"
FT                   /protein_id="BAB04426.1"
FT                   /translation="MELSFQVDLTNKVAVVTGGSGVLGREFCLALAKCGAKVAVIGRTD
FT                   DKLKAIVNEIIVNGGEAIAISADVLAKTDMERAREQVRTELGTCDLLINGAGGNHPKGT
FT                   TQLDYLREADLHGIDQDVRTFFDLDADGIRHVFELNFLGTLIPCQVFSQDMLGKEGASI
FT                   VNISSMNAFTPLTRIPAYSGAKAAVSNFTQWLAVHFSKVGIRVNAIAPGFFLTEQNYSL
FT                   LVKDDGTYTDRANKILSQTPAERFGKPEELISTLLWLVDSSTSFVNGVIVPVDGGFSAY
FT                   SGV"
FT   CDS_pept        complement(767141..768250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0708"
FT                   /note="BH0708"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04427"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04427"
FT                   /db_xref="GOA:Q9KEZ1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KEZ1"
FT                   /protein_id="BAB04427.1"
FT                   /translation="MRIIKAGLIGCGNISSIYFENVHRFKHLTIVACADLHLERARAQA
FT                   EKYRIPKACTVAELLEDPEIELVINLTIPQVHAKVCIQALEAGKHVYTEKPLTITLEEG
FT                   QKLLEKAKETGLLVGCAPDTFLGAGIQTSIQVIERGEIGTPVGASAFMIGRGHEHWHPD
FT                   PAFYYDVGGGPMYDMGPYYLTALTALLGPMARVSGSARITYPERTILSEPKKGTKIKVS
FT                   TPTHISGVIDFANGAIASITTSFDAFGGSVLPPIEVYGSEGTLLVPDPNTFDGPVQLRK
FT                   RDEREFVEVPLTYHYTENNRGIGVADMAMSLLTGSDYRASGTMGFHVLEAMHGFHMSST
FT                   SGHHYQMKSTCRKPEPLPVDFRFSYVETT"
FT   CDS_pept        complement(768277..769005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0709"
FT                   /note="BH0709"
FT                   /note="unknown conserved protein in others"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04428"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04428"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KEZ0"
FT                   /protein_id="BAB04428.1"
FT                   /translation="MMPKKALIVWGGWDGHEPEQVAHIFKQTLEEEQFQVEVSNTLESY
FT                   ADAEKLKSLDLIVPHWTMGTIPKEYVHHISEAIQSGVGVAGCHGGMCDAFRNNVDWQFI
FT                   TGGNWVAHPGNDGVDYTVQIKHSSSSLLEGIEDFNVCSEQYYLHVDPAVEVLATTRFPI
FT                   IEGPHSTNKAVDMPVVWTKRWGLGRVFYCSLGHQANIVAMPEVTTIMRRGFLWAAEGKE
FT                   RYSRLYTEKKETYTGMGDSQ"
FT   CDS_pept        complement(769028..770194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0710"
FT                   /note="BH0710"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04429"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04429"
FT                   /db_xref="GOA:Q9KEY9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KEY9"
FT                   /protein_id="BAB04429.1"
FT                   /translation="MESIKVGMIGYKFMGKAHSHAYRDLPMFFPDHLRPEMKVICGRNP
FT                   EGVAQAASQYGWEEYTTNWKDLIRRDDIDLIDINAPSDVHKEITLAAAQAGKHIFCEKP
FT                   LALTLQDSRHMLEAVEAAGVKHMVGFNYRFTPAVLLAKKLIAEGRLGDIYHFRAWFLQD
FT                   WIVAPDFPLVWRLQKDIAGSGAHGDLGAHLIDMAHFLIGDITEVIGMNETFIKERPLPT
FT                   EMTGLSGRGSNDHTVPKGPVTVDDATLFMARFANGALGSFEATRFATGHRSTNSFEING
FT                   SKGSVIFDFERLNELQVYFTDDQDDVQGFRRVLATDGAHAYSDRWWPAGHTIGYEHTFI
FT                   HEIAELMESLQEGRQPVPNFKDGVKCQQVLEAVDLSIAKREWIQVSDL"
FT   CDS_pept        770361..771152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0711"
FT                   /product="transcriptional regulator (AraC/XylS family)"
FT                   /note="BH0711"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04430"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04430"
FT                   /db_xref="GOA:Q9KEY8"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KEY8"
FT                   /protein_id="BAB04430.1"
FT                   /translation="MNIKFCGYSLHAQKFYMEFKTGVPGYLLRLQTEGTCKVKLNEREF
FT                   QLEKGDLLLTNPEDMFELIVEDGDNSGDYHLLCEGDWIDAWWRRSEKPSVSTIDLDENI
FT                   MAIWRCMILEDRRSVSEKNDEILHYLVQTLCLSLERAAMETKSMSSRPYTVTRMMRYIE
FT                   ENAITGIKVEDVAKHAGLSVSRSAHLFKSSVGKTMIEYAHEIKLAVAIDFLKHTTYTLE
FT                   HIAEDCGFGSYSYFHRVFKKHYGISPGDYRSSTKHKTMTLI"
FT   CDS_pept        771475..772398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0712"
FT                   /product="cation efflux system"
FT                   /note="BH0712"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04431"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04431"
FT                   /db_xref="GOA:Q9KEY7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KEY7"
FT                   /protein_id="BAB04431.1"
FT                   /translation="MESRFKEAEFATWVGIIVNGLLALMKGVIGWLSGSRALIADAAHS
FT                   ASDVAGSIAVLAGLRTAKKPPDADHPYGHGKAENVATIIVAILLIVVGVEIAISSTKVF
FT                   VGEMPSAPKGIALVAIIASIIIKEVLFQYKYRLAKKINSSALLAEAWHHRSDALSSIAA
FT                   FIGVFGAMVGQHFNYPILVYLDPVAGLIVSLIVIKIGFSLAKESSSIMMEQVLDPEKTK
FT                   PFIRTVSKIEGVKRIDELLARTHGHYIVVDIKVGVDPNLSVEEGHRISKRVKKALLANH
FT                   NHIKRVFVHINPYQTEGDLNRQERIN"
FT   CDS_pept        complement(772647..774383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0713"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /note="BH0713"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04432"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04432"
FT                   /db_xref="GOA:Q9KEY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KEY6"
FT                   /protein_id="BAB04432.1"
FT                   /translation="MEKQQQTSLKPFFSLILSTNIPKVALTFGLIGSLITTLVGLTIPL
FT                   LTREMVDGFSLESLNTLLIAAIIVVFILQAVLDGLSMYALAYVGQKIVARLRERMWFKL
FT                   LRLPVNYFDKNTSGQTVSRVVNDTGIVKDLISQHFPQFVGGIITIIGAVIILFIMDWKM
FT                   TLLMFIAVPITVAVMVPLGMRMSKISRGLQDETANFTGNVQQTLSEIRLMKASNAEQTE
FT                   EKKGLTGIEKLFSFGLREGKIFALIAPLMYLVVMVVIVIIIGYGGIRVAEGTMTTGSLV
FT                   AFLLYLFQIIFPITSFTMFFTQLQKAKGATERIIEILDIEEENGQQGLEMDISNKAIHV
FT                   KNVSFAYNEEEPVIQKVSFDVEPGTMVAFAGPSGGGKTTMFGLLERFYEPTSGEILIGD
FT                   TSIQELSMYSWRKQIGYVSQDSPMMVGTIRENLCYGLEDRDDIDDDRLWEVAKMAYADQ
FT                   FISEFPKGLDTEVGERGVKLSGGQRQRIAIARAFLRDPKILMMDEATASLDSQSEGIVQ
FT                   QALTRLMEGRTTFVIAHRLSTIVNADKIIFIEKGQITGIGTHQELVQTHDLYREFAEQQ
FT                   LT"
FT   CDS_pept        complement(774623..777085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0714"
FT                   /product="excinuclease ABC (subunit A)"
FT                   /note="BH0714"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04433"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04433"
FT                   /db_xref="GOA:Q9KEY5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KEY5"
FT                   /protein_id="BAB04433.1"
FT                   /translation="MKHDIDIRGAREHNLKNISLKIPKNKLVLLTGPSGSGKSTLALDT
FT                   LQRECQRQYMESMGMTTDAVSKPKVDSIVGLSPSISIGQHITNRNPRSTVGTTTDMYTY
FT                   LRVLYEKLGEQPCPHCDKMVPPRVDKEQYEEDGGFKQLIDCPHCHQRFEKLTRSHFSFN
FT                   KPEGACPTCDGLGNVSELDLTAVFQEEQSLKEDGVAIWKGQYRDYQLAILQAAAEYYDI
FT                   SLDLDSPLKSFNNIQKDLLYYGVESEPFSAHFPNKKPPKTVGQGKFEGIVTGIWRRYKE
FT                   KAGQSGEANLFFTKQCPDCHGERLNKRSRGVLVANTSISRVTKWSLNEILTWLDNLQQR
FT                   YSDESFQVIEPLLHDLKTKLTRIVRVGLGYLSLDRQTITLSGGEAQRLRLATILGSGLT
FT                   GVLYILDEPTAGLHPKDTHGLLQVMKELRDLGNTVLVIEHDEDMMRGADHIIDIGPGAG
FT                   KYGGTVVGQGTVSQLMEQEQSITGNFLKKPPTTFHKKRTGNGNHLTVHHVTKHNLKNIT
FT                   VSFPLGTLISVTGVSGSGKSTLVFDVLAAGFNGAPQGCEKITGFEAIKTLITVDQTPLT
FT                   RMQRSNIATYTDAFTHIRHLFSNLPEAKQKKLKAKDFSFNMQGGRCEHCQGLGFVMTNM
FT                   HFLPDLEVTCPVCKGRRFKDFILDITYNGQTISSILDLTIEESRPLFEHVKKISSIIEL
FT                   LCEVGLGYLSWGQPVTTLSGGEGQRLKLAKELYKQTSNHTLYLLDEPTTGLHPTDVQNL
FT                   LLLLNRLVDAGNTVITVEHTLEVIRASDWVIDIGPGGGEDGGQVVAQGTPEQIVAVKES
FT                   HTGAFLNR"
FT   CDS_pept        complement(777263..778699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="BH0715"
FT                   /note="BH0715"
FT                   /note="unknown conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB04434"
FT                   /db_xref="EnsemblGenomes-Tr:BAB04434"
FT                   /db_xref="GOA:Q9KEY4"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q9KEY4"
FT                   /protein_id="BAB04434.1"
FT                   /translation="MKRLVTCCIILFLLFCLFLPSRESLAKPDIESTLDNYVETFLGTH
FT                   RIPGAAIAIVQDRETIYAKSWGVTGGSEEAVTLETPFLIGSVTKSLTALAIVKLLDENK
FT                   IMLDDPVQAHLPWFTLQDRAAATQITIRHLLAHTSGLSTYTGLAIADQGSADENAIVSH
FT                   VRNLATEELTADPGEQHQYSNANYLILGALVEEVSGQPFSEYMKQQIFSSLGMEHAAAD
FT                   HVTAARNGYLGSYQSWFGFPVKSRVSYDNGGTPYGYIAASAEDIASFIKFLQGNGPNDF
FT                   LTEESLSFYLSPLVQQRENRYYGFGLRLTTFDSGETMIWHSGATPDSRAELFILPEHKW
FT                   GGVILTNKNHRLEEEAVTHLREGIIQILHGEQPLQVPKKLPTIQWIMIGLLFMLLIRFV
FT                   SLLKTMKSNSTRKNISWRIWGLTSILFAILLIPILNYSVHAPWHTITVFTPDVAWLTIF
FT                   TVILLSLNGLTSIYVSLRKG"
FT   CDS_