(data stored in ACNUC7421 zone)

EMBL: BA000012

ID   BA000012; SV 4; circular; genomic DNA; STD; PRO; 7036071 BP.
XX
AC   BA000012; AP002994-AP003014;
XX
PR   Project:PRJNA18;
XX
DT   02-NOV-2004 (Rel. 81, Created)
DT   10-OCT-2016 (Rel. 130, Last updated, Version 6)
XX
DE   Mesorhizobium loti MAFF303099 DNA, complete genome.
XX
KW   .
XX
OS   Mesorhizobium japonicum MAFF 303099
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Phyllobacteriaceae; Mesorhizobium.
XX
RN   [1]
RP   1-7036071
RA   Sato S., Kaneko T.;
RT   ;
RL   Submitted (25-DEC-2000) to the INSDC.
RL   Contact:Shusei Sato Kazusa DNA Research Institute, Department of Plant
RL   Genome Research; 2-6-7 Kazusa-kamatari, Kisarazu, Chiba 292-0812, Japan URL
RL      :http://www.kazusa.or.jp/rhizobase/
XX
RN   [2]
RX   DOI; 10.1093/dnares/7.6.331.
RX   PUBMED; 11214968.
RA   Kaneko T., Nakamura Y., Sato S., Asamizu E., Kato T., Sasamoto S.,
RA   Watanabe A., Idesawa K., Ishikawa A., Kawashima K., Kimura T., Kishida Y.,
RA   Kiyokawa C., Kohara M., Matsumoto M., Matsuno A., Mochizuki Y.,
RA   Nakayama S., Nakazaki N., Shimpo S., Sugimoto M., Takeuchi C., Yamada M.,
RA   Tabata S.;
RT   "Complete genome structure of the nitrogen-fixing symbiotic bacterium
RT   Mesorhizobium loti";
RL   DNA Res. 7(6):331-338(2000).
XX
DR   MD5; b1f539efc43c5ce359fafc43df6b5b91.
DR   BioSample; SAMD00061086.
DR   EnsemblGenomes-Gn; EBG00000034154.
DR   EnsemblGenomes-Gn; EBG00000034155.
DR   EnsemblGenomes-Gn; EBG00000034156.
DR   EnsemblGenomes-Gn; EBG00000034157.
DR   EnsemblGenomes-Gn; EBG00000034158.
DR   EnsemblGenomes-Gn; EBG00000034159.
DR   EnsemblGenomes-Gn; EBG00000034160.
DR   EnsemblGenomes-Gn; EBG00000034161.
DR   EnsemblGenomes-Gn; EBG00000034162.
DR   EnsemblGenomes-Gn; EBG00000034163.
DR   EnsemblGenomes-Gn; EBG00000034164.
DR   EnsemblGenomes-Gn; EBG00000034165.
DR   EnsemblGenomes-Gn; EBG00000034166.
DR   EnsemblGenomes-Gn; EBG00000034167.
DR   EnsemblGenomes-Gn; EBG00000034168.
DR   EnsemblGenomes-Gn; EBG00000034169.
DR   EnsemblGenomes-Gn; EBG00000034170.
DR   EnsemblGenomes-Gn; EBG00000034171.
DR   EnsemblGenomes-Gn; EBG00000034172.
DR   EnsemblGenomes-Gn; EBG00000034173.
DR   EnsemblGenomes-Gn; EBG00000034174.
DR   EnsemblGenomes-Gn; EBG00000034175.
DR   EnsemblGenomes-Gn; EBG00000034176.
DR   EnsemblGenomes-Gn; EBG00000034177.
DR   EnsemblGenomes-Gn; EBG00000034178.
DR   EnsemblGenomes-Gn; EBG00000034179.
DR   EnsemblGenomes-Gn; EBG00000034180.
DR   EnsemblGenomes-Gn; EBG00000034181.
DR   EnsemblGenomes-Gn; EBG00000034182.
DR   EnsemblGenomes-Gn; EBG00000034183.
DR   EnsemblGenomes-Gn; EBG00000034184.
DR   EnsemblGenomes-Gn; EBG00000034185.
DR   EnsemblGenomes-Gn; EBG00000034186.
DR   EnsemblGenomes-Gn; EBG00000034187.
DR   EnsemblGenomes-Gn; EBG00000034188.
DR   EnsemblGenomes-Gn; EBG00000034189.
DR   EnsemblGenomes-Gn; EBG00000034190.
DR   EnsemblGenomes-Gn; EBG00000034191.
DR   EnsemblGenomes-Gn; EBG00000034192.
DR   EnsemblGenomes-Gn; EBG00000034193.
DR   EnsemblGenomes-Gn; EBG00000034194.
DR   EnsemblGenomes-Gn; EBG00000034195.
DR   EnsemblGenomes-Gn; EBG00000034196.
DR   EnsemblGenomes-Gn; EBG00000034197.
DR   EnsemblGenomes-Gn; EBG00000034198.
DR   EnsemblGenomes-Gn; EBG00000034199.
DR   EnsemblGenomes-Gn; EBG00000034200.
DR   EnsemblGenomes-Gn; EBG00000034201.
DR   EnsemblGenomes-Gn; EBG00000034202.
DR   EnsemblGenomes-Gn; EBG00000034203.
DR   EnsemblGenomes-Gn; EBG00000034204.
DR   EnsemblGenomes-Gn; EBG00000034205.
DR   EnsemblGenomes-Gn; EBG00000034206.
DR   EnsemblGenomes-Gn; EBG00000034207.
DR   EnsemblGenomes-Gn; EBG00000034208.
DR   EnsemblGenomes-Gn; EBG00000034209.
DR   EnsemblGenomes-Gn; EBG00001018265.
DR   EnsemblGenomes-Gn; EBG00001018266.
DR   EnsemblGenomes-Gn; EBG00001018267.
DR   EnsemblGenomes-Gn; EBG00001018268.
DR   EnsemblGenomes-Gn; EBG00001018269.
DR   EnsemblGenomes-Gn; EBG00001018270.
DR   EnsemblGenomes-Gn; EBG00001018271.
DR   EnsemblGenomes-Gn; EBG00001018272.
DR   EnsemblGenomes-Gn; EBG00001018273.
DR   EnsemblGenomes-Gn; EBG00001018274.
DR   EnsemblGenomes-Gn; EBG00001018275.
DR   EnsemblGenomes-Gn; EBG00001018276.
DR   EnsemblGenomes-Gn; EBG00001018277.
DR   EnsemblGenomes-Gn; EBG00001018278.
DR   EnsemblGenomes-Gn; EBG00001018279.
DR   EnsemblGenomes-Gn; EBG00001018280.
DR   EnsemblGenomes-Gn; EBG00001018281.
DR   EnsemblGenomes-Gn; EBG00001018282.
DR   EnsemblGenomes-Gn; EBG00001018283.
DR   EnsemblGenomes-Gn; EBG00001018284.
DR   EnsemblGenomes-Gn; EBG00001018285.
DR   EnsemblGenomes-Gn; EBG00001018286.
DR   EnsemblGenomes-Gn; EBG00001018287.
DR   EnsemblGenomes-Gn; EBG00001018288.
DR   EnsemblGenomes-Gn; EBG00001018289.
DR   EnsemblGenomes-Gn; EBG00001018290.
DR   EnsemblGenomes-Gn; EBG00001018291.
DR   EnsemblGenomes-Gn; EBG00001018292.
DR   EnsemblGenomes-Gn; EBG00001018293.
DR   EnsemblGenomes-Gn; EBG00001018294.
DR   EnsemblGenomes-Gn; EBG00001018295.
DR   EnsemblGenomes-Gn; EBG00001018296.
DR   EnsemblGenomes-Gn; EBG00001018297.
DR   EnsemblGenomes-Gn; EBG00001018298.
DR   EnsemblGenomes-Gn; EBG00001018299.
DR   EnsemblGenomes-Gn; EBG00001018300.
DR   EnsemblGenomes-Gn; EBG00001018301.
DR   EnsemblGenomes-Gn; EBG00001018302.
DR   EnsemblGenomes-Gn; EBG00001018303.
DR   EnsemblGenomes-Gn; EBG00001018304.
DR   EnsemblGenomes-Gn; EBG00001018305.
DR   EnsemblGenomes-Gn; EBG00001018306.
DR   EnsemblGenomes-Gn; EBG00001018307.
DR   EnsemblGenomes-Gn; EBG00001018308.
DR   EnsemblGenomes-Gn; EBG00001018309.
DR   EnsemblGenomes-Gn; EBG00001018310.
DR   EnsemblGenomes-Gn; EBG00001018311.
DR   EnsemblGenomes-Gn; EBG00001018312.
DR   EnsemblGenomes-Gn; EBG00001018313.
DR   EnsemblGenomes-Gn; EBG00001018314.
DR   EnsemblGenomes-Gn; EBG00001018315.
DR   EnsemblGenomes-Gn; EBG00001018316.
DR   EnsemblGenomes-Gn; EBG00001018317.
DR   EnsemblGenomes-Gn; EBG00001018318.
DR   EnsemblGenomes-Gn; EBG00001018319.
DR   EnsemblGenomes-Gn; EBG00001018320.
DR   EnsemblGenomes-Gn; EBG00001018321.
DR   EnsemblGenomes-Gn; EBG00001018322.
DR   EnsemblGenomes-Gn; EBG00001018323.
DR   EnsemblGenomes-Gn; EBG00001018324.
DR   EnsemblGenomes-Gn; EBG00001018325.
DR   EnsemblGenomes-Gn; EBG00001018326.
DR   EnsemblGenomes-Gn; EBG00001018327.
DR   EnsemblGenomes-Gn; EBG00001018328.
DR   EnsemblGenomes-Gn; EBG00001018329.
DR   EnsemblGenomes-Gn; EBG00001018330.
DR   EnsemblGenomes-Gn; EBG00001018331.
DR   EnsemblGenomes-Gn; EBG00001018332.
DR   EnsemblGenomes-Gn; EBG00001018333.
DR   EnsemblGenomes-Gn; EBG00001018334.
DR   EnsemblGenomes-Gn; EBG00001018335.
DR   EnsemblGenomes-Gn; EBG00001018336.
DR   EnsemblGenomes-Gn; EBG00001018337.
DR   EnsemblGenomes-Gn; EBG00001018338.
DR   EnsemblGenomes-Gn; EBG00001018339.
DR   EnsemblGenomes-Gn; EBG00001018340.
DR   EnsemblGenomes-Gn; EBG00001018341.
DR   EnsemblGenomes-Gn; EBG00001018342.
DR   EnsemblGenomes-Gn; EBG00001018343.
DR   EnsemblGenomes-Gn; EBG00001018344.
DR   EnsemblGenomes-Gn; EBG00001018345.
DR   EnsemblGenomes-Gn; EBG00001018346.
DR   EnsemblGenomes-Tr; EBG00000034154-1.
DR   EnsemblGenomes-Tr; EBG00000034155-1.
DR   EnsemblGenomes-Tr; EBG00000034156-1.
DR   EnsemblGenomes-Tr; EBG00000034157-1.
DR   EnsemblGenomes-Tr; EBG00000034158-1.
DR   EnsemblGenomes-Tr; EBG00000034159-1.
DR   EnsemblGenomes-Tr; EBG00000034160-1.
DR   EnsemblGenomes-Tr; EBG00000034161-1.
DR   EnsemblGenomes-Tr; EBG00000034162-1.
DR   EnsemblGenomes-Tr; EBG00000034163-1.
DR   EnsemblGenomes-Tr; EBG00000034164-1.
DR   EnsemblGenomes-Tr; EBG00000034165-1.
DR   EnsemblGenomes-Tr; EBG00000034166-1.
DR   EnsemblGenomes-Tr; EBG00000034167-1.
DR   EnsemblGenomes-Tr; EBG00000034168-1.
DR   EnsemblGenomes-Tr; EBG00000034169-1.
DR   EnsemblGenomes-Tr; EBG00000034170-1.
DR   EnsemblGenomes-Tr; EBG00000034171-1.
DR   EnsemblGenomes-Tr; EBG00000034172-1.
DR   EnsemblGenomes-Tr; EBG00000034173-1.
DR   EnsemblGenomes-Tr; EBG00000034174-1.
DR   EnsemblGenomes-Tr; EBG00000034175-1.
DR   EnsemblGenomes-Tr; EBG00000034176-1.
DR   EnsemblGenomes-Tr; EBG00000034177-1.
DR   EnsemblGenomes-Tr; EBG00000034178-1.
DR   EnsemblGenomes-Tr; EBG00000034179-1.
DR   EnsemblGenomes-Tr; EBG00000034180-1.
DR   EnsemblGenomes-Tr; EBG00000034181-1.
DR   EnsemblGenomes-Tr; EBG00000034182-1.
DR   EnsemblGenomes-Tr; EBG00000034183-1.
DR   EnsemblGenomes-Tr; EBG00000034184-1.
DR   EnsemblGenomes-Tr; EBG00000034185-1.
DR   EnsemblGenomes-Tr; EBG00000034186-1.
DR   EnsemblGenomes-Tr; EBG00000034187-1.
DR   EnsemblGenomes-Tr; EBG00000034188-1.
DR   EnsemblGenomes-Tr; EBG00000034189-1.
DR   EnsemblGenomes-Tr; EBG00000034190-1.
DR   EnsemblGenomes-Tr; EBG00000034191-1.
DR   EnsemblGenomes-Tr; EBG00000034192-1.
DR   EnsemblGenomes-Tr; EBG00000034193-1.
DR   EnsemblGenomes-Tr; EBG00000034194-1.
DR   EnsemblGenomes-Tr; EBG00000034195-1.
DR   EnsemblGenomes-Tr; EBG00000034196-1.
DR   EnsemblGenomes-Tr; EBG00000034197-1.
DR   EnsemblGenomes-Tr; EBG00000034198-1.
DR   EnsemblGenomes-Tr; EBG00000034199-1.
DR   EnsemblGenomes-Tr; EBG00000034200-1.
DR   EnsemblGenomes-Tr; EBG00000034201-1.
DR   EnsemblGenomes-Tr; EBG00000034202-1.
DR   EnsemblGenomes-Tr; EBG00000034203-1.
DR   EnsemblGenomes-Tr; EBG00000034204-1.
DR   EnsemblGenomes-Tr; EBG00000034205-1.
DR   EnsemblGenomes-Tr; EBG00000034206-1.
DR   EnsemblGenomes-Tr; EBG00000034207-1.
DR   EnsemblGenomes-Tr; EBG00000034208-1.
DR   EnsemblGenomes-Tr; EBG00000034209-1.
DR   EnsemblGenomes-Tr; EBT00001543801.
DR   EnsemblGenomes-Tr; EBT00001543802.
DR   EnsemblGenomes-Tr; EBT00001543803.
DR   EnsemblGenomes-Tr; EBT00001543804.
DR   EnsemblGenomes-Tr; EBT00001543805.
DR   EnsemblGenomes-Tr; EBT00001543806.
DR   EnsemblGenomes-Tr; EBT00001543807.
DR   EnsemblGenomes-Tr; EBT00001543808.
DR   EnsemblGenomes-Tr; EBT00001543809.
DR   EnsemblGenomes-Tr; EBT00001543810.
DR   EnsemblGenomes-Tr; EBT00001543811.
DR   EnsemblGenomes-Tr; EBT00001543812.
DR   EnsemblGenomes-Tr; EBT00001543813.
DR   EnsemblGenomes-Tr; EBT00001543814.
DR   EnsemblGenomes-Tr; EBT00001543815.
DR   EnsemblGenomes-Tr; EBT00001543816.
DR   EnsemblGenomes-Tr; EBT00001543817.
DR   EnsemblGenomes-Tr; EBT00001543818.
DR   EnsemblGenomes-Tr; EBT00001543819.
DR   EnsemblGenomes-Tr; EBT00001543820.
DR   EnsemblGenomes-Tr; EBT00001543821.
DR   EnsemblGenomes-Tr; EBT00001543822.
DR   EnsemblGenomes-Tr; EBT00001543823.
DR   EnsemblGenomes-Tr; EBT00001543824.
DR   EnsemblGenomes-Tr; EBT00001543825.
DR   EnsemblGenomes-Tr; EBT00001543826.
DR   EnsemblGenomes-Tr; EBT00001543827.
DR   EnsemblGenomes-Tr; EBT00001543828.
DR   EnsemblGenomes-Tr; EBT00001543829.
DR   EnsemblGenomes-Tr; EBT00001543830.
DR   EnsemblGenomes-Tr; EBT00001543831.
DR   EnsemblGenomes-Tr; EBT00001543832.
DR   EnsemblGenomes-Tr; EBT00001543833.
DR   EnsemblGenomes-Tr; EBT00001543834.
DR   EnsemblGenomes-Tr; EBT00001543835.
DR   EnsemblGenomes-Tr; EBT00001543836.
DR   EnsemblGenomes-Tr; EBT00001543837.
DR   EnsemblGenomes-Tr; EBT00001543838.
DR   EnsemblGenomes-Tr; EBT00001543839.
DR   EnsemblGenomes-Tr; EBT00001543840.
DR   EnsemblGenomes-Tr; EBT00001543841.
DR   EnsemblGenomes-Tr; EBT00001543842.
DR   EnsemblGenomes-Tr; EBT00001543843.
DR   EnsemblGenomes-Tr; EBT00001543844.
DR   EnsemblGenomes-Tr; EBT00001543845.
DR   EnsemblGenomes-Tr; EBT00001543846.
DR   EnsemblGenomes-Tr; EBT00001543847.
DR   EnsemblGenomes-Tr; EBT00001543848.
DR   EnsemblGenomes-Tr; EBT00001543849.
DR   EnsemblGenomes-Tr; EBT00001543850.
DR   EnsemblGenomes-Tr; EBT00001543851.
DR   EnsemblGenomes-Tr; EBT00001543852.
DR   EnsemblGenomes-Tr; EBT00001543853.
DR   EnsemblGenomes-Tr; EBT00001543854.
DR   EnsemblGenomes-Tr; EBT00001543855.
DR   EnsemblGenomes-Tr; EBT00001543856.
DR   EnsemblGenomes-Tr; EBT00001543857.
DR   EnsemblGenomes-Tr; EBT00001543858.
DR   EnsemblGenomes-Tr; EBT00001543859.
DR   EnsemblGenomes-Tr; EBT00001543860.
DR   EnsemblGenomes-Tr; EBT00001543861.
DR   EnsemblGenomes-Tr; EBT00001543862.
DR   EnsemblGenomes-Tr; EBT00001543863.
DR   EnsemblGenomes-Tr; EBT00001543864.
DR   EnsemblGenomes-Tr; EBT00001543865.
DR   EnsemblGenomes-Tr; EBT00001543866.
DR   EnsemblGenomes-Tr; EBT00001543867.
DR   EnsemblGenomes-Tr; EBT00001543868.
DR   EnsemblGenomes-Tr; EBT00001543869.
DR   EnsemblGenomes-Tr; EBT00001543870.
DR   EnsemblGenomes-Tr; EBT00001543871.
DR   EnsemblGenomes-Tr; EBT00001543872.
DR   EnsemblGenomes-Tr; EBT00001543873.
DR   EnsemblGenomes-Tr; EBT00001543874.
DR   EnsemblGenomes-Tr; EBT00001543875.
DR   EnsemblGenomes-Tr; EBT00001543876.
DR   EnsemblGenomes-Tr; EBT00001543877.
DR   EnsemblGenomes-Tr; EBT00001543878.
DR   EnsemblGenomes-Tr; EBT00001543879.
DR   EnsemblGenomes-Tr; EBT00001543880.
DR   EnsemblGenomes-Tr; EBT00001543881.
DR   EnsemblGenomes-Tr; EBT00001543882.
DR   EuropePMC; PMC1273839; 16239585.
DR   EuropePMC; PMC1617103; 17014718.
DR   EuropePMC; PMC187327; 12933880.
DR   EuropePMC; PMC2632904; 19056824.
DR   EuropePMC; PMC3668242; 23631387.
DR   EuropePMC; PMC3957732; 24600043.
DR   EuropePMC; PMC4262367; 25476067.
DR   EuropePMC; PMC4448311; 25928324.
DR   EuropePMC; PMC4786649; 26966214.
DR   EuropePMC; PMC5739047; 29220487.
DR   EuropePMC; PMC99098; 11752244.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00435; ROSE.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00520; ybhL.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   SILVA-LSU; BA000012.
DR   SILVA-SSU; BA000012.
DR   StrainInfo; 373790; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7036071
FT                   /organism="Mesorhizobium japonicum MAFF 303099"
FT                   /strain="MAFF303099"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:266835"
FT   CDS_pept        287..1084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0002"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47682"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47682"
FT                   /db_xref="GOA:Q98NS9"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NS9"
FT                   /protein_id="BAB47682.1"
FT                   /translation="MFWVTKKALMPFLMLPAGIIFVSAVGYAINWLFSTLFQFQPPLVE
FT                   GPAGPVTVLIFTITMLLAYDISYYLYHVAQHRYPLLWELHKVHHSAEVMVGITKDRVHP
FT                   LDELMNRAWDGLIVGICFGIWSLISLNLVELTVFGVNVYVMRNILMMDFVRHTHFKISF
FT                   GPLNNVILCPHWHQLHHSTDPRHYDKNFGLLFSFWDRLFGTLCVPKPDEDFKFGLVDRN
FT                   VRDYQSLAGLYVMPLKRMWGHIARRIRPAKSRTVQSSEEGTRP"
FT   CDS_pept        1006..2223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0003"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47683"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47683"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NS8"
FT                   /protein_id="BAB47683.1"
FT                   /translation="MGAYCQAHPACKVTDRTVIGRRDAAMNAPFVLAIPRTRTFEVVTS
FT                   AARLAEIAPAWTALWQRAGGLVFQHPDWIAAWWRTTPHQERRTLRIGLAWNGDRLDGVI
FT                   ALATFRRSGIRMLEWAAKDHSDYGDALVAPDSDPQVISRLWQHVFDQGGFDLAYLNRLL
FT                   PDAGVRALLDPASRHARALRPNHRSEISYRVVGPWQSGAEWFETLSKKARQNYRRGRKF
FT                   MEEGGAVRFRLLGADDPREPVLARVAVLKRLWLARHGRVSDLFDKGSPVLAALVSVLAE
FT                   LGLLRIFVLELDDTIIAVSINFEQHGTMMAFVTTYDPEYERASPGMVLMMDYIQWSLDR
FT                   GLAKVDFLCGGEDFKRRFATQSVRLSSMIGARGLRGHLAALADRAVHVTKSSRAQRQPN
FT                   AQTPDE"
FT   CDS_pept        complement(2253..2720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0004"
FT                   /product="bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47684"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47684"
FT                   /db_xref="GOA:Q98NS7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NS7"
FT                   /protein_id="BAB47684.1"
FT                   /translation="MADLDVGDLAPQFDLPQDGGGSFSLAASAGKPVVLYFYPQDDTTS
FT                   CTQEAISFSQLKPEFEKAGAVVIGLSPDNVKKHDKFKSKYNLTVDLAADEERKVIEAYH
FT                   LWVEKSMYGRKYMGVERATFLIDRDGRIARIWRKVRVKGHAEDVLEAVRAL"
FT   CDS_pept        2816..6196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0006"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47685"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47685"
FT                   /db_xref="GOA:Q98NS6"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NS6"
FT                   /protein_id="BAB47685.1"
FT                   /translation="MDQEQPQHEKIRFRRDEITDLGALPSACRVPPLGQASIGRGFRIL
FT                   SRVFAGMVAFVLLAAIVVYLVGASGVGSERLRAEAETAIEKLAGVDVNVAVGPARITLD
FT                   SSSFVALQVSDVSLKTSDDKPMADAGRVRFGMRLIPLLWGEVRLTSARISDAHIVVAAM
FT                   PSGDDWTAQLRNEDGLVDPERLSDALFGNIHRALDAVREDSMRRIDLSNVEFVLPETGA
FT                   IKLVKIADATVVQSGPGAVEFSSEADIDGRKVTVAASATRDIAAHRVTALTASVDLAAA
FT                   DDTAAGAGKLGAVALKLTGAEGSGANESRLTAALSSAGSVLDLGTRGLLPADVDVDATL
FT                   VHGSNKIQVDRLLLKTGRSSFNFGGSIGPKPATGAAGEEPSYRYDLTSDGSTLAPSESP
FT                   EPALTFLARIAGVYQTKSHKLVAEQIAVRSAASGEVLGTAAVAFVEGKAPGVNLALNVH
FT                   DMPVSHVKQLWPWFSARNARLWVLDNLFGGRVVDANLQFQVVPDRLGNGVPLSAEEVFG
FT                   RFQIEGSRFDTAGRIPPIRDAVGVVAFHGNDVDISLSSGTVYMPSGRTVAASNGTLAVK
FT                   AANRPPVIGALDIDVEGEAPAVAELASYEPINAMRHVGFLPEDLSGNVTGHVRADIPLQ
FT                   SGVDTSKLDWLVSLDYSGLSLAKPFEGQTVTDADGSITVDPEKAVISAKASLNGIPAEL
FT                   DLIEPLADDGPARSRKVALVLDDKVRAAAMPGLTPLLGGTVKVAIDKSGDGNQNVSADL
FT                   TNARLDIPWAGWSKGAGVPASVTFVMTKAGDTTTLSDFNLDGKTFSIDGSIVLVNGGLS
FT                   SAKFSKVTLNRGDDVAISVKRSGKGYAVDINGNALDARSLIKQFTSDVDTATKTTGTDN
FT                   ISVSADVEQLTGFHDEQLSNLKLDYSAAGSRVNGLKVSATASSGAAITISNTTGDGRRS
FT                   LNVKSADAGAILRFLNVYEHMEGGSIMLALTGAGDGPMKGKVDTSNFFIVNEPKLASMV
FT                   STTPAGDNRSLNQAVKGNLDTSRVKFERGYAEIEKGSGYLKLANGVLRGPRIGTTFQGI
FT                   LYDQNNNMDMTGTFMPVYGLNRIFGELPIVGALLGNGRDRGLIGVTYRLRGNANKPVLD
FT                   INPLSVIAPGIFRSIFEYR"
FT   CDS_pept        complement(6203..7456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0007"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47686"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47686"
FT                   /db_xref="GOA:Q98NS5"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NS5"
FT                   /protein_id="BAB47686.1"
FT                   /translation="MPAFKSDFLRTMSERGFIHQISDETGLDQLFAKETVTAYVGYDAT
FT                   ATSLHIGNLISATMLYWLQETGHRPIALMGGGTSMIGDPSFRDDQRSLLTPEAIATNIE
FT                   GIKRIFGRILRFGDGPNDAIMVNNADWLMKLNYVEFLRDVGRHFSVNRMLTFDSVKLRL
FT                   DREQSLSFLEFNYMILQGYDFVELARRQNCRLQMGGSDQWGNIINGVDLGHRMGTPQLY
FT                   ALTTPLLTTSSGAKMGKSAKGAVWLNGDLFSPYDFWQYWRNTEDADVERFLKIFTRLPL
FT                   PEIARLAALGGSEINEAKKILATETTAIVHGREAANQAEETARKTFEEGALADTLPTVG
FT                   ADKAALEAGIGILSLLVTAGLASSNGEARRHIQGGAVRINDQSVSDDRRMVTLQDLSPE
FT                   NVVKLSLGKKKHVLVRPA"
FT   CDS_pept        7723..8490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0009"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47687"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47687"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NS4"
FT                   /protein_id="BAB47687.1"
FT                   /translation="MPHSTTEPRRDMPDALISIVIPCRNEAANLPLLIDEIEAAMAGRH
FT                   FELIIVNDGSTDETAAVLTEQAALRSFPVRELRHQKSAGQSLSVRSGAWAARGGIVATI
FT                   DGDGQNDPQYIPVLVDALRQAGPDFGAAQGQRLKRRDSKVKQLASRFANWLRNAILHDE
FT                   TRDTGCGLKAVHTEILRKLPFFDGTHRFVPALVIQEGYRVVHCDVVDRSRRHGKSNYGI
FT                   FDRGLQGALDLGGVWWLRRRRRRMPKVEEIKRV"
FT   CDS_pept        8483..8815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0010"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47688"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47688"
FT                   /db_xref="GOA:Q98NS3"
FT                   /db_xref="InterPro:IPR011499"
FT                   /db_xref="InterPro:IPR014546"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NS3"
FT                   /protein_id="BAB47688.1"
FT                   /translation="MFNVLQELGTWLHQVFIKQFDAWILLGFVAQFFFTMRFVVQWLAS
FT                   EKAKRSVVPVAFWFFSLFGGGLLLIYAIQRQDPVFIAGQAMGMFIYIRNLWLIANERKA
FT                   AMTKVD"
FT   CDS_pept        8856..10505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0011"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47689"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47689"
FT                   /db_xref="GOA:Q98NS2"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NS2"
FT                   /protein_id="BAB47689.1"
FT                   /translation="MALNRNYILLFLFSLVMTLSGLASLPPIDRDESRFVQATKQMAES
FT                   GDYVDIRFQEASRYQKPIGIYWLQSAAVTLSGKGAEAPIWVYRTISALGIAIAVLAIAW
FT                   TGTNLFGANAGIAAGLVMAAIFATAFEGRDAKTDAMLLACCVAAQGALALIYLASRRNE
FT                   PVAGHLWWIFWIAQGAAILIKGPIAPLLSALTIAALFAFERDGRWLSKLRVGRGLLLVV
FT                   VITLPWLAAITWKSHGAFLQQAVGKDMLGKVASGEESHGLPPGFYMLTYSLFMWPFGLI
FT                   AVGAGLQALNRMRDDVRLRFCLAWYIPFWLVFELIPTKLPHYVLPAYPGMALLIGWLLT
FT                   LQPEDANASLKRWQQWLWWSTAFGLVVVSLGLAAVSIGAPIYLTHSFSWWSIPAAAAAL
FT                   GTGYFAFSRQLQVPLPRIGATAACAGITYALLFGVIAPSLKPIWLSPAIKQAVLANKPC
FT                   DTTVLASARFQEPSLVFLVGTKTVLTDVGGVAQHLLTDPACALGLAPIEDEQKLNGMLS
FT                   VQGKSVKRVAEIDGLNYSSGDKLSLGLYRVAP"
FT   CDS_pept        10632..11366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0012"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47690"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47690"
FT                   /db_xref="GOA:Q98NS1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NS1"
FT                   /protein_id="BAB47690.1"
FT                   /translation="MRIVRGRFAARPARYPNIAWPVWGLVWLLLTAVAFVRLDTPAGMV
FT                   HGQWSGAGLAEFLTQFALGGWYLIPSALLLVAANLTDWRGLSRRSLMLVYNWTCLAFLV
FT                   LSAVGLSGLLVNVLKYAIGRARPLYFQDFGVLALHPFAFDARFAGFPSGHATTMGAVFG
FT                   VLLLLFPRRWHIALVVTACLASTRVFVGAHYPSDTVAGFGLGCAFALACGLVFARLGFI
FT                   FRATPSGLPVRKASFRLIAPQK"
FT   CDS_pept        complement(11379..12029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0013"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47691"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47691"
FT                   /db_xref="GOA:Q98NS0"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NS0"
FT                   /protein_id="BAB47691.1"
FT                   /translation="MYEPPHFQETRPDVLHGLIRAHPLGMLISNGPDGPVANAIPFLLD
FT                   AEGLSNGRLRAHLAKANPHWRLIADNPASPVLIVFQGADAYVTPSWYETKRETGKVVPT
FT                   WNYAIVQVRGTAKVIDDQEWLAQQIADLTGSQEGARQAPWAVTDAPPPFIQSQIKGIIG
FT                   LEIEISEIHGKWKVSQNRPVADRAGVAQGLESEVADASDMARLVRSYGGLDSN"
FT   CDS_pept        complement(12051..12737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0014"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47692"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47692"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NR9"
FT                   /protein_id="BAB47692.1"
FT                   /translation="MEYFMPEVIFTGPAGRLEGRYQPSKEKSAPIAIVLHPHPQFGGTM
FT                   NNKIVYDLFYMFQKRDFTTLRFNFRGIGRSQGEFDHGTGELSDAAAALDWVQSLHPDSK
FT                   SCWVAGYSFGSWIGMQLLMRRPEIEGFISIAPQPNTYDFSFLAPCPSSGLIIHGDADKV
FT                   APPKDVQGLVDKLHTQKGITITQKTLPGANHFFANHADLLIEECADYLDRRLAGELSDP
FT                   RPKRLR"
FT   CDS_pept        12964..14127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0015"
FT                   /product="nitrogenase cofactor synthesis protein; NifS"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47693"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47693"
FT                   /db_xref="GOA:Q98NR8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NR8"
FT                   /protein_id="BAB47693.1"
FT                   /translation="MAAKRAYLDYNASAPLLPAAREAMVVALDVAANPSSVHAEGRAAR
FT                   RLIETARREVAALVSARPEHVVFTSGATEAASTLLSPEWQMGRGSVRMSRLYVCEADHP
FT                   CLLNGGRFPAAQVTRIGVDANGIADLAALAAALGDHDKADGLPLVAIHAANNETGVIQP
FT                   IDRIAEIVKAAGGILVVDAVQAAGRVSIDMSAGYADYLIQSSHKIGGPKGVGAIVAAAD
FT                   LMMPKPLINGGGQEKGHRGGTENLAAISGFGAAAREALAGLLAIDAVRQRRDEIEAIVK
FT                   MLVPDAEIFGTGAPRLANTTFFAIAGIKAETAQIAFDLAGVALSAGSACSSGKVGPSHV
FT                   LKAMGYGDSLGALRVSIGSATGAEDIELFRTALAGIAQRRAGREQAA"
FT   CDS_pept        14316..15833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0016"
FT                   /product="ABC transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47694"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47694"
FT                   /db_xref="GOA:Q98NR7"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NR7"
FT                   /protein_id="BAB47694.1"
FT                   /translation="MPAVQDTIDRVRKIDVDQYKYGFQTEIAVAKAPKGLSEDIIRFIS
FT                   AKKDEPSWMLEWRLEAYRRWLTLEEPTWARVHYPKIDFQDIYYYAAPKSTPGPSSLSDV
FT                   DPELLKVYEKLGIPLREQEILAGVQKTDASELEEPSDNVYKSGRVAVDAVFDSVSVVTT
FT                   FKKELAQAGVIFCSISEAIREHPELVQKYLGSVVPTSDNFYATLNSAVFTDGSFVFVPK
FT                   GVRCPMELSTYFRMNEKNTGQFERTLIIAEEGAYVSYLEGCTAPQRDENQLHAAVVELV
FT                   ALDDAEIKYSTVQNWYPGDAEGKGGIYNFVTKRGDCRGDRSKISWTQVETGSAITWKYP
FT                   SCILRGDDSSGEFYSIAVSNGYQQVDSGTKMIHLGKNTSSRIISKGIAAGFSQNTYRGQ
FT                   VSAHRKATNARNFTNCDSLLIGDQCGAHTVPYMEAKNSTAQFEHEATTSKISEDQKFYV
FT                   MQRGIPEEEAIALIVNGFVKDVIQQLPMEFAVEAQKLIGISLEGSVG"
FT   CDS_pept        15830..16450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0017"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47695"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47695"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NR6"
FT                   /protein_id="BAB47695.1"
FT                   /translation="MMVMPFRNIVSGLFAGLLGVASAVLPTASAYAVEEKEAGSADGLL
FT                   LSMSKEFLENSGFVSGLGLDGSKLDYSVESLKQIDAALQKLHDELPDGTDGKDLMAAGD
FT                   KQLQFVTLSLGSYVGEVLRRHLKQDARWEGFGSLSEDEKQLFGNEKDIGNAYFIRWADG
FT                   VVFPMSKVMKFLANGDEDSVYFYAKVILKDTKQVDGDGTAASR"
FT   CDS_pept        16552..17307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0019"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47696"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47696"
FT                   /db_xref="GOA:Q98NR5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NR5"
FT                   /protein_id="BAB47696.1"
FT                   /translation="MLEIRNLHARIVDDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTL
FT                   SYILAGREDYEVTEGDILYNGQSILEMDPAERATSGIFLAFQYPMEIPGVATMEFLKVA
FT                   MNEQRKARGEEPLKIPEFLKRVKEAAASLNMDMAMLKRPLNVGFSGGEKKRAEILQMKL
FT                   LEPKLCVLDETDSGLDIDALKIVSDGVNALRAPDRAFLVITHYQRLLEHIVPDSVHVLY
FT                   RGQVIKSGDKSLALDLEANGYAGVIGEAA"
FT   CDS_pept        17309..18601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0020"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47697"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47697"
FT                   /db_xref="GOA:Q98NR4"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NR4"
FT                   /protein_id="BAB47697.1"
FT                   /translation="MPEGKVKLMNMHTQPQRTPAETALIDAFGDRLSLLPGDGAVMLKR
FT                   DDAIEAIKHGLPTRRVESWHYTDLRRLLSVVPDFDPAAMAKAIAPIVEGSAVLPVLNGK
FT                   SDAKVPALDGVTVQSLSEKLIDGSIAPGLDSYGSDDAIGALNTAFVADGYFVDIADGTE
FT                   LEKPIELQNVQAGGQTHVRLAVRVGAGAKAVIVERQAGDGAALVSSVSQLVLGEDAEVT
FT                   WLIVQEQPDTATHLAQFKAHIGKNAKLTLFVMNAGGKLVRQEVMVKTTGEGADFKLRGI
FT                   NLLAGDTHSDVTMVLDHAVPHTTSTEVIRNVVTGKARGVFQGRINVHQYAQKTNAKMAC
FT                   NTLLLSDDGEFSTKPELEIFADDVVCGHGATVTEIDHDHLFYLMARGVDEKSARGLLVK
FT                   AFVAEVIEELDDETIVEALEARLDEWFVTHG"
FT   CDS_pept        18713..19954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0021"
FT                   /product="NifS-like aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47698"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47698"
FT                   /db_xref="GOA:Q98NR3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NR3"
FT                   /protein_id="BAB47698.1"
FT                   /translation="MDQKVETTPYDVEAIRRDFPILSREVYGKPLVYLDNGASAQKPQV
FT                   VLDTIQHAYSQEYANVHRGLHFLSNAATDAYEKARETVRRFLNAPSTDNIVFTSNTTSA
FT                   INTVAYGYGMPNIGEGDEIVLSIMEHHSNIVPWHFIRERQGAKLVWVPVDDLGVFHIEE
FT                   FEKRLTNRTKLVAITQMSNALGTVTPIKEIVRIAHARGIPVLVDGSQSAVHMPIDVQDL
FT                   DCDFFVFTGHKVYGPSGIGVLYGKKDILAGMRPFMGGGEMIEEVTEDIVTYNEPPHRFE
FT                   AGTPPIVQAIGLGAALDYMEKIGRERIAAHEEDLKTYAHERLRAINSLRIFGDAPGKGA
FT                   IISFELQGIHAHDVSMVIDRQGVAVRAGTHCAQPLLKRFGVTSTCRASFGMYNTRAEVD
FT                   ALAEALEKARKFFG"
FT   CDS_pept        19951..20355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0023"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47699"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47699"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR014291"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NR2"
FT                   /protein_id="BAB47699.1"
FT                   /translation="MMTTMDDVSATAETAPETAANGIVSASAIPADELARLTDDIVSAL
FT                   KTVYDPEIPADIYELGLVYKIDIEDDRSVKIDMTLTAPGCPVAGEMPGWVENAVGAVEG
FT                   VSGVEVNMTFDPPWSPDRMSEEAQVAVGWY"
FT   CDS_pept        20404..20838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0024"
FT                   /product="HesB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47700"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47700"
FT                   /db_xref="GOA:Q98NR1"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR011298"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NR1"
FT                   /protein_id="BAB47700.1"
FT                   /translation="MRNHSAGLEPAWNGEGKRMGRFAVITMTEKAADRVREIVATRENA
FT                   HGIRLGIKKGGCAGMEYTVDLVTEPNTKDDHIERDGAHVYVAPEAALFLFGTEMDFEQT
FT                   TLRTGFTFHNPNQSSACGCGESVELKPADLKALAEARASA"
FT   CDS_pept        complement(20875..21372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0025"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47701"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47701"
FT                   /db_xref="GOA:Q98NR0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NR0"
FT                   /protein_id="BAB47701.1"
FT                   /translation="MPLLLKGSCRCNAVRFEVESHTPVPFMLCYCSICRKQQGGGGFAI
FT                   NLGAAYETLNIRGKRSLGVYRAEIEDDEHPHCEVSTGERNFCRKCGSALWLYDPTWPEL
FT                   VHPFASAIDSDLPKPPSRVHLMLKYKANWVEPVIGKGDKTFDVYPEESIADWHKLTGMW
FT                   VD"
FT   CDS_pept        21462..21785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0026"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47702"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47702"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NQ9"
FT                   /protein_id="BAB47702.1"
FT                   /translation="MDNERIAELFSGLGPVSIRRLFGGKGIYFDGVIIAIVLRGELLLK
FT                   ADEQSAPDFEAEGCKQWAYTGKRHGKLVAMPYWSIPDSAFDDPDEMTVWARRAYEAGRR
FT                   AGK"
FT   CDS_pept        complement(21787..22704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0028"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47703"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47703"
FT                   /db_xref="GOA:Q98NQ8"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NQ8"
FT                   /protein_id="BAB47703.1"
FT                   /translation="MSPETARPFIDIHAPVAQALAAGRPVVALESTIITHGMPYPDNGA
FT                   MAANVEKIISDGGAVPATIAVIGGRIKIGLSDGERESLAMTGDAMKLSRADLGFAVAQG
FT                   RTGGTTVAATMIAAEMVGIKVFATGGIGGVHKGAEKSFDISADLDELARTPVIVVSAGA
FT                   KAILDIEKTLEVLETRGVPVVGHGCETMPAFWSRQSPFRAPLTLYKPEEIAHFFRTRVA
FT                   LGLGGGVLVANPVPENHEIPAEEMAGYIEAAQKAAEALNVTGKAVTPFLLGKILELTGG
FT                   RSLKTNIALVENNARLAAEIAKAL"
FT   CDS_pept        complement(22778..23722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0029"
FT                   /product="carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47704"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47704"
FT                   /db_xref="GOA:Q98NQ7"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NQ7"
FT                   /protein_id="BAB47704.1"
FT                   /translation="MVKSIEILAVGGAHIDRRGQVSGAYVPAASNPGTMREDVGGGVFN
FT                   ALRSTVRRGVSGSLMSMRGGDAGADTISRAIAQAGIADLSAVFLDRTTPSYTALIDREG
FT                   ELIVGFADMALYDLAFPKQMRRSKVREAIAAADAILCDANLPSAALERLVSLAAGKPVY
FT                   AIAISPAKVVRLIPVLGALALVFMNRREAVALAGVNANAAERDVIDGLRCSGLTSGVVT
FT                   AGSAPVLGFDEAGAFSIQPPAPRKVANVTGAGDALAGATVAALLHGLPLRQALREGIAA
FT                   ATLAIESADAIPDFTAASFAEVLALVPNAQEVA"
FT   CDS_pept        24004..25101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0030"
FT                   /product="recombination protein; RecA"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47705"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47705"
FT                   /db_xref="GOA:Q98NQ6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NQ6"
FT                   /protein_id="BAB47705.1"
FT                   /translation="MAQNSLRLVEDKAVDKSKALDAALSQIERAFGKGSIMRLGANEQV
FT                   VEIETVPTGSLGLDIALGVGGLPRGRIIEIYGPESSGKTTLALHTVAEAQKKGGICAFV
FT                   DAEHALDPVYARKLGVDLENLLISQPDTGEQALEICDTLVRSGAIDVLVVDSVAALTPR
FT                   AEIEGEMGDSLPGLQARLMSQALRKLTASISRSNTMVIFINQIRMKIGVMFGSPETTTG
FT                   GNALKFYASVRLDIRRIGSVKDRDEVVGNQTRVKVVKNKLAPPFKVVEFDIMYGEGVSK
FT                   TGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRENAKLFLRDNPDTAREIELALRQNAGL
FT                   IAEKFLENGGSEGGDDGFEDEAGAM"
FT   CDS_pept        25362..28028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0032"
FT                   /product="alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47706"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47706"
FT                   /db_xref="GOA:Q98NQ5"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NQ5"
FT                   /protein_id="BAB47706.1"
FT                   /translation="MSGVNEIRSTFLDYFRKEGHEVVASSPLVPRNDPTLMFTNAGMVQ
FT                   FKNVFTGLEKRSYSRATTAQKSVRAGGKHNDLDNVGYTARHLTFFEMLGNFSFGDYFKE
FT                   RAIELAWNLITKEFGLKKDKLLVTVYHTDDEAAGFWKKIAGFSDDRIIRIATSDNFWAM
FT                   GDTGPCGPCSEIFIDRGEHVWGGPPGSPEEDGDRFLEFWNLVFMQYEQVTKEERIDLPR
FT                   PSIDTGMGLERMASILQGVESVFETDLFRHLIDAASSALGRAPDAETVASYRVIADHLR
FT                   SSSFLVADGVLPSNEGRGYVLRRIMRRAMRHAQLLGANEPLMWKLVPALVREMGQAYPE
FT                   LLRGEQLVTETLKLEETRFRKTLVRGLGLLSEATETLHAGDMLDGETAFKLYDTYGFPL
FT                   DLTQDALRQRNISVDLAGFTNAMEQQKAEARKHWTGSGEAATETVWFSVREQTGATEFL
FT                   GYETEQAEGLIQALVKDGKTVDSAGKGDAVAVVVNQTPFYGESGGQMGDTGIISGEGFS
FT                   IEISDTQKKADGLFVHLGKVASGTVKTGAAVELKVDHARRTRLRANHSATHLIHEALRE
FT                   VLGTHVAQKGSLVAPERLRFDISHNKPISAEELEEVERMANEIVVQNSPVTTRLMSVDD
FT                   AIAEGAMALFGEKYGDEVRVVSMGTGLHGAKANRPYSVELCGGTHVRATGDIGLVRVVS
FT                   DSAVAAGVRRIEALTGEAARKHLDEQDRRLKAAAATLKISPADVPARVEALLEERKKLE
FT                   KDLTEARKKLALGGGAAAGAPSENETVAGVGFLGKAVSGVSPKDLKPLADAGKSSLGSG
FT                   VVVFVGADEDNKASVVVAVTDDLVGRFSAVDLVRVASAALGGQGGGGRPDMAQAGGPDA
FT                   SKANDAIAAVKAALEAA"
FT   CDS_pept        28039..28395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0033"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47707"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47707"
FT                   /db_xref="GOA:Q98NQ4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NQ4"
FT                   /protein_id="BAB47707.1"
FT                   /translation="MNVLVLGGYGLIGDAVIGRLLRDGHHVTGLGRDVPDAGRRRPAVR
FT                   WIAADMSKLLAAEDWLPVVAGMDAVVKFGSAIWRGRRPSKTHRCPPKRNACFASGLLAV
FT                   FQPLARRLRSSGRW"
FT   CDS_pept        complement(28427..29053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0034"
FT                   /product="glutathione S-transferase III"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47708"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47708"
FT                   /db_xref="GOA:Q98NQ3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NQ3"
FT                   /protein_id="BAB47708.1"
FT                   /translation="MTRPILYGADYSVYVRIARMALEEKGVDYELVPLDIFAADGIPAW
FT                   YLEHHPFGRIPAFEHDGFRLFETNAITRYVDEAFDGPALQPADARGRARMGQMTGMLDA
FT                   YGYRAMVWDVAVERLEKVEPDWALIASGLAQAETVLKVLRSLKAQGPWLLGDQLTLADL
FT                   HAAPIIAYFVKVTQGRDLLARFADMRDWYARVADRASFARSEKAD"
FT   CDS_pept        complement(29133..30344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0036"
FT                   /product="NADP-dependent isocitrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47709"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47709"
FT                   /db_xref="GOA:Q98NQ2"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NQ2"
FT                   /protein_id="BAB47709.1"
FT                   /translation="MAKIKVANPVVELDGDEMTRIIWQFIKDKLIHPYLDLKLEYYDLG
FT                   IEHRDATNDQVTIDSANAIKKYGVGVKCATITPDEQRVEEFKLKKMWKSPNGTIRNILG
FT                   GTIFREPIIMKNVPRLVPGWTKPIIVGRHAFGDQYRATDFRFPGKGKLTIKFVGEDGKV
FT                   IEHDVFDAPGAGVAMAMYNLDESIREFARASLNYGLLRNYPVYLSTKNTILKAYDGRFK
FT                   DIFQEVYEAEFEADFKSKKLWYEHRLIDDMVASSLKWSGGYVWACKNYDGDVQSDTVAQ
FT                   GFGSLGLMTSVLMTPDGKTVEAEAAHGTVTRHYRQHQKGEETSTNSIASIFAWTRGLAH
FT                   RAKLDDNAELKRFAETLEKVCIQTVESGFMTKDLSLLIGPDQPWLSTTGFLDKIDENLQ
FT                   KAMA"
FT   CDS_pept        complement(30662..31606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0037"
FT                   /product="probable outer membrane protein B; OmpB"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47710"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47710"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NQ1"
FT                   /protein_id="BAB47710.1"
FT                   /translation="MLLLASVFLIAPASAQATRTWVSGVGNDADPCSRTAPCKTFAGAI
FT                   SKTATAGEINCLDPGGFGTVTITKSITIDCKTTEGGVLSALVNGIVVNTPVGSVVHLRG
FT                   LDIDGAGTGLDGVRMTGQGQLHIEDCNIERVTSNGVEFLPNGASELYISNTRIAEAVGG
FT                   AILIKTTGAVGINAILSRVELTNSANGILVDGTGNTSAMNMALTDSLVSGNTGNGVAVK
FT                   SVAAASSVRATIVNTTISSNAGIGVNANGAAASGAGSAIAFLGASTVFGNVTGVSNTGS
FT                   GAVQSFKNNMISGNVADGTPITAFPGPGGTPLQ"
FT   CDS_pept        32191..33102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0038"
FT                   /product="RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47711"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47711"
FT                   /db_xref="GOA:Q98NQ0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NQ0"
FT                   /protein_id="BAB47711.1"
FT                   /translation="MTGKDFQRGPGGPAIILVEPQLGENIGMVARAMANFGLSELRLVN
FT                   PRDGWPSEKARAAASRADHVIDAVKVFDDLASALADLNFVFATTARQRDGFKAVRGPVE
FT                   AGRVLRARHGMGQRTGILFGRERFGLYNDEVGLADEIVTFPVDPDFSSLNIAQAALLMS
FT                   YEWMKSGLEDETKTNFSGPEMKPASKEELHGLFAYLEGALEARGYFRPAPKKPKMVDNL
FT                   RAVLTRAGFAEPELKVLRGIISSLDRFSPAMPRGDGSPGDDPRRLPAAARAGKADADRQ
FT                   VRKPAGDDEDAPPLGGKGTDND"
FT   CDS_pept        33053..33883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0039"
FT                   /product="glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47712"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47712"
FT                   /db_xref="GOA:Q98NP9"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NP9"
FT                   /protein_id="BAB47712.1"
FT                   /translation="MMRTRRRWAAREPTMTDQPILMFDSGVGGLTVLREARVLMPDRRF
FT                   VYVADDAAFPFGAWEEPALRTHILDLFVKLLDRFAPAISVIACNTASTLVIDALRERFP
FT                   GHPFVGTVPAVKPAAERTRSGLVSVLATPGTVKRQYTRDLISKWAQKCHVRLVGSDRLA
FT                   GLAEVYMREGFVDEEAVRAEIAPCFMEHEGLRTDIVVLACTHYPFLVNRMRKTAPWPVD
FT                   WIDPAEAIARRALSLLPPVDGALPQGEPDIAVFTSGKTDFAIGRLMQGFGLSVR"
FT   CDS_pept        complement(33966..35348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0040"
FT                   /product="ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47713"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47713"
FT                   /db_xref="GOA:Q98NP8"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR040596"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NP8"
FT                   /protein_id="BAB47713.1"
FT                   /translation="MKSLTDPSQALSAGLAKIRTEFHVPGGFPVDVVAAAETAARRVPN
FT                   QHVDRTAMPFVTLDPAASTDLDQAFSIEASSSDLLLHYAIADVAWFVEDGDALDREAWA
FT                   RGETLYLPDGKAGLYPPAIAEGAASLLPDGPRPAVVFTVRVAEDGATKLDGAERAIIQS
FT                   RAKLAYDSVKASDVPADFAEMARRMAANEERRGASRVDPPEQEVERLADGTFRLSFRPI
FT                   LQSEQDNAALSLAANMAIADAMLTHKTGLFRVMSGPDDPKEQRLRNAAQALGLSWPAST
FT                   SLRDYQRTLDPADPKQAALMLEIRRAGNGASYQPYQEGVVPWHEAMAATYAHATAPLRR
FT                   LADRYVVRCALAIANGQAVPQAVTDAFAGLPKVMGRADARASQINHAAIDLAEAVMLSG
FT                   REGETFKAVVTDFVDHGVRVQLADMPVVATVKASGLRQGDRVMLKLASADPDQRSIVFE
FT                   PV"
FT   CDS_pept        35512..35700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0042"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47714"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47714"
FT                   /db_xref="InterPro:IPR021553"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NP7"
FT                   /protein_id="BAB47714.1"
FT                   /translation="MPATSKAQQKAAGAALSAKRGETKKSELKGASKGMYESMSEKQLE
FT                   EFAETKRKGLPEKKSKD"
FT   CDS_pept        complement(35797..36057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0044"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47715"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47715"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NP6"
FT                   /protein_id="BAB47715.1"
FT                   /translation="MPEGLHQRHQEGIWNKRSPISMKKFFLTLAGAAVLAGSMAVAPEP
FT                   AMARHWHGHKQVCRIIVKKRVVWRHGHRRVIVERIRRCHRW"
FT   CDS_pept        36362..36979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0045"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47716"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47716"
FT                   /db_xref="GOA:Q98NP5"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NP5"
FT                   /protein_id="BAB47716.1"
FT                   /translation="MSKRESAKYKIDRRLGENIWGRPKSPVNKREYGPGQHGQRRKGKL
FT                   SDFGLQLRAKQKLKGHYGDVSEKQFRKVYEEADRRKGDTSENLIGLLESRLDAVVYRAK
FT                   FVPTIFAARQFVNHGHVNVNGKRVNIGSYRCKPGDVIEVREKSKQLVIVLESVGLAERD
FT                   VPDYIEADHNKMVATFSRIPGLADVPFAVQMEPNLVVEFYSR"
FT   CDS_pept        37184..37999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0047"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47717"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47717"
FT                   /db_xref="GOA:Q98NP4"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NP4"
FT                   /protein_id="BAB47717.1"
FT                   /translation="MPSSVEFNKLRKRLLRLTRQAIEDFSMVEPGQRWLVALSGGKDSY
FT                   GLLALLLDLKWRGLLPVELLACNLDQGQPNFPKHILPDYLNANGIAHRIEYQDTYSVVT
FT                   NKLPEGSTYCSLCSRLRRGHLYRIAREEGCSALVLGHHREDILETFFMNLFHGGRLAAM
FT                   PPKLLNDEGDVMVLRPLSYCAEIDLEKFAAAMRFPIIPCDLCGSQEGLQRNAMKAMLED
FT                   IEKRMPGRKDTMIRALSNTRPSHLLDRKLFDFAALNQTLITGQDASDDI"
FT   CDS_pept        37989..38816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0048"
FT                   /product="monophosphatase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47718"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47718"
FT                   /db_xref="GOA:Q98NP3"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NP3"
FT                   /protein_id="BAB47718.1"
FT                   /translation="MTFDDNAIDWLASLLAEAADTEIMPRFRRLGDGDIRQKTSAADLV
FT                   TEADVNAERLITTRLRQNYPSAMVVGEEACSDDPALLDGLGDADLAFVIDPVDGTFNFA
FT                   SGVPLFGVMLGVVVKGETVAGIIHDPVGKDWLIGAKGGGSHIRHAHGSLEKVRVAASAP
FT                   ISQMTGAVSWQYMAEPDRTRLACNQTKTLSQFNYRCAAHEYRLLASGHGHFVVYNKLMP
FT                   WDHLAGVLIHAEAGGHAARFDGSAYLPSHVGGGLLVAPDRESWQELRRELWAG"
FT   CDS_pept        38893..39300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0050"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47719"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47719"
FT                   /db_xref="InterPro:IPR014587"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NP2"
FT                   /protein_id="BAB47719.1"
FT                   /translation="MKSRFAILAAALAAISFASASGAIAQERPCHSPDPVNTLKEMSEA
FT                   IYACWRPPAGTAGMSLTLQFSLRRNGTLIGKPRATYSDLGTDPQLSRAFVASILKALDE
FT                   ALPLPFSDGMGGAIAGRMLAPRFTAALEGAS"
FT   CDS_pept        complement(39311..40495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0051"
FT                   /product="bicyclomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47720"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47720"
FT                   /db_xref="GOA:Q98NP1"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NP1"
FT                   /protein_id="BAB47720.1"
FT                   /translation="MALNSLAIDIMLPALQQIGASLGVENENHRQYVVTAYILGFGGGQ
FT                   LFFGPISDRFGRRSPLVAGLIIYVAAAAAAAIAPSFETLLICRAVQGIGAAATRVIAVS
FT                   IVRDTFEGRRMAEVMSLIFMVFMAIPVIAPGIGQFIMLFATWHYIFVTMAVGALIVSAW
FT                   SLLRLPETLRPEYRRQLTVSSVLGGFRIVLTNRIALCYAFASTFIFAAMFGFIASAQQI
FT                   YVGIFNVGEMFPVIFAGVAGVLAFSNFLNSRLVGRIGMRRLSQSALLLFLVISLAWLVV
FT                   SLEIKMPLWLFITFFASAMLPFGALGANFNALAMEPLGQLAGTASSILGFMQTFLGGIL
FT                   GTLIGQAFNGTVTPLAAGFCSVSVAALLMILIAERGKMFQPHNPPISGHITDLH"
FT   CDS_pept        complement(40724..41059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0053"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47721"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47721"
FT                   /db_xref="GOA:Q98NP0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NP0"
FT                   /protein_id="BAB47721.1"
FT                   /translation="MSGINDYIDNEVKGNDVVLFMKGTPGFPQCGFSGQVVQILDYIGA
FT                   DYKGVNVLDSAELRQGIKDYSNWPTIPQLYVKGEFVGGCDIVREMFQAGELQTFLVEKG
FT                   VSVKGAA"
FT   CDS_pept        complement(41212..41445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0055"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47722"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47722"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NN9"
FT                   /protein_id="BAB47722.1"
FT                   /translation="MAMDAHDIEKLIKDGIPDAKVTIRDLAGDGDHYAAEVVAESFRGK
FT                   SRVQQHQMVYDALKGNMGGVLHALALQTSVPD"
FT   CDS_pept        complement(41568..41918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0056"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47723"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47723"
FT                   /db_xref="GOA:Q98NN8"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NN8"
FT                   /protein_id="BAB47723.1"
FT                   /translation="MLVLQNLIYAVPIVCLVFWNRLLPDPARANRIVTCIKLFAVAAVL
FT                   GALWEYGSSLVCDGYGQPFFSPVWQITSYLPIADLAVNIPLYILVFSLGRTFSMREDDP
FT                   AADAVDPGTNAS"
FT   CDS_pept        complement(42089..44320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0057"
FT                   /product="phosphoribosylformylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47724"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47724"
FT                   /db_xref="GOA:Q98NN7"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NN7"
FT                   /protein_id="BAB47724.1"
FT                   /translation="MTISNSVPITPELIAAHGLKPDEYQRILDLVGREPSFTELGIFSA
FT                   MWNEHCSYKSSKKWLRTLPTTGPQVIQGPGENAGVVDIGDGDCVVFKMESHNHPSFIEP
FT                   YQGAATGVGGILRDVFTMGARPIAAMNALRFGAPDHPKTRHLVAGVVSGVGGYGNSFGV
FT                   PTVGGEVNFDARYNGNILVNAFAAGLAKTNAIFLSEAKGVGLPVVYLGAKTGRDGVGGA
FT                   TMASAEFDDKIDEKRPTVQVGDPFTEKCLLEACLELMASGAVIAIQDMGAAGLTCSAVE
FT                   MGAKGDLGIELDLDKVPVREERMSAYEMMLSESQERMLMVLRPEKEKEAEAIFHKWGLD
FT                   FAIVGKTTDDLRFRVLHQGDQVADLPIKDLGDKAPEYDRPWIEPKKPAPLAANDIPQAD
FT                   VADALLKLLGGPDLSSRRWVWEQYDTLIQGNSLQLPGGDAGVVRVEGHATKALAFSSDV
FT                   TPRYCEADPYEGGKQAVAECWRNLTATGALPLAATDNLNFGNPERPEIMGQLVGAVKGI
FT                   GDACRALGFPIVSGNVSLYNETNGQGILPTPTIGGVGLIADWSKMVRTGFAAQDQMILL
FT                   VGAPASWGTHLGQSVYFRDIHGRTDGPPPPVDLAHEKRVGDHVRSLIASGIVTAAHDVS
FT                   DGGIAVALAEMAMASGIGATVPGLVGTDPIPVWFGEDQGRYLLTLSIDPHGDEWDAIRK
FT                   QQGELGIFAPWIGSTGGDALKLGDAKAIPVGDLKAAHEGWFPRFMDQAS"
FT   CDS_pept        44471..44740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0058"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47725"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47725"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NN6"
FT                   /protein_id="BAB47725.1"
FT                   /translation="MGPAVIRGAILRNAKANGNAMASRPLGSNPSGDQDMATKQGKKDN
FT                   RLSDKEALHIAETTDVSPGQAKELAKKHGKDKAKEEAKNFKAEG"
FT   CDS_pept        complement(44756..46168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0059"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47726"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47726"
FT                   /db_xref="GOA:Q98NN5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NN5"
FT                   /protein_id="BAB47726.1"
FT                   /translation="MTNWLPDLTGGAGPLYQRLADSVEAGIDQGVIGAGTKLPPQRDLA
FT                   YDIGTTVGTVGRAYQLLRERGLVSGEVGRGTYVLGRRADGVKPEAPDVSVEGTRYVDAP
FT                   QDKLRFDSTAAPDVGQGAVVADVLSRTAQDHPHEISSYTRDFPGRWYEAGARWLARNSF
FT                   RPAADGIVPTLGTHAAVMAAIAALTTPGDYVAFEHLTYSQISRSAGLIGRRTALVASDD
FT                   EGLDPADFERVCAQKHPRMIFLMPTAQNPTLTTLSAGRREAIARVAREYNVILIEDDLY
FT                   GHLTDDPTPLLAEYAPERTIVAGGLSKSVAAGIRGGWLSCPPAYRHRIRVAHKMMTGGM
FT                   PFLLAEVNTRLVLSGQASDIRKRCIAEISARIAIVRETLAGFAFKSHDKVPFVWLTLPD
FT                   PWLSGTFKNACLEHGVLIDDEDEFKAGRSEQVFHGVRFGTSQPRQRGDVANGVAVIRRL
FT                   LDEGRAGYDSFS"
FT   CDS_pept        46262..46513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0060"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47727"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47727"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NN4"
FT                   /protein_id="BAB47727.1"
FT                   /translation="MDTIATIRHSRAAFPSEALRPSGQRGFVRRLVRVVRSLARWIDHL
FT                   LERRRGRLALLEMTDDQLKDIGISRCDAHREGIRRFWE"
FT   CDS_pept        complement(46523..46816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0061"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47728"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47728"
FT                   /db_xref="GOA:Q98NN3"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NN3"
FT                   /protein_id="BAB47728.1"
FT                   /translation="MTPVLFVLWWLAAGADGRTRWSDISWWVLYPIAYLVYALVRAPIA
FT                   GEVPYPFLDVAKNGAASVAIAALAITALFLVISIVAVFIDRGIGHRGAKRVR"
FT   CDS_pept        complement(47167..47490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0062"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47729"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47729"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NN2"
FT                   /protein_id="BAB47729.1"
FT                   /translation="MPSGKSAALLAMEQVAISAHKCWIASKDPAFKQYQMANELNSFSG
FT                   TPRFLLVPAKHYGGKPLLVVQAQGNSSRVDVFGPLMNDPLGARIGSDIARWQTGNPGCA
FT                   ATA"
FT   CDS_pept        complement(47571..48236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0063"
FT                   /product="glutathione transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47730"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47730"
FT                   /db_xref="GOA:Q98NN1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NN1"
FT                   /protein_id="BAB47730.1"
FT                   /translation="MKLYSRPLSPYSSIVRALAYIKDVPLKIIAPPPGFPIPEAFRAIS
FT                   PMNRIPVLITGSGETIVESVVIAEYLEERFPEPALLPPDSKDRALVRMFARITDLDVLT
FT                   PTMKLFELHFVPKRNNAEIDAQFARLHHGLAGIEARMAQGPFALGNDISFADAWLTPTR
FT                   FIFNNFRAMTGHHDLLDAYPKFDAYEQIASQHPALSRVWGEMTDGLKVFLSELEMGAA"
FT   CDS_pept        complement(48307..48975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0065"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47731"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47731"
FT                   /db_xref="GOA:Q98NN0"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NN0"
FT                   /protein_id="BAB47731.1"
FT                   /translation="MKSAVVLLPGLNRDRDMIAALTKISGKPPVTVWQTDTEIPDVDLI
FT                   AIPGGFSFGDYLRCGAIAARMPVMRAVAEKAAKGVTVIGVCNGFQILVEAGLLPGALMR
FT                   NTSLKFVCRQIKLEITNANTMFTRRYQPGQVIRSPVAHHDGNYFADAETLARLEGEGQV
FT                   VFRYAEGTNPNGSINDIAGIINEQGNVLGLMPHPENLIEAAHGGSDGRALFEGALGIAA
FT                   "
FT   CDS_pept        complement(49247..49498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0067"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47732"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47732"
FT                   /db_xref="GOA:Q98NM9"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NM9"
FT                   /protein_id="BAB47732.1"
FT                   /translation="MSSVIKARITVTLKNGVLDPQGKAIEHALSGLGFDGVGAVRQGKV
FT                   FDVELAESDKAKAEADLKAMCDKLLANTVIENYSVTLT"
FT   CDS_pept        complement(49533..50327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0069"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47733"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47733"
FT                   /db_xref="GOA:Q98NM8"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NM8"
FT                   /protein_id="BAB47733.1"
FT                   /translation="MKNRRRIYEGKAKILYEGPEPGTLIQFFKDDATAFNKKKHEVVDG
FT                   KGVLNNRISEHIFNHLNRMGIPTHFIRRLNMREQLIKEVEIIPLEVVVRNVAAGSLSKR
FT                   LGIEEGTVLPRSIIEFYYKADALDDPMVSEEHITAFGWASPQEIDDVMALAIRVNDFLS
FT                   GLFMGVGIQLVDFKIECGRLFEGDMMRIVVADEISPDSCRLWDVATQDKLDKDRFRRDM
FT                   GGLVEAYQEVARRLGIMNENEPPRPTGPVLVASTDVVKGKPH"
FT   CDS_pept        50603..50923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0071"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47734"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47734"
FT                   /db_xref="InterPro:IPR009945"
FT                   /db_xref="InterPro:IPR038293"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NM7"
FT                   /protein_id="BAB47734.1"
FT                   /translation="MSSMKDREEGFERKFAFDEELRFKASARRNKALGLWAAEKLGKSG
FT                   ADADAYAKEVVVSDIEEAGDHDVFRKIRKDFDAAGVEQSDHQIRRTMDELMAQAIEQIK
FT                   NT"
FT   CDS_pept        51088..51861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0073"
FT                   /product="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47735"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47735"
FT                   /db_xref="GOA:Q98NM6"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NM6"
FT                   /protein_id="BAB47735.1"
FT                   /translation="MSLKSRLAADETLVTAWSGVPDALTVEILAKQGFDAITLDMQHGG
FT                   HHEDSVLRGLMPVLAANKPALVRIPVGRFDMASRALDFGAEAVIAPMVNSVADAKLFAA
FT                   AMKYPPLGERSWGPTYAFPRHGKGDHAEWLRDTNQRTMAFAMVETRAALDALDGILDTP
FT                   GIDGIFLGPSDFSIAWTNGATVSSTLESMMETVASVAERTRKAGKHAAIYVVEPAIAGR
FT                   VVSMGYRLLATGSEHALISLGAKTLLKDIKDSIGA"
FT   CDS_pept        complement(51900..53024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0074"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47736"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47736"
FT                   /db_xref="GOA:Q98NM5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NM5"
FT                   /protein_id="BAB47736.1"
FT                   /translation="MNGHILRAFAPSAAGGDGDNAAQSLKTSLAFVAFNGGSAVYLFFV
FT                   LSSYVLVKRYFQTREAQDLLLGATKRLPRLAGPVLVTVLASCVIFKLDLYFFQDAAAVT
FT                   QSEWLSRFGNASKVLSQETASFADAFQQGAWRTFIYGDKYYDSSLWTMTVEFWGSMLTF
FT                   ALAPIAFFLLGRWTLLSWFCIATGVFLALQVSFFFCAFPASLMLYPLLAMGLRPNRWVR
FT                   GAMMIVSLVLLGYAGSAVGIYRPFALLETAVCDDVGLRQACVAIPASIMLVYAMLSVDE
FT                   PPAWLSGKAARFLGDLSFPLYLVHVPVICSLGSWVLLASGSTALGAAAAILGSILAALP
FT                   LMTFNNWWVQALGALFNRFRRGGPMAAAPAAASA"
FT   CDS_pept        complement(53249..53797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0076"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47737"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47737"
FT                   /db_xref="GOA:Q98NM4"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NM4"
FT                   /protein_id="BAB47737.1"
FT                   /translation="MKVKDADILIVPGYTNSGPEHWQTRWQSKLSTARRVEQAEWSKPV
FT                   REDWTASVAKAVNEAERPVVIVAHSLGVAAAVQAIPQFVKPVAGAFFVAPPDVANPGIK
FT                   PKHLMTFGPYPREPLPFPSIVIASRNDPFCAFDVAEDIAGAWGSLFIDAGETGHLNQDS
FT                   GFGPWPEGSMTFAKFLTDL"
FT   CDS_pept        54043..54855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0078"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47738"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47738"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NM3"
FT                   /protein_id="BAB47738.1"
FT                   /translation="MSELPFAATTPVSVARVGLKARDAESLAAYYRRVVGLQELSRADG
FT                   AITLGAGSRPLLVLEPDASAKPDDPRSAGLFHTAFLLPSRADLGRWINHAISDKIAIEG
FT                   ASDHLVSEALYLTDPEGNGIEIYADRRPQDWKWNGDKIAMATERLNIPAVVGEVPVGDA
FT                   GWQGAPENSIVGHVHLRVGRPEEAEAWWNQEFGFDTVAKYGGQAVFLSSGHYHHHIGAN
FT                   AWQSAGAGRRDPSRSGLAWVEMRSDNVTGETTREDPWGTVIRTVPGKA"
FT   CDS_pept        complement(54935..56242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0079"
FT                   /product="adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47739"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47739"
FT                   /db_xref="GOA:Q98NM2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NM2"
FT                   /protein_id="BAB47739.1"
FT                   /translation="MIPRYSRPEMVAIWSPETRFRIWFEIEAHACDALAELGVIPKEAA
FT                   KTIWEKGGAAKFDVEKIDEIERVTKHDVIAFLTHLAEFVGPDARFIHQGMTSSDVLDTC
FT                   FAVQLTRASDILLADIDGLLAALKRRAFEHKDTVTIGRSHGIHAEPTTFGIKLAQAYAE
FT                   FSRCRERLVHAREDIATCAISGAVGTFANIEPYVEEHVAAKLGLKPEPVSTQVIPRDRH
FT                   AMFFATLGVIASSMERLATEIRHLQRTEVLEAEEYFSPGQKGSSAMPHKRNPVLTENLT
FT                   GLARMVRSMALPAMEDVALWHERDISHSSVERMIGPDATVTLDFALSRLTGVVDKLVVY
FT                   PENMLRNMNKFRGLVHSQRVMLALTQAGLSREDSYRLVQRNAMKVWEQGADFLEELLAD
FT                   KEVTAALPEAEIREKFDLGYHTKHVDTIFRRVFGEA"
FT   CDS_pept        complement(56401..56919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0080"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47740"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47740"
FT                   /db_xref="GOA:Q98NM1"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NM1"
FT                   /protein_id="BAB47740.1"
FT                   /translation="MTPHAAILSRNLNFVRRALPGWRATLFGSLFWAATMGTSALINLL
FT                   LDNWVTPEKIRTVSLLFAGGGALAFPVGLFVARLVSLGRRREVAFAATMVCLAAATIGL
FT                   TDGLYALQYRSYYAEWHAPVFTLTWGFQLAFTMAVASYQFMVLGIRLYFPLGFIALFAA
FT                   SLWFAQQRR"
FT   CDS_pept        complement(56916..57590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0081"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47741"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47741"
FT                   /db_xref="InterPro:IPR018725"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NM0"
FT                   /protein_id="BAB47741.1"
FT                   /translation="MIVAQAGDVAELEILGFSKDGGVFAFEEYGVQDGSGFPYANRYYI
FT                   DTSTDSFLKGTPIRVRLDDENAKLDAARLQARQKGEAIVSQAELSANRGITAGFNPVTE
FT                   LSADPHRMAVNPRPIFSPVDQPLEFRLDEIGMNNTEGCDSQGEINGFRLLRIEAQDGGT
FT                   TKLLHEDKSIPKSRSCPNGYRIGAVQTFSMDSLSAYAVLIAVRQYGFEGPDFRWIAVTG
FT                   RL"
FT   CDS_pept        57770..58024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0083"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47742"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47742"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR018684"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NL9"
FT                   /protein_id="BAB47742.1"
FT                   /translation="MTDTSKIREHMEVVGADGVHLGTVDKVDGQRIKLTKADSGEGAHK
FT                   GHHHYIPLALVAEVDGKKVWLSANSDVAVTFEEEKSDPV"
FT   CDS_pept        complement(58034..59059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0085"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47743"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47743"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NL8"
FT                   /protein_id="BAB47743.1"
FT                   /translation="MFHTGPRNLITDVAGLRVGNSSDARLKSGVTTILCDEPAVAGVQI
FT                   LGGAPGTRETDLLEPHNSIEAIHAVVLSGGSAFGLDAASGVQAALRERGVGFEVGGFRV
FT                   PIVPAAILFDLRNGGDKDWGRYPPYRDLGYEAAQSAATDFQLGTVGAGTGALTAGLKGG
FT                   LGSASTLLDTGVTIGALAAVNPTGSVTVGRTRHLWAAPFEIGDEFGGLGYPSPMPADAK
FT                   EILLKYRDKHAGKQMETGGNTTIAVIATDAVLTKAAAKRLAMSAHDGFVRAIWPTHTPA
FT                   DGDLVFALATGTSGIRLEADAAIDLYAAAGATMARAIGRGVFAATPADNDLFPVWSSRL
FT                   G"
FT   CDS_pept        complement(59059..60126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0086"
FT                   /product="amino acid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47744"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47744"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NL7"
FT                   /protein_id="BAB47744.1"
FT                   /translation="MRPGATISAALAWLFLAGAASAQTLTIGVAAPLSGPSAILGKQIE
FT                   AGAALAAQADGVELKTEDDACTADGGAAAARVFAAAKVSVVIGFLCTEAIEAAMPILKD
FT                   ANIPVITVGVRTESLTDRRAKTGWPVYRLGPRGDDERNAVASTLTHLWQKELFAIIDDG
FT                   TIYGREMAETFRAAAEQAALKPVFVDTFRPQLDNQIGMIGRLKKAGATHVFAGGDGDDI
FT                   AIMGRDAAQLQAGIVFAGGENLRTPPGDVPYATGTLMIAPPEWADVADAKVLESFSVQK
FT                   IVPDGYTLPAFAAVEIAKAASTLSPGKPLTEVLSGHDFATAIGPVRFDAKGDLSQSPYR
FT                   VFRFDGARFVPLESN"
FT   CDS_pept        60308..60835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0087"
FT                   /product="monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47745"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47745"
FT                   /db_xref="GOA:Q98NL6"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NL6"
FT                   /protein_id="BAB47745.1"
FT                   /translation="MLKKNDIGPQAYRDAMSHFAGHVHVVTTDGPAGKRGTTVIAACSV
FT                   SDTPPTILVCLNRENANNELFVKNGRFALNTLASHQEPLSIGFSGITGLPVEERFALGE
FT                   WDVISTGAPTLKGALAVFDCELIDTKDLATHRVLFGKVTGLRMGDNLRPLIYHARGYHV
FT                   LDSGAAAFTEKE"
FT   CDS_pept        60832..61761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0088"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47746"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47746"
FT                   /db_xref="GOA:Q98NL5"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NL5"
FT                   /protein_id="BAB47746.1"
FT                   /translation="MTELKPRPVPRTIDETLDLLTGADYVADRSLATVLFLSLRMNRPL
FT                   FLEGEAGVGKTEIAKVLAQALGRRLIRLQCYEGLDVSSAVYEWNYAAQMIEIRMEEAAG
FT                   KVDRSAMERNVFSEKYLIRRPVLDALTGKTGAAPVFLIDELDRTDEAFEAFLLEILSDY
FT                   QVTVPELGTIKAQEPPIVIITTNRTREIHDALKRRCLYHWVDYPNAERELEIVRRKVPR
FT                   ANQRLSAEVVSFIQKLRQIELFKVPGVAETIDWAGALTELDKVALDPETVSDTIGVLLK
FT                   YQDDIARIGTGEGRRILDEVKAELAAAE"
FT   CDS_pept        61766..63031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0089"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47747"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47747"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NL4"
FT                   /protein_id="BAB47747.1"
FT                   /translation="MKAPGAYPKEADPKEATADGRIADNIVYFARTLRKAGMRVGPASV
FT                   KDAIEAVLAAGIGSRDDFYWTLHAVLVSRHEDHPVFDEAFRLFWKSRELIEKLLAMFSP
FT                   VAPDVREKQKPRAAENRVSQAMFEGHQKNQPPQEVPEIEVDARFTFSGNEVLRGKDFAQ
FT                   MNVAEIADAKKAIAELRLPFDMVRTRRFKADAHGRRIDPRAMMRSAARTGGELILPKFR
FT                   SAREVHPPLVVLADISGSMSQYTRIFLHFLHALTEKRRRVHTFVFGTRLTNLTRQMRHR
FT                   DPDAALADCSAAVKDWSGGTRIGDTLAEFNLAWSRRVLGQGAVVLLITDGLERDDVAGL
FT                   SQEMERLHKSCRRLIWLNPLLRFDGFQARARGVKAMLPHVDEFRSVHNLDALADLCASL
FT                   DKKSAQSVDPRRWMEAGARQAA"
FT   CDS_pept        63082..63420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0091"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47748"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47748"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NL3"
FT                   /protein_id="BAB47748.1"
FT                   /translation="MNDSLYLDEARDPLIIAEGWMKDGKDVAIATVVETWGSAPRPVGS
FT                   HLVIDADGNFHGSVSGGCVEGAVVSEAVDVIGSGKARMLEFGVADETAWQVGLSCGGRI
FT                   KVYVERLG"
FT   CDS_pept        63427..64164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0092"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47749"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47749"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NL2"
FT                   /protein_id="BAB47749.1"
FT                   /translation="MDPYALKALNAERRARRAAILVTDLGDGRDRIVREGDQVAGDLGA
FT                   AIAKAFRSGNSGSVEAEGRTFFLNAHLPQPRLLVIGAVHISQALAPMAKIAGYPVEIID
FT                   PRTAFATPDRFPDVALHAEWPEDVLKRQPLDSYTALAAVTHDPKIDDFALKAALDANCF
FT                   YVGALGSRKTHAKRVERLLALGAAADQIARIHAPIGLDIGAASPAEIAVAILAQTIYAF
FT                   RSRGLDVSASAQRSESILEKHDA"
FT   CDS_pept        64231..65841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0093"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47750"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47750"
FT                   /db_xref="InterPro:IPR012184"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NL1"
FT                   /protein_id="BAB47750.1"
FT                   /translation="MKFGPIAIEEAEGAVLAHSTTAGEKRFRKAHRLSAEDISVLKRAG
FT                   IVQVVAAVLSPDDLGEDAAAQRIAESMRFSGIEARPAATGRVNLHAKASGIFTVDAAMI
FT                   DAINAVDPAITLATLAQHAPVEKGQMVATVKIIPFAVASTLVDTVVKICAGGEILAVNA
FT                   YQPVRVGVIQTVLPGIKPSVLDKTLRVTEARLARSGGRLTAERRTPHEIAPVAEAAASL
FT                   ARDNDLVVIFGASAMSDFADVVPAAIERAGGTVVRAGMPVDPGNLLVLGTLGGKRIIGA
FT                   PGCARSPKENGFDWVLDRLVAGLDVTAKDIAGMGVGGLLMEIPTRPQPREPLPAKSRLK
FT                   VGIVLLAAGRSSRMGGPNKLLALFDGKPLVRRTAERALGSKASGTIVVTGHQRERVRAA
FT                   LSGLDVTFADNPDFANGLSTSLKAGIAYLPEDTAGAMIVLGDMPGVVSGDLDRLIDAFR
FT                   KAGGNSVVRASHQGKRGNPVLLPRALFPAIAHLEGDTGARHLVEAEGLDVVDVEIGEGA
FT                   SVDVDTREALEGAGGVLQD"
FT   CDS_pept        65874..66773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0094"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47751"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47751"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NL0"
FT                   /protein_id="BAB47751.1"
FT                   /translation="MAFRFLSPLHGFLAAVSVLCLAGQANALELKPFKDDLFAYPATLS
FT                   TGDGGAYTVIDYREMRDINQRDVVPEKRVHPQYTDTGVRKVQQDLMLKTDAGDVRHVAV
FT                   GKTEGAALIVLYLHGQGGSRKQGVDDFTFGGNFNRLKNLMADNGGLYLSPDFPDFGDKG
FT                   AAQVAALIDHYAEQSPGAKIFVACGSMGGALCWKLAARNDTGRRINGLLLLGSLWDESF
FT                   LASPAFRRHIPVFFGQGSHDVVFPVVNQEAFFRSIIARSKAYPYPTRFVRFETGTHGTP
FT                   IRMVDWRSTLNWMLSKAP"
FT   CDS_pept        complement(66795..67847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0095"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47752"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47752"
FT                   /db_xref="InterPro:IPR009560"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NK9"
FT                   /protein_id="BAB47752.1"
FT                   /translation="MRRVLLAATAFLSLTISGQAALAADDAPEAPYVDDRSSAEAVIRS
FT                   LYSAINRHEFARAWGYYGDTKPAKDFDSFVKGYDGTDKVEVTTGAISDDGAAGSIFYNV
FT                   PVAIRATDKSGGEKVFAGCYTLRQVNAQAQAAPPFDPIHIEKGALKPSTADFEAALPPS
FT                   CGDGPPPPKKDTALEQARKAFLATYGDQCDKQFLGNEPEVFSIKYKDKDARPGDPDKEA
FT                   RLFRFSCSAAAYNESSVYYMTDELSEVRQLQFAEPKMDIRYENNNSDGKLLGMSIVGFE
FT                   TTGWAVNSDYDPDTHTITTFDKWRGVGDASDSGTYLFRNGDFSLVQYDVDASYDGQENP
FT                   QTVVDYNTAP"
FT   CDS_pept        67898..68494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0096"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47753"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47753"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NK8"
FT                   /protein_id="BAB47753.1"
FT                   /translation="MVTRCLRRLKNRVRRRYVASPAFRPDRRSDVTISMYEASVPVFST
FT                   RLKALSNVLAAAEQNALDRKIDPQVFLTARLAPDMFALTRQVQIATDHAKGAPSRLAGR
FT                   EVPKYEDNEASFADLEARIAKTLALLATFSAADIDGSDDKVIELKLGGRETTLAGMQYL
FT                   LHVAMPNFYFHLTTAYDILRHNGVPLGKATFLGSR"
FT   CDS_pept        68666..68758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0098"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47754"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47754"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NK7"
FT                   /protein_id="BAB47754.1"
FT                   /translation="MFLRARPGEHFREETHESGSWLVLHASQYR"
FT   CDS_pept        69421..69561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0099"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47755"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47755"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NK6"
FT                   /protein_id="BAB47755.1"
FT                   /translation="MRRSFAFTNHPDRVAPHLRQRAMIRMQVANMLIDEAKRRAVAGAR
FT                   R"
FT   CDS_pept        69673..70740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0100"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47756"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47756"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NK5"
FT                   /protein_id="BAB47756.1"
FT                   /translation="MHKRRLGRTDLLVTQICLGSMTWGQQNTEAEGHAQMDLAFSRGVN
FT                   FIDTAELYPIPPKAETQGRTEKIIGSWMKAKGNRDKVILASKVVGRTANSWFRGDRPSQ
FT                   LVRADIFDAVDKSLAKLGTDYLDLYQIHWPERDIPWGANPTRIGAVARRADADGAPANE
FT                   TPIAETLGVFDELVKAGKIRHFGLSNESSWGVMRFLAEADKGVGPRVASIQNAYNLVNR
FT                   TFEVNLAEVCEREQVSLLPYSPLAQGYLTGKYDHGARPQGSRSQLFNRGQRYETPNAAE
FT                   VLLEYNELARSFGMEPALFANAYVSSRPFVTSNIIGATTIPQLEMALSSVDVVWTEEMQ
FT                   KAVDAIHQRVGNPCP"
FT   CDS_pept        70772..72049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0102"
FT                   /product="aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47757"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47757"
FT                   /db_xref="GOA:Q98NK4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NK4"
FT                   /protein_id="BAB47757.1"
FT                   /translation="METMVDFPIEAVRGQFPALSLTDKGRRRIYLDNPAGTQVPQAVAD
FT                   AVSRCLLTTNANLGGYFETTIAAQSVVDDAHRAMADFLGAASPEEIIIGANMTTLTYHM
FT                   SRTLGRTLKPGDEIILTRMDHEGNVSPWLQLAEDLSLVVRWLPFDEKSWQVEEAALTGL
FT                   LSDKTRLVALNYASNLTGSINRVKALTAIAKRAGALVYVDAVQFAPHGLIDVQDLGCDL
FT                   LICSAYKFFGPHMGILWGRREIIDGLKPYKCRCSSNGLPERFELGTPQIELMAGLMAAV
FT                   DYFAGLGVAAGEGGSRRQKIARAFEVSIAYENPLAQRLIDGLSDIPGLTIHGITDRKRL
FT                   ADRVPTVSFTVDGIVPETIVRQMNAENIFLWSGHNYAWEIVHQLGIPAEQGVVRIGIAH
FT                   YNTAAEIDETLESVHRVIAMLRQQRS"
FT   CDS_pept        complement(72065..73093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0103"
FT                   /product="acetylpolyamine aminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47758"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47758"
FT                   /db_xref="GOA:Q98NK3"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NK3"
FT                   /protein_id="BAB47758.1"
FT                   /translation="MKAFYAEEQKRHDPKAFLSSGAAQPNPEKPERVEKLLAGAKSAGC
FT                   MIEQPRNHGLGPVSAVHTPEYLDFLEHIFERWQRIEGASAEVIPNIHPIARNGSYPASA
FT                   VGQAGYHMADTACPISGETWQSALWSAWSAVEAAEAVMAGAPAAYALCRPPGHHAFADV
FT                   AGGFCFINNSAVAAQVLRKQAARVAILDVDLHHGNGTQGIFYARPDVFTVSLHADPVRF
FT                   YPFFWGHADERGEGPGLGYNFNLPLPRKSADAAFLEALGVAFQRIRAFSPDALVVALGL
FT                   DAFEGDPFGGLSVTTPGFSRIGEAIGKLGLPSVVVQEGGYLCDALSDNLTAFLTGFGGK
FT                   VR"
FT   CDS_pept        complement(73090..73611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0104"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47759"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47759"
FT                   /db_xref="GOA:Q98NK2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NK2"
FT                   /protein_id="BAB47759.1"
FT                   /translation="MTDKVQTKTSDIVIRPGRIDDAETIHAALLKLGAHIGAHQEITST
FT                   SDDLRRYGFGDKPAFSTLIAEVGGEFAGLCLYFPIFSTWMGRPGVYVQDLYVEDRFRGR
FT                   KIGERLLRRVAAECRKEGGVYLRLSVDTDNEGAKAFYERLGIAWSSYEQTQKIIGDAFF
FT                   AFADAPEEQE"
FT   CDS_pept        complement(73615..74118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0105"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47760"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47760"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NK1"
FT                   /protein_id="BAB47760.1"
FT                   /translation="MERVLVSACLLGSHVRYNGSYRLDGHPVLTRWQAEGRVVQICPEV
FT                   AAGFSTPRPAAEIHGTADAVLDGQGRVVEQTGSDVTALYLEAGQLALELARETGCRYAV
FT                   LTDGSPSCGSSFVFDGSFSGKRVAGRGTTAALLEANGIRVFSEDSIGDLDALLNRPGSV
FT                   ETTA"
FT   CDS_pept        complement(74139..75068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0106"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47761"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47761"
FT                   /db_xref="GOA:Q98NK0"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NK0"
FT                   /protein_id="BAB47761.1"
FT                   /translation="MAPRKVIITCAVTGSVHTPSMSPYLPVTPDQIASDAIAAAEAGAS
FT                   ILHLHARDPKDGRPTADPDVFMQFLPRIKQATDAVINITTGGSSLMTLDQRLAAPLRAE
FT                   PEMCSLNMGSMNFALFPMLDKPREWQHEWEPKLLEATRDTIFKNTFADMEGVLERLGKG
FT                   CGTRFEFECYDVGHLYSLAHFRDRGLVSGPLFIQFVLGILGGIGADPDNLVHMKRIADK
FT                   LFGDSYQFSVLAAGRQQMPLISIAAAMGGNVRVGLEDSLYDGRQLAKSNADQVRRIRGI
FT                   LDGLSLEVATPAEAREMLALKGGDRVAF"
FT   CDS_pept        complement(75072..76457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0107"
FT                   /product="aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47762"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47762"
FT                   /db_xref="GOA:Q98NJ9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NJ9"
FT                   /protein_id="BAB47762.1"
FT                   /translation="MSKTQTADQITEARRESHLFYLSSLRRPLIDRAEGIYMWTQDGRR
FT                   FIDGSSGPMVANIGHSNRNVLDAMKRQMDRATFAYRLHFENEPAEELARELAKKLPEGM
FT                   DRIFFVSGGSEATESCIKLARQWAVATGQASRWKVITRFPSYHGGTLGSLSITGDDALA
FT                   ETFEPMMRVMPTVPAPTAWRDRDNLSMEQRGVRYADMLEEKILAEGPESVVAFIMEPIG
FT                   GAATAALVAPDSYYARTREICDHYGILLIHDEVMCGAGRTGKFLGGDHWNCKPDIVALS
FT                   KGLGSGYAPLGALAAPMRLVQPLLASGGFQHGHTYAGNPLACAAGLAVLGEMDRLDLIA
FT                   NAAAMGDVLMDGLKGLAKRFPFIADVRGKGLLTGAEMVADPETLRPIEQGKKATQRLLD
FT                   LAYERGLIIYGRRVKGGVDGDNFMVAPPMIVTSEQVGEIISIIGDSLEVLASELDLPVE
FT                   GRG"
FT   CDS_pept        complement(76459..78006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0108"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47763"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47763"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NJ8"
FT                   /protein_id="BAB47763.1"
FT                   /translation="MDGERGEIWCYSDRFSYRPGEMVTLHVSSTAPSFSMAIIRDGGTE
FT                   TKVFEKSGIAACWQDTPDQCSAEGCGWEASFEFRVGSDWPSGAYRVTLTSVGHDGRPIH
FT                   GYHLFIVSPQPGKKPGRVLQVAATGTWLAYNTWGGSNHYQGITGPDRNQYSPVVSTQRP
FT                   WCRGFVVLPKDAPRVPLKVAVPPKTVPRYPHMEWALATGHSKKYASSGWASYDSHFLRF
FT                   AEQAGYAVDLASQHDLHFSPDILDGYDCAVFVGHDEYWTWEMRDAVDNYVERGGHAARF
FT                   AGNFMWQTRLEGEGRRQVCYKYRARAEDPAYRGGDVTRATNSWEAPEIGRPGSATFGLN
FT                   ATRGVYAGWGGCAPRGVRGFPVYRPEHWAFAGTGIYYGDLLGADGHVYGYEVDGLDFEI
FT                   RGGLPYPTATSGAPDGLQVLAVGMASQVEESADIPIEDQFLTDEDGRFTAETLFGEASD
FT                   ANLEKVKRGNGMIVNFPRGKGEVFHAGSCEWVAGLLRQDPMVERVTRNVLDRYLGKS"
FT   CDS_pept        78156..78503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0109"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47764"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47764"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NJ7"
FT                   /protein_id="BAB47764.1"
FT                   /translation="METIGPAIAWPPLAAQGKATISGEAVCSAWGASMLRVQKVKVDEI
FT                   YVPTARKKTLHPETVRHLAEDILENGMKTPIQVRHDGKRHILVEGLHRLEAARWLGETE
FT                   IDAYLVQAKRH"
FT   CDS_pept        78525..79106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0110"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47765"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47765"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NJ6"
FT                   /protein_id="BAB47765.1"
FT                   /translation="MESLSIIFRWFVGLRSVGSSLGRKPDQTEETTLTTKLDIAPANDR
FT                   ELVVARIIDAPRENVYRCWTDTRLLTQWFSPKPWTTPRAEMDMRTGGSSLVIMADPDGN
FT                   EFPNPGVFLEVIPGKKIIFTDAYTQAWEPSEKPFMTGVLTFEDEGEGRTRYIARVRHWS
FT                   VADRERHEAMGFHVGWGQCTDQLEDLARTL"
FT   CDS_pept        complement(79141..80169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0111"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47766"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47766"
FT                   /db_xref="GOA:Q98NJ5"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NJ5"
FT                   /protein_id="BAB47766.1"
FT                   /translation="MTQDIETIGIADLFGPPSPGRDRADISIMAAASGIGFMAVRDFPG
FT                   DAWLMPERRAQLLHIFALPDTEKQKLLRWNFDRTRKNVYRGWFSLQPTAVSYKEGIDMG
FT                   PDIADAAGVSASDDPLCEPTPLPTEDALPGWRAAAADYYRAMETVSNALMRSIARGLDL
FT                   PETIFDSYFEHGISTLRLIRYPLRDANAGIDISGPEFSVVHKGETRTIIGREHADSGFV
FT                   TLLAQDGVEGLQAKNLAGEWIDVPPANSTLAVNFGQLLERWTGGRVRATRHRVIAPKTA
FT                   RFSIPFFYEPRVDAEIAPLPLSGAEPFEPFLYGDYLWEAATNFVEMAGIKHLRQPRRAK
FT                   AS"
FT   CDS_pept        80276..80674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0112"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47767"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47767"
FT                   /db_xref="GOA:Q98NJ4"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NJ4"
FT                   /protein_id="BAB47767.1"
FT                   /translation="MAKHQGGCLCGAVRYSTDAAPINERICHCRLCQKAIGAAFNARVL
FT                   FRIDDVTIEGPLATVNTSPDLKRGFCPDCGTTMFSRRDSAGIIGITTGSLDDPTFFRPQ
FT                   MHIFTASKQPWVVLDDGLPQYEGAPPPG"
FT   CDS_pept        80792..81037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0114"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47768"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47768"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NJ3"
FT                   /protein_id="BAB47768.1"
FT                   /translation="MLRGPASRRRRMNDSISTLDELLSDPMVLLVMERDRVRPEQVRML
FT                   LERARNRAPDGARADQPVVPPAHIVARGCFQQWLRG"
FT   CDS_pept        complement(81044..81949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0115"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47769"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47769"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NJ2"
FT                   /protein_id="BAB47769.1"
FT                   /translation="MLTALSELQPLPEPHSPAIAIEDVSRDLSRIIERAEVNAWLDLYA
FT                   AAPADFAARQGLSIAGEGDLAWTTCTTIPFVHFNCVKNFGVDSPASESQLDALLAHYRA
FT                   AGISRPWFYVNPHAEPSRLRCWLEARGLQRQGGWERIYRDAEPLSSEPLFTVDGVSVER
FT                   VTKASASEWAGFIDKSYRLPTTPWLLALVDRQGWHHYMAKRDGAVAAVRSLFIGVDGAA
FT                   WSGIEAPVPGIMAPSFDLDAVLGEALVRDGIAAGAKLFVADIEAPHEERDGPAYRNYAR
FT                   LGFRIAYFRSHYSYLPPSSN"
FT   CDS_pept        82193..82987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0116"
FT                   /product="integral membrane lipid kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47770"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47770"
FT                   /db_xref="GOA:Q98NJ1"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NJ1"
FT                   /protein_id="BAB47770.1"
FT                   /translation="MQGITELLPISSTAHMRIVPALLGWQDPGSAFSAAMQLAALAAVI
FT                   SYFWGDVRDLLFGSLDALTRRDFSDRHFRLASWIVLATIPIVIAGVALSGVLNACNSPL
FT                   RSLTVIGWSCIAMAILLALAEIFARHKRTIAEASLADALLVGVAQIGALIPGVSRSGST
FT                   LTAALGLGFKRAEAARFSFLLGLPAIALAGLKELWELHKVHLDAHGWSVLATGLVVASI
FT                   SAFFAIWGLMRVLERFSAWPFVIYRGLLGVVLLLGLAMGWLA"
FT   CDS_pept        83132..83740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0118"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47771"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47771"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NJ0"
FT                   /protein_id="BAB47771.1"
FT                   /translation="MGWRRKAKGLAVALAVFCAVAGSAHAAPASMVVGGSTSQPIGHYD
FT                   FCKIHVAECSIRSPDSVPEHLTSKLLHDISAVNLSVNTRVKPMSDMDNYGKDEWWAYPD
FT                   NGFGDCEDYALEKRRELNSLGIAIANLLMTVVRKPDGEGHAVLTVRTDKGDFILDNLTD
FT                   KVRLWNQTSYRYLKRQASDNTGHWVSILGGDEQLVSAVK"
FT   CDS_pept        83867..84658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0120"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47772"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47772"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NI9"
FT                   /protein_id="BAB47772.1"
FT                   /translation="MDFLTFFSSAPLLLGAVKAALPQAVASTMAFSQWFVSLPPCRDFA
FT                   FEATSYLICEVDPKLYSIELFWKDPVGKPFQSLHNLDAAQRAAGRTMLFAINAGMYHPD
FT                   LRPVGLYVERGREMAGVRTGSGSGNFSLQPNGIFYISGGKAAVRATRDFVRKRPSTDYA
FT                   TQSGPMLVIDGQLHPKFQSDGTSRKTRDGVGVRKDGVAVFAISNGTVNFHTFARLFRDA
FT                   LGCDNALFLDGTISSLFAPAIGRNDDYWNLGPMIGVFRKRG"
FT   CDS_pept        complement(84642..85283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0121"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47773"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47773"
FT                   /db_xref="GOA:Q98NI8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NI8"
FT                   /protein_id="BAB47773.1"
FT                   /translation="MQAFIDQSVCFIENHQAWAGLVVGLLAFGESLVLVGILLPGTTVL
FT                   IIVGGLVGAGIVQPLPVLLAAMVGAALGDTISYFLGKWLGRSVVHKWPLNRYRREVARA
FT                   RLFFHRYGFAAVFVGRFFGPVRATVPLVAGMMGMHRRRFQIANILSAIIWAPVVLSPGW
FT                   LVAKGAGSIPELDVTSLFGLAAIGVVALIIIAVIALKLRRKRTAAPSRAS"
FT   CDS_pept        complement(85308..86357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0122"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47774"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47774"
FT                   /db_xref="InterPro:IPR009842"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NI7"
FT                   /protein_id="BAB47774.1"
FT                   /translation="MAVETRAALAAGISHDFYKRHPMIALQRLLLVPLLAVLSCGGALL
FT                   AEAAHASALIVVPPGNRSETQPRIPDASATRTRAFKTTYAEKYEKIVALLKREKKLVAH
FT                   IKQVAAAYDIDPIHIVGALVGEHTYNVTAVGSVQTYYVKALSYSGLDFAFRYKGVPVQT
FT                   FVQRPEFAGCAQAKDSASLWSCRDRVWVDHFRGKTVDGVTYDAMTFQQAFFQPFFAGQT
FT                   FGLGQISPLTALEVTDLVNKVSGYDKLTPDHPQAIYRDVMDPDRSIVYIAAIVRDAIDA
FT                   YKEQGFDVSDNPGITATLYNVGQPRQRAADLRAALASGKGRKLPAENYYGWLVNDKLDE
FT                   LRSLLDSGS"
FT   CDS_pept        complement(86439..86642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0124"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47775"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47775"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NI6"
FT                   /protein_id="BAB47775.1"
FT                   /translation="MVSFDGFCMSSASMPDVDEQPARHSDAITKLMAPGNRIWTCTQNT
FT                   TDRRQWPTDNRASYEREITNKV"
FT   CDS_pept        86650..87603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0125"
FT                   /product="lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47776"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47776"
FT                   /db_xref="GOA:Q98NI5"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NI5"
FT                   /protein_id="BAB47776.1"
FT                   /translation="MVRPSAPIASVPVSKASNARKPAEIAPEDGPDRPFGLAEEETVAL
FT                   SAPALPDNVDPPVEPAALVSPPKLLSRAAPAMLAGPVTRYGFRDAKPINFGRSSPRHLA
FT                   VHGVDVSRWQGDVNWEKLRAQGANFAYIKATDGGDHLDPMFMRNWRNADAAGLKRGAYH
FT                   FFYWCRTAGEQADWFIRNVPKVDGALPPVIDVEWNGDSSCKRRPSREKVLEKMQVFMDK
FT                   LERHYGQRPIIYTSPDFYRDNLQGAFLDYPFWLRAVARHPSKVYPGRKWLFWQYSGSGL
FT                   SHGVTGRVDLNVFHGDERQWRAWAGGGGRQMMADAD"
FT   CDS_pept        87751..88011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0127"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47777"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47777"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NI4"
FT                   /protein_id="BAB47777.1"
FT                   /translation="MLGWVGSDIGELVDDVGVVVGFVTHGRFPVVIFQTFPFDPIRRQI
FT                   VPISLRRVNGRPTAHPTGPTALSWMTATRFVEGGKSQNRGK"
FT   CDS_pept        complement(88242..88625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0128"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47778"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47778"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NI3"
FT                   /protein_id="BAB47778.1"
FT                   /translation="MIDHITIEVPDLERSKLFYERAFAPLGYRLSFGKEGVFWAFDVGN
FT                   GCLFEIQRTGEAPPLTHLHVAFRVGSKAEVDAFHQSALAAGAQDNGAPGPRPDYAENYY
FT                   ACFVLDPDGYNIEAMINEPAASS"
FT   CDS_pept        complement(88658..89569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0129"
FT                   /product="transcriptional activator; AmpR"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47779"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47779"
FT                   /db_xref="GOA:Q98NI2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NI2"
FT                   /protein_id="BAB47779.1"
FT                   /translation="MSWELPPLGAIRVFEAAARLGSFTKAAEELGMTQSAASYQIKVLE
FT                   ERAGTPLFIRKTRQIALTEAGQQLAPHASGAFSALADAWVATKGGATGVLSVTTMETFA
FT                   TNWLAVWLGTFQLMHPDLAVKVNTSPRLVDFTREDMDIGIRTGTGNWSGLTAHYLFKAD
FT                   YTPMLSPKLAESVGGIRRPEDLYKVPLCCADDPWWKIWFEAAGVPFEPDRVIAGPMLGS
FT                   QAYDAMAALTDRGAAILTRNIYSALLANGQLIQPFDVLGSDGDGYWLVHLESRRNVPKI
FT                   KVFRDWVLAQTAEIRAQEGRQT"
FT   CDS_pept        complement(89576..89818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0131"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47780"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47780"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NI1"
FT                   /protein_id="BAB47780.1"
FT                   /translation="MAVEDADVAQEMIRQRTLVKQAAAAGPERRGEEIEHRTSKRVVEG
FT                   GGHCRGPFGFGLMTRSCLFTALDSNRTSHTMHQED"
FT   CDS_pept        89882..90487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0132"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47781"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47781"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NI0"
FT                   /protein_id="BAB47781.1"
FT                   /translation="MDVSQTLAKSRQTISAYEDYADRYDAIVRHVPNEREQASLKRLVA
FT                   IAGTSGRILEVGSGAGYDADFLEGLGVKVRRTDATKRFLELQAARGKHGDLLDLLTDDL
FT                   GGPYDAVLALAVLIHVPRDQTDQVLAKIARSLRPGGAFLVSMRNGDGETDSNYHTVLWR
FT                   RDDFAVRLEAAGLVLLRDDFNVGRNSEEWNTFLAVRPS"
FT   CDS_pept        90601..91572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0133"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47782"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47782"
FT                   /db_xref="GOA:Q98NH9"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NH9"
FT                   /protein_id="BAB47782.1"
FT                   /translation="MELELKFLLVGFACAVSGMLSLITFVKWREVQALSRWLPTPGKII
FT                   SSRVEAREVRSSGAGSDSTDTTEMRNFPAITFEYKVGGKKFQSSRYSVKENLGNFEVRE
FT                   TLAQFPRGAEVTVFYNPADPSKAVIERTMPDGAFKFMFQLSAGLVIGTAVLVFSVGGVL
FT                   EAIRPHLPKPQNLGAAALLLFMGLFALRMGFAQKSLAEQAAKWPVAAGRIDASGLQALR
FT                   THSSYQRWRTVFKSRIVYSYGVAGQCYSADRVTFGATVTASLPGLVSAQARNYAEGGKV
FT                   DVHYDPANPGSAVLECRVRGLWLLWVCSAGFLGGAAWLVGLV"
FT   CDS_pept        91615..91809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr8578"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47783"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47783"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NH8"
FT                   /protein_id="BAB47783.1"
FT                   /translation="MIVRKLACVFLGRPDPAGERQGMPAEPRHLPRAALGSTEWADFAN
FT                   ANPDGSAWDAFTLTRCSDD"
FT   CDS_pept        complement(91907..93019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0134"
FT                   /product="probable acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47784"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47784"
FT                   /db_xref="GOA:Q98NH7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NH7"
FT                   /protein_id="BAB47784.1"
FT                   /translation="MEMVGNTNSSRLASLDLLRLIAALAVVCFHYLYRGPIAGDIDAGY
FT                   PAAAPFAIYGYLGVSLFFLISGFVITWSAEGRKWQDFAVARFVRLYPGFLLCMTLTFVV
FT                   LSIANNPRFPTNFSTYVANLSMFARAFGRPSMDGVYWSIMLEIVFYGWVAALIFAGAFQ
FT                   RWKLAIVAIWLVISAGNELFFGNTAIRILLITSYAPFFAVGILAQQVVAKGRSPAALIL
FT                   LVAAFLLSCQTITFNQGWMQEHYGMAIPYPALLVANGVVFGIFAGALLIRSLVAPSKTV
FT                   LMLGGLTYPLYLLHQYIGYLSLNALAPLIGKNAAFFVVLLAVLLASFLIWRFVETPLRK
FT                   PLIRGLTSAIDHIASAGSAYARRNRPVART"
FT   CDS_pept        complement(93870..97808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0136"
FT                   /product="ribonucleotide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47785"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47785"
FT                   /db_xref="GOA:Q98NH6"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013678"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NH6"
FT                   /protein_id="BAB47785.1"
FT                   /translation="MTEASREAQAANAGGDRGMESRPFSNAGRRRTCAFRIRGRNPWGK
FT                   ALYIDKRTGPMRIERRFTKQGQSAYAEIEFRKALSEIKNPDGSVVFRLDNIDVPAQFSQ
FT                   VAADILAQKYFRKAGVPARLKKVEENDVPSFLWRSVADEAELAKLPEAERYGSEIDARQ
FT                   VFDRLAGTWTYWGWKGGYFKSEEDARAFRDELAYMLATQRVAPNSPQWFNTGLHWAYGI
FT                   DGPSQGHFYVDPFTGKLTKSKSSYEHPQPHACFIQGVQDDLVNEGGIMDLWVREARLFK
FT                   YGSGTGSNFSLLRGEGEKLSGGGRSSGLMSFLKIGDRAAGAIKSGGTTRRAAKMVIVDA
FT                   DHPDIEEFIDWKVNEEQKVASLVTGSKIVKKHLEAIMKACVNCEGNGEDCFDPAINTAL
FT                   KREIKAAKKSAVPENYIYRVIQFAKQGYKSMSFKTYDTDWDSDAYLTVSGQNSNNSVSL
FT                   KDNFLRAVEDDADWHLTARKDGKVLKTLKARDLWEKIGYAAWASADPGLHFNTTMNDWH
FT                   TCASAGAIRASNPCSEYMFLDDTACNLASINLLPYRNADGTIDIAAYEHTVRLWTIVLE
FT                   ISVMMAQFPSKEIAKLSYEYRTLGLGYANIGGLLMTSGIPYDSDEGRAICAALTAIMTG
FT                   VAYSTSAEMASELGAFPDYDRNAQNMLRVMRNHRRAAYGDKDGYEKLAVNPVPLVASDL
FT                   KQQALAEHAKAAWDRAIELGEEHGYRNAQATVIAPTGTIGLVMDCDTTGIEPDFALVKF
FT                   KKLAGGGYFKIINRAVPEALRTLGYSESQIAEIEAYAVGHGNLNQAPGINPGSLKAKGF
FT                   SDDKIAALNAALKSAFDIKFVFNQWTLGADWVKETFGFTDEQLNDFSFEMLPAMGFSRK
FT                   DIEAANIHVCGAMTLEGAPFLKAEHLAVFDCASPCGKIGKRSLSINSHIQMMAAAQPFI
FT                   SGAISKTINMPNDATVEDAKGAYMLSWKLALKANALYRDGSKLSQPLNASLLADGEEDE
FT                   DEAVEQLIQAPAAARAAQITERIVERIIERVSREQEKLPGRRKGYTQKAKIGGNTIFLR
FT                   TGEYDDGRLGEIFIDMNKEGATLRGLLNNFAIAISLGLQYGVPLDEYVHAFTFTKFEPA
FT                   GMVIGNDAIKSATSILDYVFRELAISYLGRNDLAHVDQSDFSNTALGRGISEGKTDAVS
FT                   KGLTRGSPVKLVSRAIGNEPKGFAGAGTPARSAPTAFSGSNVLALKPASDEAVAYKRDY
FT                   EERAKELAEDIAFEETVSETSDTTAALFTDAAANEAAEAKKLAADRRAKSLLQGYTGNS
FT                   CSECQNFTMVRNGTCEKCDTCGATSGCS"
FT   CDS_pept        98264..98656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0138"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47786"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47786"
FT                   /db_xref="GOA:Q98NH5"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NH5"
FT                   /protein_id="BAB47786.1"
FT                   /translation="MSNLVGLEKPVGPICQISAVMQLRLRLGAGELHADPVVAAPADLA
FT                   AIGDAVERHIKQETIGHPRLDRYFQFGAARMLVAQRHGDFRVLNPGDNGSTLEHAWTVL
FT                   ALGLAGMLLNWVYRIRHRSNARLVDS"
FT   CDS_pept        complement(98725..99213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0140"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47787"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47787"
FT                   /db_xref="GOA:Q98NH4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NH4"
FT                   /protein_id="BAB47787.1"
FT                   /translation="MLTRPTTHNHLAERVRRLFGTAPCRLQVAALPWRDTGNGVEIMLI
FT                   TSRDTGRWVLPKGWPEAKEPLCEAAAREAGEEAGLRGTVSHLEAGRYFYAKVLASGEEV
FT                   PCEVLVFPLHVDKIADRWKEKHSRTRKWVSSSEAVRMINEPDLCQIIAYFCADPHRFS"
FT   CDS_pept        complement(99424..99924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0141"
FT                   /product="xanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47788"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47788"
FT                   /db_xref="GOA:Q98NH3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NH3"
FT                   /protein_id="BAB47788.1"
FT                   /translation="MSLPEKAFPVSWDQFHRDARALSWRLSGANKGQWKAIVCITRGGL
FT                   VPAAIIARELGIRVIETVCVASYHDYTSQGQLQVLKEITPALLADDGAGVLIIDDLTDT
FT                   GKTAGIVRAMMPKAHFATVYAKPKGRPLVDTFVTEVSQDTWIYFPWDMGFTYQKPIADD
FT                   HAG"
FT   CDS_pept        complement(100041..100874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0142"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47789"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47789"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NH2"
FT                   /protein_id="BAB47789.1"
FT                   /translation="MRFKTIVAILQNEQDAERVLDCAIPLANRFQGHLIGIHAEALPVP
FT                   YTSATGFPDTEFLQVSADMSRERADKLQAVFLRRIEDSGLSFEWRSLESFSGDSALTGI
FT                   SSVRAADLIIAAQRETGGDPSADVDTLVYDAGRPVLVVPSAGPLVTTFKRVLLAWNGSK
FT                   EAARAAFDALPFIIEAEKTDILVIDPPDTFDESPEAAGAEIASALSRHGANVSVSVQKS
FT                   GGTSVDDMIQNRVAETGADLLVLGAYSHSWLRQLLFGGVTRTVLRTAQVAAFLSR"
FT   CDS_pept        complement(100957..101700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0144"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47790"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47790"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NH1"
FT                   /protein_id="BAB47790.1"
FT                   /translation="MTEIVTAAMLVIGDEILSGRTKDKNIGHLADMMTAIGIDLKEVRI
FT                   VPDEEDEIIAAVNAVRARYTYVFTTGGIGPTHDDITADSVAKAFGVPCEYDAKAYALLE
FT                   ASYAARGIEYTEARKRMARMPRGADLIDNPVSVAPGFRIGNVHVMAGVPSIFQAMLDNV
FT                   VPTLKTGTKMLSATVHCPFGEGLVGGPLGEIQKAHPDTIIGSYPKYGDGKFWTELVVRA
FT                   RSQEALDAARADVEAMVAGFAAKAS"
FT   CDS_pept        101864..102868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0145"
FT                   /product="lactone-specific esterase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47791"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47791"
FT                   /db_xref="GOA:Q98NH0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NH0"
FT                   /protein_id="BAB47791.1"
FT                   /translation="MLISILSWLLAVLFLLAVLGIACLALATLWIAMKAQALVPPVGKF
FT                   IEIDGNRIHYVDVGEGRPIVFLHGLGAQLHHFRRTLFGHFGPGYRLIALDRPGSGYSTR
FT                   ASGTTGRLPEQAALVRRFIEKLQLERPLVVGHSLGGAVTLTLAVEHPEAISGIALLAPL
FT                   THLETRARQRFDLLYIPSRVQRWIMAYTVAIPLSLRYARPTMEFIFAPQAFPTDYMVEG
FT                   GGWLGLRPVHFQATSADVVAVEEDLGRIEQRYGEIVMPAGILFGTADRVIDIRIHGEPM
FT                   RGKIAGLDFEPVDGVGHMPQFVEPKRVIGFIERIAVRAFPSPQPHDNFNEPTG"
FT   CDS_pept        102852..103208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr8579"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47792"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47792"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NG9"
FT                   /protein_id="BAB47792.1"
FT                   /translation="MNQPADCRVYPVSHPKATKTRSNAMYRRFLAASVLTIGLATSAMA
FT                   QSSDGAYSNRHNWWPFGNEQSSGVDQNTTGSINGDRSGLDSLGNSGPAGPCAYGTAGPD
FT                   ANAQGNVNDQYCGK"
FT   CDS_pept        complement(103311..103550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0146"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47793"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47793"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NG8"
FT                   /protein_id="BAB47793.1"
FT                   /translation="MAKLTYKIVEHDGGWAYKVGSTFSETFPTHQDALRAAEIASAEQQ
FT                   VAGATDGIQYEDADGKWHEELADGRDRPQTEVSE"
FT   CDS_pept        complement(103580..103858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0147"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47794"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47794"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NG7"
FT                   /protein_id="BAB47794.1"
FT                   /translation="MMDNKPFETPVVVELGHVGKYRHIRSTQEAAECLMTVWPLNRGPR
FT                   HRDALDTCLKVLEGYRSTAEARRALIEAARESEVLVPDDKLSDDRLH"
FT   CDS_pept        complement(103963..104280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0148"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47795"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47795"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NG6"
FT                   /protein_id="BAB47795.1"
FT                   /translation="MSFRAFLPAAMLVTVAGFWLGASTPGVAQYCEGTVHGLSGRYNLA
FT                   TGSGFLAVRTRPNSSSRMIGQLFNGDHVEIFDRRGNWYQVEIGGSTGWANARWLRNDCR
FT                   Y"
FT   CDS_pept        complement(104408..105511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0149"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47796"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47796"
FT                   /db_xref="GOA:Q98NG5"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NG5"
FT                   /protein_id="BAB47796.1"
FT                   /translation="MTASLFQPITLDGLTFPNRIAVAPMCQYSAEDGSASDWHLYHWMN
FT                   LAMSGAGMVTVEMTDVERRGRISHGCLGLYSDDNEAAARRTLDAARRVAAPGTKFGTQL
FT                   AHAGRKASNRKPWEGGGPLQPNEDPWQTVSASAMAYDTGWNVPRALDEEEILQLIERFA
FT                   QAARRAERAGFDFIELHAAHGYLIFQFLSPLSNQRTDRWGGSLENRMRLVVEIARAVKK
FT                   AVPKLMLGARLSVKDWVDGGFDVEDAIEVAKALKAEGIAYLCCSSGGNSPLQKLPTGPG
FT                   YQVHLAEAVRKGAGIPTRAVGLIDDPQQAEAVIAEGRADMVALARAFLADPRWGWRAAA
FT                   TFKEKIHPAPQLARSVTTMEHWMKAAG"
FT   CDS_pept        105672..106250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0150"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47797"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47797"
FT                   /db_xref="GOA:Q98NG4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NG4"
FT                   /protein_id="BAB47797.1"
FT                   /translation="MEDRIRIRSEEVLSDDWAVLKKTVLDYRRRDGQWETQIRQTYDRG
FT                   DGAVILPYDPQRSTVLLVRQFRYPAYVTGHREPLIEACAGLLDENDPETAIRKEAEEEL
FT                   GYRLKDIERLFSPYMSPGSVTERLWFFIARYSPADRISAGGGAPEEGEDIEVLEMPLDE
FT                   ALAGIADGRIVDAKTIILIQHLKLNPMKA"
FT   CDS_pept        complement(106280..107782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0151"
FT                   /product="histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47798"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47798"
FT                   /db_xref="GOA:Q98NG3"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NG3"
FT                   /protein_id="BAB47798.1"
FT                   /translation="MTITIDTNASWRDIARVSEGESLALSQAAWERIAFAHQIVAAIVE
FT                   KGIRAYGVNTGVGALASKVVAPALQKKLSRNIIRSHACGVGDLVPRRGVRAIIAAQVAN
FT                   FAHGRSGVSPAIVRNLLTFIERDCVPDVPSRGSAGYLTHNAHVALVLIGEGSATVAGRP
FT                   MSGLEALAEMGLEPLELGAKEGLSLVNGTACATGLTSIAVLRAERLLGWADAAAALTLE
FT                   AAGAQMPAFGEQILAMRPSPGIQDVGRSLRGWLHGSELIALAHGSRTQDALSLRAVPHV
FT                   HGAAREVLDRSSELVDRELAAVTDNPAVFGSLSDPQVVSEAHAVAPALGQAADGLTIAL
FT                   AQVAGMSERRIDRLVNPLVNNLPAFLADEDGANSGFMIAQYTATSLSNVNRRLAAPAAT
FT                   DGGVTSGLQEDFLAHPTVAANKLLAVIDNAEYILAIELMAAAQAHDFLARRGARAPGTD
FT                   TIYQLVRENIAHYSDDRPLSRDMEALRTFIREMDVPACPQHS"
FT   CDS_pept        108052..108435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0152"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47799"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47799"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NG2"
FT                   /protein_id="BAB47799.1"
FT                   /translation="MEIPSTFRHAPWSAGTLDQCGAKRMSVGTALEQLLRLIHRRAMKL
FT                   AMLPEDERDSHYDRIRLSCCAAAEHIGQDPDQAAITANDMVEFVRALVGIIEMGSGPDH
FT                   ERNADQRSPMLPSGGQEHVTTRI"
FT   tRNA            complement(108953..109035)
FT                   /product="trnL-TAA"
FT   CDS_pept        complement(109319..109984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0155"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47800"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47800"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NG1"
FT                   /protein_id="BAB47800.1"
FT                   /translation="MYRLVVASAGLLAVLSVPALAADPTVDVPMTAPGFDWTGYYAGLQ
FT                   AGYGWGQSDISGTEGEPFSVSPDINGGFVGGHIAGLWQFDQAVIGAEADLNYSSVNGTA
FT                   EAEPGNNFGTDIKWFGSVNAKAGYAMDRVLVYGIGGVAFAGIETSQSAGSAFSETRANV
FT                   GWTLGAGVDYALTDKFVVGAQYRYYDFGSEHYDGSSDFVGRDQDTKLNTVGINLSYKF"
FT   CDS_pept        110176..110562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0156"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47801"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47801"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NG0"
FT                   /protein_id="BAB47801.1"
FT                   /translation="MNGLTRLIAGTAITLFACGLVMAEPLTLAIAKAAVVSDQASGQRA
FT                   LNLKMTPDSAKAFADFTKANVGKVVDLSVDGAVVASPRLVEPILGGEVMLSGAFAAGEL
FT                   QRLAERISAGGAKVTVEVKAEQPL"
FT   CDS_pept        110644..112461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0157"
FT                   /product="adenine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47802"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47802"
FT                   /db_xref="GOA:Q98NF9"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NF9"
FT                   /protein_id="BAB47802.1"
FT                   /translation="MAKKPAAHATKPKPWTEMATHLVDVAMGRKPADLVIRNGRWVNVH
FT                   SGEIIAGTDIAIAGGRFAYCGPNASHAIGQGTKVVDAGGRYLVPGLCDAHMHVESGMVT
FT                   VTEFCRAVIPHGTTSMFIDPHEIANVLGLPGVRLMHDEAVAMPINVHVQMPSCVPSAPG
FT                   LEHAGAELTVADVAEAMTWENIIGLGEVMNFPGVAANDPVMSGEIAATVRAGKTVGGHY
FT                   ASRDLGLPFHGYVAGGPEDDHEGTRAEDAIARVRQGMKAMLRLGSAWYDVASQIKAVTE
FT                   GGIDPRNFILCTDDSHSGTLVHEGHMDRVVRHAIQQGLKPVTAIQMATINTAQHFRLER
FT                   EIGSIAPGRLADLLIVSDLAAMTIDEVYARGVRLAKGGKLDIDIPAYDYPKTAKNTVKL
FT                   GKKLRAGDFDITAPKGANEVRVRVIGVIENQAPTRALEADLPVEDGLVAMDRRNDVCQI
FT                   ALVERHRGTGGVTNAFVSGFGYMGDCAMASSVAHDAHHIICVGTNKQDMALAVNRLGQV
FT                   GGGVVLFSKGKELALVEMPIAGLMSDERAEIVAAKAEKLTEAMRKMGCSLNNAYMQHSL
FT                   LALVVIPELRISDVGLIDVTTFQKVDLFV"
FT   CDS_pept        complement(112487..113413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0158"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47803"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47803"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NF8"
FT                   /protein_id="BAB47803.1"
FT                   /translation="MPKVHQVGAIERAKGSANSNPAKQFTATNVVHYGDAPQFAKAVGA
FT                   DIAMRGDRALVFVHGFNNGFDDGVYRLTQIAHDTKYPGTPVLFSWASSAKTTGYIYDKD
FT                   SANAARDDLEATLRMLAKTRVKSIDIIAHSMGTWLTMEALRQLAITGDRDLGGKLGYVV
FT                   LASPDIDVDVFKKQMMRYGKPDKPFAVLLSGDDRALKLSSFISGDKPRVGDYGNAADLA
FT                   SYGVSVVDLTKAKGGDGGLNHAKFADNPILVQLLGNRLRTPAGLASDEPDPAQLNNLGQ
FT                   GLGKAVGSVAEVVITTPFKVLTIVTGG"
FT   CDS_pept        113399..113707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr8580"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47804"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47804"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NF7"
FT                   /protein_id="BAB47804.1"
FT                   /translation="MDLRHGDVDAGVAGGQRAIAVKYLPRILGRLLPGGGDENFVRGRD
FT                   VGRWYRDRRLVEQIMRVLAGTTGNGERQRDDETVQAQAQAPAPVTGDVKGMTSPLFR"
FT   CDS_pept        complement(113792..114898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0159"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47805"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47805"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NF6"
FT                   /protein_id="BAB47805.1"
FT                   /translation="MGLLAGVEISDVPLKKIVTVCLAVLVAGCAGPQTQELLGSAIVAA
FT                   PVTEIAGNHSIFIATTRKKSDDPNKVFDGERSATLNYARVNVTVPGLHQTGQIERRSRG
FT                   KSDDPAKYFMASEVVGYDTQPKFSSALNADIAARGGRVMVFVHGYNTGFDDAVYRLTQI
FT                   VHDSGYPGTPVLFSWASGAKTTDYVYDKESASAARDQLEVTLRMLQQSGARRIDIVAHS
FT                   MGTWVTMETLRQMAISGDRDLGGKLGDVVLASPDIDVDVFKSQMRRYGKPDKPFILLLS
FT                   DDDRALRLSGLIAGSRPRVGDYKDAADLASYGVTVVDLSEVKGSDSFNHTKFADNPVLV
FT                   KMIGQRLREDDGFASDRDVTDRISLLGQ"
FT   CDS_pept        115271..116572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0162"
FT                   /product="threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47806"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47806"
FT                   /db_xref="GOA:Q98NF5"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011820"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NF5"
FT                   /protein_id="BAB47806.1"
FT                   /translation="MTGGPRRHAAQGGFPMNSFSSRVATAAAAIRQIFPETPLQENDYL
FT                   SKKTGARVLLKREDLSPVRSYKIRGAFNFFRKALGEGNQAELFVCASAGNHAQGFAFVC
FT                   RHFGKKGVVFMPVTTPQQKIDKTRLFGGDFVEIRLVGDFFDDCYRAAFEFTERSGAHMV
FT                   PPFDHKDIIEGQATVAYEIAAQMAGARMPDIVMLPVGGGGLAAGVTHYFADQGREARFV
FT                   FCEPAGAPSLHDSLAAGKRLKLAKVDNFVDGAAVAEIGREPLRFLKEFAADTVRLIPEN
FT                   RLCATMIEMLNVEGVVLEPAGALAIDALKDFSRKEIRGKTIVAVVSGGNFDFERLPDVK
FT                   ERALRFEGLKKYFIIRFPQRPGALRDFLEMLGPDDDIARFEYLKKSARNFGSVLIGIET
FT                   KDRRNFDLLKANFEAEGVQYQDITDNETLAGFII"
FT   CDS_pept        116569..117123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0163"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47807"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47807"
FT                   /db_xref="InterPro:IPR012545"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NF4"
FT                   /protein_id="BAB47807.1"
FT                   /translation="MSAKVFIALFSGINVGGNRIVKMAELRSFFEDLGFSDVATYVQSG
FT                   NVVFRAGKGDATALTRQIEAAFEKKWGFHSRILVRDLSWFERLVSENPYPEAAADHTKL
FT                   HAYALDREPTAEEVARLAEKCTGPERFEVKGDVLYLSAPDGLGKSVFANLIPRVLKVPG
FT                   TARNWRSVLALLEMAGQAGKN"
FT   CDS_pept        complement(117129..117422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0164"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47808"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47808"
FT                   /db_xref="InterPro:IPR014543"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NF3"
FT                   /protein_id="BAB47808.1"
FT                   /translation="MPSSRADVATEHASRYLQQLCKHWAHKFPVEFNPTHGTIDLTSLG
FT                   RTVMDADAAALHIVVSSDEAGSLERLESVVADHIKRFAFREELTFDWKPAAT"
FT   CDS_pept        complement(117555..117995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0167"
FT                   /product="lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47809"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47809"
FT                   /db_xref="GOA:Q98NF2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NF2"
FT                   /protein_id="BAB47809.1"
FT                   /translation="MRYLHTMVRVADVDASLDFYCNKLGLKEVRRYENEQGRFTLIFLA
FT                   ASEDEQSGINDKAPLIELTYNWDPEDYKGGRNFGHLAYEVDDIYATCQHLMDNGVTINR
FT                   PPRDGNMAFIRSPDGISIELLQKGPAKAKAEPWASMANTGSW"
FT   CDS_pept        118263..118808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0168"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47810"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47810"
FT                   /db_xref="GOA:Q98NF1"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NF1"
FT                   /protein_id="BAB47810.1"
FT                   /translation="MKRDEGGDAADLTEIAGAIKWFDVAKGYGFILPDDGVSGDILLHV
FT                   TCLRRDGFQTALEGARVVCLVKQGDRGLQAFRVLSMDVTTAVHPAEMQEQRTHVAVTPE
FT                   SGLERALVKWFNRTKGFGFLTRGEGTEDIFVHMETLRRYGITELRPGQVVLVRFGRGDK
FT                   GLMAAEIHPDMGTLPVSH"
FT   CDS_pept        118983..119393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0169"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47811"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47811"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NF0"
FT                   /protein_id="BAB47811.1"
FT                   /translation="MTKDGNRSFSIEIADTDAEREAGLMFRQDMADDHGMLFVFEIQQQ
FT                   VSFWMQNTPMPLDLIFVGQDGKIRAVKHGEPQSQAIISPGVPVRFVLELKAGAAAKYGI
FT                   GYGDLLRHPAIGTVSGPGMPPPDNGDAPNGGG"
FT   CDS_pept        119365..120180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0170"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47812"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47812"
FT                   /db_xref="GOA:Q98NE9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NE9"
FT                   /protein_id="BAB47812.1"
FT                   /translation="MAMHPTAAAEREVGQPMQFFSHGGFDLAFLDRQPASGQGDPVLMI
FT                   HGFASSHYVNWVSPGWFKTLNDAGYRAIAFDNRGHGSSSKSYEEADYTPAKMASDAAAL
FT                   LDHLGIERAHVMGYSMGARIAAFLALSDPDKVATLVFGGLGIGMIDGVGDWDPIAAALL
FT                   ADDPATTTHPRGRSFRAFADQTRSDRRALAACIATSRELLSEQDVARIAQPTLVAVGTT
FT                   DDIGGSPDDLAALMPNARAFHIEGRDHMLAVGDKTFKQRVLEFYAEYPL"
FT   CDS_pept        complement(120351..120962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0172"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47813"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47813"
FT                   /db_xref="InterPro:IPR009218"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NE8"
FT                   /protein_id="BAB47813.1"
FT                   /translation="MTKMKDQPLIDELLKQELSALYRAEDRHYHNLAHIEAMLALAADH
FT                   RALLSDPQAVEAAIWFHDAIYDSKAKDNEARSAALAAQKLASRTDPERLDRIGAMILAT
FT                   ATHQVPRFHDDAATRDASLFLDMDLSILGAAPHAFDAYERAVRREYGWVEEPMWRAGRG
FT                   AVLKDFLARPRIFHTEEFRQRFEPQARLNMARSLEALTAG"
FT   CDS_pept        121123..121719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0173"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47814"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47814"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NE7"
FT                   /protein_id="BAB47814.1"
FT                   /translation="MKLEAVIIAVADADRSKRFYSGLGWRLDADFVVGDAFRVVQFTPQ
FT                   GSPCSIHFGKGLTSAAPGSAKGLYLVVSDIEAAHAELVARGVEASEVFHRAGPGQPAIS
FT                   GRHPEGRSYSSYVTFSDPDGNSFILQEITQRLPGRVDPTDTLFTSSRELAAALRRAAAA
FT                   HGEHEQRTGGQYDVNWPDWYAEYMVAEQAGTPLPT"
FT   CDS_pept        complement(121889..121996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0174"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47815"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47815"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NE6"
FT                   /protein_id="BAB47815.1"
FT                   /translation="MLMLFIDVSSCVLLACLLSGRTYKPDHSMIELNFP"
FT   CDS_pept        122013..122828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0175"
FT                   /product="serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47816"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47816"
FT                   /db_xref="GOA:Q98NE5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NE5"
FT                   /protein_id="BAB47816.1"
FT                   /translation="MQPVDPIWRSIRDEAMDAVNRDPLLAAFLYSTILNQESLEEAVIH
FT                   RIAERLAHQDIGSDLIRQTFKTMLADDKEWPTTVRVDIQAYYDRDPACDRFIMPVLYFK
FT                   GFHAIQTHRLAHWLWNQGRKDFALYLQSRSSSVFQTDINPAARIGKGIFIDHATGLVVG
FT                   ETAVIEDDVSILHGVTLGGTGKAGGDRHPKIRRGVLIGAGAKILGNIEIGHCSKVAAGS
FT                   VVLSPVPHNKTVAGVPARVVGETGCDQPSRQMDQLLPSQSMDQVVSFDI"
FT   CDS_pept        complement(122913..123227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0177"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47817"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47817"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NE4"
FT                   /protein_id="BAB47817.1"
FT                   /translation="MAGRVRRGLPFDTSSAQIDVEDRHREIIVAVVLVLEDDAKEFVSD
FT                   IDFGRIFLARPCLDLKLGVLEDALEIGVQLSDFVRLRQSSPIIGLAGLKGASGTSTMAM
FT                   "
FT   CDS_pept        complement(123234..124064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0178"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47818"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47818"
FT                   /db_xref="GOA:Q98NE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NE3"
FT                   /protein_id="BAB47818.1"
FT                   /translation="MKSHSRFWKAARAVPRDVCRRGTPGMAVGIRTEMKQAAIADGPEL
FT                   TVVDSTLMKRVFYAFAALALLSVAISLGGKWFGHAIAMAGYTDDTTVRRVVIGNNVISV
FT                   PANFIRFEQARRDGVASRLDLYLRYPQMDGYSEAARDDFNHSEANRSIIFLSFEQQMMS
FT                   RDMSGRFAPIYSALIVQPGVPGAGGTTVYGFNEKSGYLNEVLVVGKRAGKDPFVARCLS
FT                   GPNAGQSLAPCERDVHVGDDLSLTYRFPKEFLGDWQALDAAMMAEAGRMLKTGH"
FT   CDS_pept        124053..124418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0179"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47819"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47819"
FT                   /db_xref="GOA:Q98NE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NE2"
FT                   /protein_id="BAB47819.1"
FT                   /translation="MRFHGKCKVKMAQMELFLFAFVVGLTVCGLTGSTMELVSGRKVAF
FT                   AEPYVSSAHVLRSLAATAGAGPFMLVNDALDARREKRISTMALLSCGCTAIAWSLALGI
FT                   VVLTIASWAIGLLGSGI"
FT   CDS_pept        124438..124965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0180"
FT                   /product="ferripyochelin binding protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47820"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47820"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NE1"
FT                   /protein_id="BAB47820.1"
FT                   /translation="MPLYAIDGAEPSFADAGSNWIAPDATLIGDIRVGRNAGFWFGVVI
FT                   RGDNEPIIVGADTNVQEHTVMHTDPGFPLTIGEGCTIGHRAMLHGCTIGDNSLIGMGAI
FT                   VLNGARIGKNSLVGAGALVTEGKEFPDNSLIVGSPAKAIRVLDDAAVERLRGSAAHYVA
FT                   NGKRFKAGLKKV"
FT   CDS_pept        complement(125017..125574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0182"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47821"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47821"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NE0"
FT                   /protein_id="BAB47821.1"
FT                   /translation="MLEIPEDRCERHRLFKAIDDAFKAGDFDGLGKALGGSPGWFDERM
FT                   PFELGLGHPLEYAIYWSPVGFISTLLDAGSDPNYQDHGGFPAIIAALSTDRADRLEVVR
FT                   VLIEAGADPNMRGVNDWTPLHYSVGIRSAEAIHLLLAAGADPTLATRIDDYTTAFEEAD
FT                   KAGFEAGASLLRDAIARRGFNR"
FT   CDS_pept        complement(125874..126482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0183"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47822"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47822"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ND9"
FT                   /protein_id="BAB47822.1"
FT                   /translation="MKKTRGKLLLMAMAMQLSAWGSAYAAGPAYMHTGGRTTQPVGHYE
FT                   FCQRIPGECNEKTPKGAPVDLSRKLWATIVNINNSVNTRVKPRTDMENYGVEEYWAYPD
FT                   NGYGDCEDYALEKRRELMDAGVPAGDLLMTVARQPNGDGHAVLTVRTSLGEFILDNLET
FT                   KVLSWTDTDYTYLKRQSTENSGVWVTINDGRSDAVASVR"
FT   CDS_pept        complement(126787..127404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0185"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47823"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47823"
FT                   /db_xref="GOA:Q98ND8"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ND8"
FT                   /protein_id="BAB47823.1"
FT                   /translation="MRSAAVDYAPSQAERRNFQRVRVKIYGRFMLEDRTEHPCQVVDMS
FT                   PGNVAFRTDRIGMPGEKVIAYIDHIGRIEGVVTRTLQDGFAMTVIASDRKKDKLAAQLT
FT                   WLANKHELDLPEDRRHERVAPRNPTSVLQLTDGRQYQCRIIDLSLSGAAIEIDVKPAIG
FT                   VQVMLGTMRGQIVRHFEDGVAIEFAVIQRPETLDSEFNTPRA"
FT   CDS_pept        complement(127524..128195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0186"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47824"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47824"
FT                   /db_xref="InterPro:IPR009922"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ND7"
FT                   /protein_id="BAB47824.1"
FT                   /translation="MGHQTTECAEQHTMNQNGSITLFHYWNRLRDGRPAPKRSEVEPAD
FT                   IKSLLADTFILEKDTRGQPVFRLAGTRLCACYGRELKGFSFPSLWREKDQRLVSRLIHG
FT                   VFDQKSVVLINFEGFSRNGRSNKFELLALPLDGGVENPRCLGVISAAEKPFWLGADPIT
FT                   DAMIDSIRVIDPEKEMLNNRPAIDVPSLVPAELEAPDTISALGRARRIRHLVVFDGGRD
FT                   E"
FT   CDS_pept        128607..129320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0187"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47825"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47825"
FT                   /db_xref="GOA:Q98ND6"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ND6"
FT                   /protein_id="BAB47825.1"
FT                   /translation="MPPPAREPVFNLPPIVLAVIGICAAVFLLQQYVLNDAQQITLLYD
FT                   GAFIPVLYTGQYGFDWFLFTRPFTYAFMHGGFAHIAINMVWLAAFGSPLANRLGGLRFA
FT                   LFFAVTGLASVALFWAMHPYGEAPLVGASGAISGMMGAAARFGFRTDRSAGKAAFAGPV
FT                   LPISLVVRSRGVVVFLAVWMIINLATGLLGFAPGVDGQIAWEAHIGGFVAGFFGLRWFD
FT                   RRWPPPEWETADRRT"
FT   CDS_pept        129408..129839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0188"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47826"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47826"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ND5"
FT                   /protein_id="BAB47826.1"
FT                   /translation="MTVKAILEKKGHDVLTLGPNEKLSEAIRILAEHKIGALVITNGDH
FT                   KIVGILSERDIVRVVAKEGAAALDIAVRSAMTPKVKICNENHTVNEVMEIMTRGRFRHL
FT                   PVEKDGLLDGIVSIGDVVKRRIEDVEREADEIRAYIATA"
FT   CDS_pept        complement(129888..130187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0189"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47827"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47827"
FT                   /db_xref="InterPro:IPR018654"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98ND4"
FT                   /protein_id="BAB47827.1"
FT                   /translation="MPHYNCHSVLCASKRTRGAVGQRILHMLAQGGRIEIEKNQKKRIA
FT                   SVKCLTRDGWHHPGVDLDLFRKLKRKKAVSSSGGGPYRITRRGLELVRSELDNR"
FT   CDS_pept        130538..132037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0190"
FT                   /product="Glu-tRNA(Gln) amidotransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47828"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47828"
FT                   /db_xref="GOA:Q98ND3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98ND3"
FT                   /protein_id="BAB47828.1"
FT                   /translation="MTIIDTRTPDAKRLIPGATGDWEIIIGLEVHAQVISEAKLFSGAS
FT                   TAFGAAPNANVSLVDAAMPGMLPVINEECVKQAIRTGLGLKAQINHKSVFDRKNYFYPD
FT                   LPQGYQISQFKQPIVGEGTVIVSVGPDRQGEFEDIEVGIERLHLEQDAGKSMHDQHPTM
FT                   SYVDLNRSGVALMEIVSKPDLRSGDEAKAYVTKLRTIMRYLGTCDGNMDEGSLRADVNV
FT                   SVRRPGGEFGTRCEIKNMNSIRFIGQAIDYEARRQIAILEDGGKIDQETRLYDAVKGET
FT                   RSMRSKEEAHDYRYFPDPDLLPLEFDQAYVDALAKELPELPDDKKARLITSLGLSTYDA
FT                   SILVSEKSVADYFEKVAAGRDGKLAANWVINDLLGQLNKVGKDIENAPVSPDQLGAIID
FT                   LIKDGTISGKIAKDLFEIVWSEGGDPRALVESRGMKQVTDTGAIEKAVDEVIAANPDKV
FT                   EQARAKPTMAGWFVGQVMKATGGKANPQAVNDLVKAKLGIE"
FT   CDS_pept        132042..132533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0192"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47829"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47829"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ND2"
FT                   /protein_id="BAB47829.1"
FT                   /translation="MFVRTAGERDLVAIRALLVETWHATYDAIYGAAKVTEITDAWHSI
FT                   ASLKARLIKPNSEFLVADDGKRIGGVAFAEGIGGGEEVVLKQLFVFPALQSRGIGGMLL
FT                   DEIIESFPEARAIRLEVEAQNARAIAFYEANGFVRSGDAGEHADASGEPTLVYRRSLAG
FT                   "
FT   CDS_pept        132724..133389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0194"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47830"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47830"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ND1"
FT                   /protein_id="BAB47830.1"
FT                   /translation="MSDETFGGVTYHIAGELVPVLSVDVTQMPVYFEHHILLWKNSTIT
FT                   IGLKTLKGALKRMMAGMQIFVTEASGAGIIAFSRDGPGHIVPIHLRRGEEIQVREHQFL
FT                   AATGNVDYTFERVRGLATMLFGQSGFFIDRFRGDGGDGIVWLHGYGNVFEKTLAAGETI
FT                   DIEPGGWLFKDASVRMETKIDRLSSGFFGANMNFIVNRFTGPGRVGIQSMYLHMPTEE"
FT   CDS_pept        complement(133453..134304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0196"
FT                   /product="pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47831"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47831"
FT                   /db_xref="GOA:Q98ND0"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98ND0"
FT                   /protein_id="BAB47831.1"
FT                   /translation="MSRPEVVNSVAALRAQVSDWRRDGLRVAMVPTMGALHEGHLSLIR
FT                   IAREKAERCVVSIFVNPTQFAPSEDLDKYPRQLARDLDLLARVKADLAFTPTVGAMYPA
FT                   GFATRISVGGPSAGLESDFRPTFFEGVATVVAKLFLQATPDCAVFGEKDYQQLCVVRQL
FT                   CRDLDLPVEIIGAPTIRDAHGLAMSSRNAYLDEAELAVARRLNVILHKAAAALAAGTHQ
FT                   DDATGEANRALIAAGFQKIDYVEARESLTLAPWRRDRAGRVLAAAWLGKTRLIDNVDVP
FT                   VA"
FT   CDS_pept        complement(134301..135161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0197"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47832"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47832"
FT                   /db_xref="GOA:Q98NC9"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NC9"
FT                   /protein_id="BAB47832.1"
FT                   /translation="MATKLPTTDIRIGAELIRRRKGGVPLVCLTAYTYPVARLLDPHVD
FT                   LLLVGDSVSMVLHGHATTLGASLGMMIAHGQAVMRGSARACVVVDMPAGSYEDSAAQAV
FT                   ASARRIVDETGCQAVKLEGGVDMAGQIAAIAAAGIPVMGHIGLLPQSVEKDGGYKIKGR
FT                   TDETVAALMADARAVEKAGAFSVVIEGTIEAVAADITRRIAIPTIGIGASGDCDGQILV
FT                   IDDMVGLTVDRVPKFVKEYADLRSVIANAAERYAAEVRDRTFPGPSHVFSGSKASSDLN
FT                   GGDES"
FT   CDS_pept        134982..135221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr8581"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47833"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47833"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NC8"
FT                   /protein_id="BAB47833.1"
FT                   /translation="MAMQDHGDAVADQKQVDMRVEQAGDGIGVGGQADQRDAALTAANQ
FT                   LRADANVGGRQFRGQSSPPSAHGWIGYPHGRAEL"
FT   CDS_pept        135392..135790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0198"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47834"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47834"
FT                   /db_xref="GOA:Q98NC7"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NC7"
FT                   /protein_id="BAB47834.1"
FT                   /translation="MKTFLTQFFTWWNSQTLGTRLHTWRYGKRVGQDEVGNVYYEGGID
FT                   SEGRTRRWVIYRNYSEASAIPPGWHGWIHHRVDLAPASEDYKPRDWQKPHQPNLTGTPA
FT                   AYRPKGSVLTNQHRPQVTGDYDAWTPGS"
FT   CDS_pept        135949..136545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0199"
FT                   /product="cellulase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47835"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47835"
FT                   /db_xref="InterPro:IPR019225"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NC6"
FT                   /protein_id="BAB47835.1"
FT                   /translation="MSFFNRISTGGLTLAAGLAVSTAAFAASPAPATPAAPAPAAPAGS
FT                   DRITNPVAEFAGIDKITGRIITFDVYIDETVQFGALQVTPRVCYSRPQNEEPKTDSFVE
FT                   VDEITLDRKIRRIFTGWMFAESPGLNAVEHAVYDVWLKECKQKSDVPAPDATKADAPKA
FT                   DASKPVATKPAAAKPAASPDAEQPDPTQPDTSDAN"
FT   CDS_pept        136561..137007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0200"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47836"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47836"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NC5"
FT                   /protein_id="BAB47836.1"
FT                   /translation="MATMRWTTDDRASTRPEDISMSDTKRITASKKELLELEKGFWTGD
FT                   AAYYAANADTECLVAFPQMAKAMDNADLAKTATKPNRWRDLDIELKGIIEPGSDIIMLT
FT                   YEAHATRENGEPYAALVSTGYVHRVNGWKMMFHSQTPIEVAAAK"
FT   CDS_pept        complement(137018..137635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0202"
FT                   /product="leucyl/phenylalanyl-tRNA-protein transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47837"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47837"
FT                   /db_xref="GOA:Q98NC4"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NC4"
FT                   /protein_id="BAB47837.1"
FT                   /translation="MTRPYAPGYRIPTDLLLKAYASGVFPMAESASDPEVFWVRPETRG
FT                   IIPLDGFHTPKSLRKTIRKSLFDIRFDFDFEATIDGCAEKREERRSTWINAPIREAYVQ
FT                   LHRMGHCHSVEAWREDQLVGGLYGVSLGRVFFGESMFSKETDASKICLVHLVERLKARG
FT                   FALLDTQFTTEHLKRFGAVDVPRGKYEKMLAEALKGEAIFFP"
FT   CDS_pept        complement(137648..138991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0203"
FT                   /product="biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47838"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47838"
FT                   /db_xref="GOA:Q98NC3"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NC3"
FT                   /protein_id="BAB47838.1"
FT                   /translation="MFQKILIANRGEIALRVLRACKELGIQTVVVHSTADADAMHVRLA
FT                   DESVCIGPPPSRDSYLNIHQIVAACEITGADAVHPGYGFLSENAKFADILAAHNITFIG
FT                   PSGDHIRIMGDKIEAKRTAKRLGIPVVPGSDGAVTEEKEAKRIAAEIGYPVIIKASAGG
FT                   GGRGMKVAHSEADLEVALQTARSEAGAAFGDDAVYIEKYLQKPRHIEVQVFGDGFGRGV
FT                   HFGERDCSLQRRHQKVWEEANSPALNAEERSRIGGICAKAIADLGYSGAGTIEFLYENG
FT                   EFYFIEMNTRLQVEHPVTEAITGIDLVHEQIRVASGGGLSVKQEDIKFNGHAIECRINA
FT                   EDPRTFTPSPGTITHFHTPGGLGIRVDSGVYSGYKIPPYYDSLIGKLIVHGRNRVECMM
FT                   RLRRALDEFVVDGIKTTLPLFRDLVGNADIANGDYDIHWLEKYLAKEE"
FT   CDS_pept        complement(139002..139460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0206"
FT                   /product="biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47839"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47839"
FT                   /db_xref="GOA:Q98NC2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NC2"
FT                   /protein_id="BAB47839.1"
FT                   /translation="MSIKKTGVDQQLIRDLAGILNDTNLTEIEVELGDLKVRVSRQAPA
FT                   VHAIAASQPSYASAAAQPAVAAAPATVDVSKNAVASPMVGTAYLAPSPDAKPFIEVGQK
FT                   VKEGQTLLIIEAMKTMNQIPSPRAGTVTAILFEDATPVEYGMPLVVIE"
FT   CDS_pept        complement(139487..139921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0207"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47840"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47840"
FT                   /db_xref="GOA:Q98NC1"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NC1"
FT                   /protein_id="BAB47840.1"
FT                   /translation="MKTVFVLNGPNLNALGKREPGIYGGKTLAAIADDCKQAGASLGLG
FT                   IDFRQSNHEGDLVDWIQEAGDKAAGIVINPGAYSHTSIAIHDAIRSIAPLPVAEVHLSN
FT                   IHARESFRHVSMVAPVAVGMICGFGPLGYTLALQALAARL"
FT   CDS_pept        complement(140067..140867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0208"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47841"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47841"
FT                   /db_xref="GOA:Q98NC0"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041205"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NC0"
FT                   /protein_id="BAB47841.1"
FT                   /translation="MKKALLLGTTGVAVVLAMLAFGFVAGSPQMAKAGTAQPVQTAADT
FT                   KIDRAEVEGIIRDYLLKNPEVLLEVQDALEAKQKEEQRIASLGVIKGAKDQIFNSAFDG
FT                   VVGNPNGKVTIVEFYDYNCGFCKRAIEDMRALTKSDPDLRFVLKEFPILGPDSQKASVV
FT                   SMAFHLMMPEKYGEFHNALLGGQGRATEAAAIKVALSLGADEATLREKMKDASIPEAFS
FT                   KTYDLANKLAITGTPSYVVGNEVVFGALGQDVLAEKIKAAKAAL"
FT   CDS_pept        complement(140932..142386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0209"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47842"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47842"
FT                   /db_xref="GOA:Q98NB9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NB9"
FT                   /protein_id="BAB47842.1"
FT                   /translation="MRKFSGADFSSFARSSTSEHVMLSRPRSTIARIARVFTTLSLGLA
FT                   VAVASSVTAFAQSVPVVRDAEIEALVRDYARPIFKAAGLANDGIDIVLVNDSSFNAFVT
FT                   GRRLFINTGALMTAETPNEIIGVIAHEAGHIAGGHQQKLRDQLERAKTMAIIATLLGAG
FT                   AIVAGATTNSRGLAGAGMGVAAGGGEMAQRSILAYQRTEEITADRSAITYLNATGQSGM
FT                   GMLKTFRRFQTALSLSGAQVDPYRISHPMPQERIANLEVLVKQSPNVDKLDPPTLQQRH
FT                   DMMRVKIAVYMEGQAAAARLLQKMRGSLAAQYGDAQSTYLYGDIAGALAKTNALIKAQP
FT                   KNAYFQELRGDILMKANKPKDAAEAYAKAVSLDPARSGLLPVSLGQALMAVGTPDSLKK
FT                   AVVQINNGLGRDKENSEGYRYLAQAYGELGDIPGAELATAEGHFYSGNYKDAKIFAMRA
FT                   QQQMKRGEPRWIRAQDIINYKSSNKI"
FT   CDS_pept        142471..143619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0210"
FT                   /product="probable aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47843"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47843"
FT                   /db_xref="GOA:Q98NB8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NB8"
FT                   /protein_id="BAB47843.1"
FT                   /translation="MVVSLSRRGNVEPFHAMDVLAEANRLKAQGVPVISMAVGQPSDPA
FT                   PVRVRAAAARALQDGRIGYTDTLGLAGLRKAIAEHYADHYRLEVEPARIAVTTGSSAAF
FT                   NLAFLAMFDPGDRVAIAAPGYPAYRNIMAALGIDVVEIELGDAAYLHAGHLETAHREKP
FT                   LKGVLFASPANPTGAVIPADELSALVNTAEALGIAVISDEIYHRLAYGAPDTTALAFGN
FT                   SVTVINSFSKYYCMTGWRIGWMVLPEELVRPVERIAQSLYISPPELSQIAAIEAFAATE
FT                   ELEAVKGRYAWNRELLMKRLPELGFPLAAPMDGAFYAFCDVTRHSNDSMAFARKMLAEA
FT                   HVAATPGRDFDTQAGHRTMRFSYAGSHDDMVEAMARIERWLR"
FT   CDS_pept        143624..144571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0211"
FT                   /product="glutaminase A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47844"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47844"
FT                   /db_xref="GOA:Q98NB7"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NB7"
FT                   /protein_id="BAB47844.1"
FT                   /translation="MPELERAPKLDQALAEVAAEMAERTDRGDVATYIPQLGKVDPRKF
FT                   GIAAVTNDGRVLVAGDADQAFSIQSISKVFTLTLALGNVGDALWQRVGREPSGNPFNSI
FT                   VQLEHENGIPRNPFINAGAIVISDILLAGHQPREAIGEILRFIQFLADDDTIIIDREVA
FT                   ASERATGYRNFALANYMKSFGNLHHAPELALGVYFHHCAIAMSCRQLAMAGRFLANGGK
FT                   NPATGHSVVSAERARRIGAMMLTCGHYDGSGDFAFRVGIPGKSGVGGGILGIVPGVASL
FT                   AVWSPGLNANGNSKLGSIALEKLARMMNWSIFAP"
FT   CDS_pept        complement(144667..147621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0212"
FT                   /product="ribonuclease E"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47845"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47845"
FT                   /db_xref="GOA:Q98NB6"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR028878"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NB6"
FT                   /protein_id="BAB47845.1"
FT                   /translation="MPNKMLIDASHPEETRVVVVRGNRIEEFDFESQDKKQLKGNIYLA
FT                   RVTRVEPSLQAAFVEYGGNRHGFLAFSEIHPDYYQIPVADRQALLRAEAQEAEDEEDED
FT                   GDGDDRQSRDRGRRGRRRGGKSRERGEHKRDTGEAGEGAGEPGEGGDNGDIVVEEISHT
FT                   SEIIEHAADTSEHSGPSEHADTSGHDEGSAEQEETETREGGPTSIAAAVEGDVISEPVS
FT                   HTEQTTEASSSDNDRGMLEEVQSSHPDDHEVESVGAEDALEEVRNRRKPVRRQYKIQEV
FT                   IKRRQILLVQVVKEERGNKGAALTTYLSLAGRYSVLMPNTARGGGISRKITSAVDRKRL
FT                   KEVVADLEVPQGMGVILRTAGESRTKAEIKRDYEYLMRLWENVRSLTLQSTAPALVYEE
FT                   GSLIKRSVRDLYNKDIDEILVSGEEGYREAKDFMRMLMPSHAKVVQPFRDTTPIFVRNG
FT                   IEAQLDRMLQPQVTLKSGGYIIINQTEALVAIDVNSGRSTKEHSIEDTALHTNLEAAEE
FT                   VARQLRLRDLAGLIVIDFIDMEENRNNRSVEKRLKDHLKNDRARIQVGRISHFGLMEMS
FT                   RQRIRASVLESTMKPCPHCGGTGHVRSDSSVALMVVRAIEEFLLKDSRSHITVRTPAAT
FT                   ALYVLNHKRGTLVELESRFGLTITIEADDTVGAQHYAIFRGALAEKPEGFVEARSLPAY
FT                   VEPEEPEDEIAVVEEDDEVVVQAEQPRQQPQQHQQPRPAGSEDGEGRDRKRRKRRRRRG
FT                   GRDRDREHGAPADGSAISAPAGEFVGAADAAGDDDGEQDDAAPIAASASDEAVQAADDS
FT                   QGKKRRRGKRGGKRNRREDGEGETEASAGEATEASEADASESEPASIEPAAVAAVTEEP
FT                   VAAVSEEVPSTEKPKKPRRAAKPKKAAAEAAAETPVVEAAAETPVEAPVTVVEETAVVP
FT                   VAEEPSKARPSRRKPAAIDAPVVPVVSSTVADEPEAKTEEKPKRAGWWQRKGFF"
FT   CDS_pept        148273..149535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0213"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47846"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47846"
FT                   /db_xref="GOA:Q98NB5"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NB5"
FT                   /protein_id="BAB47846.1"
FT                   /translation="MGLADFTDKGCRVGGRILGALFLLLLVAISQGFFSIANAADAPLV
FT                   AKGYKMAGDATKMRIVMDFDREPDIKWFLLRGPNRLVIDLANTRLAIDAKDLKPRGLVK
FT                   GVRLGALGDGVSRLILTGKGPFAVDKLDVLKNEDGTGYRIAIDMSAASEREFDAALANQ
FT                   ALTTGSTVSTDKGGRVGTGPVSNPGHRFTVVIDPGHGGVDGGAEGLNGTIEKNVTLAFA
FT                   TELRDKLAAIGKYDVFMTRDTDEYLRLDDRVRIARQHEADLLISIHADTISVKGIRGAT
FT                   VYTVSEKASDPQAQALADRENLSDQFAGMVIKDDNKEVTDILIDLIRRETHTFSMSFAH
FT                   TLVGQLSTSVGLINNPQRSAGFKVLKAPDVPSVLVELGYLSNAKDEAQLLNAEWRGKAA
FT                   QSITNAVALFASAKAGARTGG"
FT   CDS_pept        149749..152205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0215"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47847"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47847"
FT                   /db_xref="GOA:Q98NB4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NB4"
FT                   /protein_id="BAB47847.1"
FT                   /translation="MIRLIGYFFGIGTTLALLVAAGVAIYISHLSKDLPDYEVLAKYEP
FT                   PVTTRIHASDGSLMAEYARERRLYLPIQAIPDRVKAAFLSAEDKNFYNHPGIDVTGLGR
FT                   AIIVNLQNFGSGRRQVGASTITQQVAKNFLLTADQTYERKIKEMILAFRIEQAYPKDRI
FT                   LELYLNEIFFGFGAYGVAGAALTYFDKSVNELTVAEAAYLASLPKGPNNYHPFKHADRA
FT                   IERRNWVIDQMVENGYVTREEGNKAKAEPLGVTPRRTGTYLFAGEYFTEEVRRQIIARY
FT                   GENALYEGGLSVRTTLDPKVQLIARKAMQNGLIKYDTLRGYRGPVTSIDVSGDWGVPLG
FT                   AVKGLEDVPEWSLAVVLDSSASGLSIGLQPARQASGDIVKERVEGTVSKDDMGFAMRHM
FT                   VDGKTVKAKSPADVLKPGDVIFVQKNEGSDNTYSLRQVPEVEGGLIAMDPHTGRVLAMV
FT                   GGFSYAQSEFNRATQAMRQPGSSFKPIVYSAALDNGYTPASVIMDGPITIQSGNTTWTP
FT                   KNYDGTVAGPATLRSGIEKSRNLMTVRLANDMGMKLVVEYAERFGVYDHLAPYLPMALG
FT                   SGETTVMRMVSAYSIMANGGKSIKPSLIDRIQDRYGKTVFKQDERGCEGCNALEWKNQP
FT                   EPELVDNSEQVLDPMTAYQITSMMEGVVQRGTGATIGELGRHIAGKTGTTNDEKDAWFI
FT                   GFTPNLVVGLYMGYDTPRGLGHGATGGGLAAPIFKDFMRVALDGTPNVDFKVPDGMNLI
FT                   AINRKTGMRAASGDPGTIIEAFKPGTGPADSYWVIGMGADGSNASGGALSPQANQAIQD
FT                   GGGGLY"
FT   CDS_pept        152441..153463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0216"
FT                   /product="translation releasing factor RF-2"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47848"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47848"
FT                   /db_xref="GOA:Q98NB3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NB3"
FT                   /protein_id="BAB47848.1"
FT                   /translation="MRAEDASLWNEPLEAQKLMRERQGLEEGIAAVKGLTQALEDNIGL
FT                   IELGEEEGDEGVITEAEAAIRSMQGEAKARQVETLLSGEADANDTYLEIHAGAGGTESQ
FT                   DWASMLLRMYTRWAERRRFKVEVLEVHDGEEAGIKSATLMIKGHNAYGWLKTESGVHRL
FT                   VRISPYDSNARRHTSFASVWVYPVIDDTIEIDVSESDVRIDTYRSSGSGGQHVNTTDSA
FT                   VRITHIATGIAVACQAERSQHKNRAKAWEMLRSRLYEEELKKREAIANATEASKSDIGW
FT                   GHQIRSYVLQPYQLVKDLRTGVESTSPSSVLDGDLDDFMEASLSQRIEGGAGEAVADLD
FT                   "
FT   CDS_pept        153709..154080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0217"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47849"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47849"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NB2"
FT                   /protein_id="BAB47849.1"
FT                   /translation="MFAANSRSAIAVPSVGQLVLPLCAVIALLSAPAMAHDAKPTAAKP
FT                   QGWSYPFACCANYDCHEVSQTSISERPEGYVIKDTGEVLAYSDRRIKDSPDGEYHWCAH
FT                   EAGLDAGKTICLFVPPSSY"
FT   CDS_pept        complement(154097..154267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0218"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47850"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47850"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NB1"
FT                   /protein_id="BAB47850.1"
FT                   /translation="MHCVTVSGASETSNVVALQWQLPLMVINITSPLSAAHEARHHKEV
FT                   ILTTACQQVLL"
FT   CDS_pept        154254..154556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0219"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47851"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47851"
FT                   /db_xref="GOA:Q98NB0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NB0"
FT                   /protein_id="BAB47851.1"
FT                   /translation="MTQCTCSFCSKRGSLWAYYTPSQFKLITPLKNVSFYEWGSKTVKH
FT                   GFCANCGCGTFTETPDWSTGEPDFDNPKISVNSRLFDDFNLDKVEVVVIDGKNLW"
FT   CDS_pept        154684..155334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0220"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47852"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47852"
FT                   /db_xref="GOA:Q98NA9"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR027367"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NA9"
FT                   /protein_id="BAB47852.1"
FT                   /translation="MKKTVLVAVATALLVSACTTTDPYTGDQKISNTAAGAGLGALAGA
FT                   SLGLLAGGNDRRNALIGAGIGALAGGAIGATMDQNEAELRRQLEGTGVSVTRSGDQIIL
FT                   NMPSDITFNVDQDAVKPGFYPVLNSVALVLKKFKQTTVDVFGHTDSTGGDQHNFDLSQR
FT                   RALAVANYLSGQGVDQRRFAVTGFGKTRPIASNATAAGREQNRRVEIQLSPLT"
FT   CDS_pept        155809..156189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0223"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47853"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47853"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NA8"
FT                   /protein_id="BAB47853.1"
FT                   /translation="MDYPKGAMGVHFVNVPSVGQKLDPMKPNVLIYEPTKKGLKLVGVE
FT                   WLVPLTPNVKEVPTLFGQKFMGPMEGHYPLIPREFVHYDLHAWLFRDNPNGMFSPTNPN
FT                   VKCSKADFPMLEKPTKMMPGPM"
FT   CDS_pept        complement(156279..157862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0224"
FT                   /product="probable ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47854"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47854"
FT                   /db_xref="GOA:Q98NA7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NA7"
FT                   /protein_id="BAB47854.1"
FT                   /translation="MSSDTTIAPEALTFSDLGLSPKVLSAVTDAGYTVPTPIQAGAIPH
FT                   ALLGKDILGIAQTGTGKTASFVLPMLTRLEKGRARARMPRTLILEPTRELAAQVEENFV
FT                   KYGKNHKLNIALLIGGVSFDEQDKKLERGADVLIATPGRLLDHRERGKLLLNGVEILVI
FT                   DEADRMLDMGFIPDIERICEMIPFTRQTLFFSATMPPEITKLTEKFLHAPVRVEVSKAA
FT                   SAATNITQRLVKSGSKPWDKRETLRNLIKAEDAELKNAIIFCNRKVEVSELFRSLLKYD
FT                   FDAGALHGDMDQRARMQMLANFRDGKLRYLVASDVAARGLDIPDVSHVFNYDVPIHAED
FT                   YVHRIGRTGRAGRSGKSFTIATKSDTKYIDAIERLIGNKIEWHDGDLSTVVASEGEDDA
FT                   PRRGKGAPRRAGRKDDDRKDRGERKKGGERRARHSEEDAAVAQQEQPDVAETAVADISE
FT                   RRARKEAIRSENTERKSSDRNEPRAPERGDTRPQRDNSRPARHRHQEDNDTTVGFGDDM
FT                   PAFMRIVAKV"
FT   CDS_pept        complement(158053..158907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0225"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47855"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47855"
FT                   /db_xref="GOA:Q98NA6"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NA6"
FT                   /protein_id="BAB47855.1"
FT                   /translation="MQSCPPRATPARARPDLPPPIGRDREAMSTAANSIAFVSSDTADA
FT                   KAALESLSARYGQCSVAEAVVVVALGGDGFLLQTLRDTMGTGKKVYGMNRGTIGFLMNE
FT                   YRSGGLTERIAAAVAETIRPLEMLAVTSEGETVSALAINEVALWRQSYQTAKIRISVDD
FT                   QIRLEELSCDGVMIATPAGSTAYNLSAHGPILPLDAPLLALTPVSPFRPRRWRGALLSN
FT                   KATVRFDILEPEKRPVNAAADHTEVKAVTSVTVRESPTATATLLFDPNHSWNERILAEQ
FT                   FRY"
FT   CDS_pept        159129..159356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0226"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47856"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47856"
FT                   /db_xref="GOA:Q98NA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NA5"
FT                   /protein_id="BAB47856.1"
FT                   /translation="MRMIPGKSEVRGTHQPDEADILPVARLIIVFVMLGSFALVFAELV
FT                   RQSENMSMRPLPTASRCGDATGMPCPQRAL"
FT   CDS_pept        159762..160796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0227"
FT                   /product="probable binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47857"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47857"
FT                   /db_xref="GOA:Q98NA4"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NA4"
FT                   /protein_id="BAB47857.1"
FT                   /translation="MNWKLTAAAAGLSLLAATGVARADGELNIYNWGNYTSPDLIKKFE
FT                   DTYKVKVTVTDYDSNDTALAKVRQGASGYDIVVPSASVVPVWISEGLLLETDPNKMENF
FT                   KNVDPRWADVPFDPGRKYTVPWQWGTTGISVNKSVYSGDPNTSAIFLDPPPELVGKINV
FT                   VPEMGDIMFLAIAYEGGKYCTNDMQVLKKVHDKLVEAKAKWLSLDYAAVDGLGRGDIAA
FT                   GVNWNGISLRERLQNNKIVYGYPKEGFPIWMDNVAVLKDAKNVENAKLFQNFIMDPKNA
FT                   AMISAFARYANGIKGSEAFMPDDMKTAPEVDVPAEFAAKGQFMPACPSDVQALYTKIWT
FT                   DLQK"
FT   CDS_pept        160894..162321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0229"
FT                   /product="amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47858"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47858"
FT                   /db_xref="GOA:Q98NA3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NA3"
FT                   /protein_id="BAB47858.1"
FT                   /translation="MSDLDLCYMPAHEALRLFKAKKLSPVELMQATIRRAEATRSSINC
FT                   FTFTHFEEAMKLAARAEAKYARGARAGALEGLPIGIKDESYIKGKPTSHGSLLSRDAIG
FT                   GHTSTMNERIMKAGGIVHARTATPEFSCAGYTWSKRWGVTRNPWNPDFTPGGSSGGAAA
FT                   TLASGTSSIATGSDIAGSIRIPASACGLVGYKPPYGRNPDEPPFNLDFYCHTGPLARNV
FT                   RDAILLQNVMAGPSPLDIATLRPKLRLPFDFKPIKGWRIAFSMDLGSFEVDPDVRKNTL
FT                   AACDVFRSLGATVEEVDLGWDDGVLKAGMAYLEHLFGASLSQLLAEHAKDMTSYARRFA
FT                   EDGRKSKATDFVATLDVAARMYQTLGPLLETYDVLICPTNALPAVPAEFDQTTDRVEIN
FT                   GTEVNPSLGWVMTTPFNMLSRCPVLSIPSGHAASGVPTGIQIVGRTYSDADVFRAGLAY
FT                   ETARGQWYGDTGTRPSL"
FT   CDS_pept        162343..163110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0230"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47859"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47859"
FT                   /db_xref="GOA:Q98NA2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NA2"
FT                   /protein_id="BAB47859.1"
FT                   /translation="MAYVARQSVRRDMSAAGPKGLTNMAQRKTTAKPEKRKVVTKGAAN
FT                   DAAPPKDRRRERGEASVQRIIDATIELIAEEGLASLTMQRIAEHVGSSNALVVFHFRSK
FT                   ENLFRAVLQYLSDQYDALWITLVRAPGLSPVERLLGAVDCAQRFARQHPKWVSVFVVFS
FT                   SDRKSMQIYNEIGLPSDLAYTAEARELLIEISRSGGYAGVDINTLSESLNYLVHGAWYW
FT                   DHLNPSSRDTNVLRKTMLLLLHQAFPRHFELMP"
FT   CDS_pept        complement(163117..163878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0231"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47860"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47860"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NA1"
FT                   /protein_id="BAB47860.1"
FT                   /translation="MGSLAVIDAPGWYETIRMADGVTLIHEPWIKPFFRCNIWHVRGRD
FT                   RDLLFDTGLGHFSLRTHVPLVTERKLTCVASHTHFDHIGCHHEFPDRGVHPAEAKILAD
FT                   PRNEWTVADRYATDDMFDGLPQGWESSRYRILPAPADRLLDHGDVVDLGDRAFEVIHTP
FT                   GHSPGGIALYEKKTGILLSGDIIYDGPLIDDVYHSDIPDYMATLLAMRELDVSVVHGGH
FT                   FPSFGKVRYRQLIDEYLAQKRRAGCHLRQRP"
FT   CDS_pept        complement(163880..164944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0232"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47861"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47861"
FT                   /db_xref="GOA:Q98NA0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NA0"
FT                   /protein_id="BAB47861.1"
FT                   /translation="MTAPLVDIRAVSHRFGQLAVLKNVSLRIEPGSYTILLGPSGSGKT
FT                   TLLSILGGFVTPSEGKVFIRGEDCTTVAPARRPTTTVFQDYALFPHMSVGGNVGFGLRM
FT                   QGVDGATRAAKAREALALVGLASAFDKKPHQLSGGQRQRVALARALVIEPAVLLLDEPL
FT                   GALDLKLRRQMQDELKAIQKRVGTAFIHVTHDQEEAMALADHCVVMNDGRIEDEGPPER
FT                   VYARPATRFSATFMGESTILAGRVAETRDRTSTVTTPAGPVLVRSALPVGSAVALAIRP
FT                   EHLMLGGTAGTASLGMAKVSDVVFQGSFKRVLAVSVEDPSLQFIAKLPASATVQPGDTL
FT                   AVSCDTDQIIVLAD"
FT   CDS_pept        complement(164941..165723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0233"
FT                   /product="probable permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47862"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47862"
FT                   /db_xref="GOA:Q98N99"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N99"
FT                   /protein_id="BAB47862.1"
FT                   /translation="MRQLVRVVSWLYALTVYGFIFLPVVVLVLFSLQATSFPIPPFTGP
FT                   SLRWYDAVLSDVRLTSALVNSLLVASISSAAAVTLGFLSAWGFARFVLPGSGLLRGLIT
FT                   LPLTVSYLIIGMGLLVLFNWAGVPKSLLAAGIGHVVINLPLCFAIIYSQMGDHQINIER
FT                   AARDLGAPEWKVLLLITVPVMAPAIFAGFFLSMTFSWDEFVISFLLTRFDTTLPVEIWN
FT                   LLRSGLNPKTNAVGSLVFAVSIVLVVLFELTLLRRRKT"
FT   CDS_pept        complement(165725..166525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0234"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47863"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47863"
FT                   /db_xref="GOA:Q98N98"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N98"
FT                   /protein_id="BAB47863.1"
FT                   /translation="MTPALGWTLLFFVLPFIAMGFSSLTAHEGGGFTLSNYSQFFTNPS
FT                   YWQAMVNSLQVTAIVTLLSVLLAYPFAWILAEQVPERWQRLALMLAVLPFWTSYVVRSY
FT                   SWLLVLAQNGVINRALTGSGLIAEPLQLANTRLATVTGFVHFFVMLLTLTIFANLKQLS
FT                   PSYRKAAADLGAGPVRTFLHVILPLTLPGIMVGAFLTFVLCIGDYITPQILGGNNELLM
FT                   PQLVMMQIGRRGDFPLASALSIILMAVVTVAYLACARWLKIERA"
FT   CDS_pept        complement(166605..167696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0236"
FT                   /product="probable binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47864"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47864"
FT                   /db_xref="GOA:Q98N97"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N97"
FT                   /protein_id="BAB47864.1"
FT                   /translation="MSVKSASGNPLSILKRHLRAACAATALLLGVGSLAEAADLNALIW
FT                   CDHSDPALLQPFEEANNVKVNVKEFEGTGAGLAIVEQSQPGDWDVMVIDSIDVPRGVEK
FT                   GLFEPLPEDKLPLADLFPQVKMDGSTVVGGKRYGITEKFGYNTIGFNKTKVDPADMQSL
FT                   ASLTSDKYKGKVAIYDYYLPVIGMAALAIGKKTADLTEADLPALKAELLKMKANAKLVG
FT                   EVTASQTALATGEVDILVGGGEWVTAGLAKENPALDFSIPKEGAVLWSQSLAMFKASKN
FT                   KDLALKFIQYIMSPEGQARLATSSCYWGMPANSKAALTDDQKKVLRFDEQPGFLARAQA
FT                   YPAPNADLDKKMQDMWTEMLQAK"
FT   CDS_pept        167788..168402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0237"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47865"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47865"
FT                   /db_xref="GOA:Q98N96"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N96"
FT                   /protein_id="BAB47865.1"
FT                   /translation="MSGLRARQKADRHRRIIEAAAALFREAGYEGAKIEAIAAQAEVSI
FT                   GTIYNYYENKGDILGAIVSLEVNEVLNAGRGVVARPPANVGDALDTLIGIYIEHSLHYL
FT                   SKEMWRQAMAISTQLPDSPFGQAYTALDRSLTEQIRALIARLQEIGLVRQDIDGAALGE
FT                   LIFNNMNMMFIEFVKRDEARIPELRAAIRRQNRILVAAIGV"
FT   CDS_pept        complement(168617..169513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0238"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47866"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47866"
FT                   /db_xref="GOA:Q98N95"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N95"
FT                   /protein_id="BAB47866.1"
FT                   /translation="MDLEALADFNLVAAHGGFGRAGRISGRSKATLSRHVNELEHSLGV
FT                   RLIERGSQSLRLTDEGRALYERTDGLMAEIAEAGEAIVLGASTPRGRLRVSAPVVFAHV
FT                   ALPMIGTRFALAYPEVKLEIVAEDRKVDPVEDGYDLVIRIDPSPDERLIGRRFLNDERL
FT                   IVALPDMPRPQPAPGGGPSPVKAVLLSATSLNVVWRLKFDFEDEILLKPEPILRFSSLL
FT                   MVRDAVLAGAGAALLPKLLVAGDIEAGRLVCWGTDAGPPVEIWALQSSRRLIGAKVRAF
FT                   LDVMERAFPTKVFVSAP"
FT   CDS_pept        169623..170501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0239"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47867"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47867"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N94"
FT                   /protein_id="BAB47867.1"
FT                   /translation="MAILVTGSTGTIGSQVLAHLQGHNVEVRALTRSPETAQFPAGVTA
FT                   VRGDLADPDSVRAALRGVSTLFLLAPNVADELTQAMLTLTVAREAGVKGIVYLSVFGGD
FT                   GYADVPHFAGKYTVERMIEALDLPATILRPAYFIQNDLRQKDGLLKTGVYGSPIGKKGV
FT                   SMVDIRDIGEAAAIELLRREQAATPLGRETYALVGPDSLTGEGIATIWREALGRAIRHG
FT                   GDDLVVMEQRTKTMLPAWHALDLRLMFSRYQTEGAVATADDIERLTKLLGHAPRSYTAF
FT                   ARDAAAQWTKG"
FT   CDS_pept        170538..171488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0240"
FT                   /product="probable esterase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47868"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47868"
FT                   /db_xref="GOA:Q98N93"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N93"
FT                   /protein_id="BAB47868.1"
FT                   /translation="MMTIHPLSPEDAPALAAMRQAASAHKGEKLGPEARPMFDAMFAAT
FT                   PAAADVQVEAATAGGIAGFWLRPVSARSGAHILYLHGGGYVLGSAGALTNFAGQIASRV
FT                   GADTFVPDYRLAPEHPFPAAIDDAVAAYRGLVADGAERIVVVGDSAGGGLTLSLLSALA
FT                   ADKTNGMVQPVGAAVMSPWTDLALTGDSLGTRAEADPIFTGGVLQGFADMYLQGQDAKN
FT                   PKASPLYARLNGLPPIRIDVGDDELLLADSVRYADRARAAGVEVTLSVWQGMPHVFQSS
FT                   LGHFLAAERSVDAIVDFLRQRLVGTSPSNSTASEA"
FT   CDS_pept        171490..172119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0241"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47869"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47869"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N92"
FT                   /protein_id="BAB47869.1"
FT                   /translation="MKILVLGATGATGRLIVAKAIAEGHNVVALVRSKAKAKDLTGAEL
FT                   VEGDARDTAALTRAIAGCDAVVSSLGTAMSPFREVTLLSTATRALVGVMEQQNIRRLVC
FT                   ITGLGAGDSRGHGGFFFDRVLLPLMLRKVYEDKNRQEDAIRASTLDWTIVRPMVLNDKP
FT                   ARGGIKALTDLSGVHGGTIARADVADFVVQQLTADTWLRKSPLITW"
FT   CDS_pept        172241..172624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0242"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47870"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47870"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N91"
FT                   /protein_id="BAB47870.1"
FT                   /translation="MTRILFVGQKPETVDFSDPSLPPGFNAEKINAGIALGVAKIEERG
FT                   WQGDTCMITPDAAGFADLKRALGDGAYDCVVIGGGLRLPPKSLLLFETVVNIIHKAAPN
FT                   AAIAFNTRPEDTADAAARQLPTG"
FT   CDS_pept        complement(172691..173386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0243"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47871"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47871"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N90"
FT                   /protein_id="BAB47871.1"
FT                   /translation="MKIGIVGAGNIGSALTRLFRAAGHEVTISNSRGPGSLAGLSAETG
FT                   ARAAAIEEAVRGQDVVVVAVPTIKIPGLPRELFASTPADVVVIDTTNYYPQQRDGHLDG
FT                   IEDANTESEWVEQHLGRPVVKAFNTIEATHLLPGAKPAGSADRIALAVAGDDARAKSKA
FT                   MALIDGIGFDAVDAGTIAESWRQQPGSPGYLKDYGVKGVHSALAKANPERQPEWRATPN
FT                   SPGTYDSPA"
FT   CDS_pept        173499..174425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0244"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47872"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47872"
FT                   /db_xref="GOA:Q98N89"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N89"
FT                   /protein_id="BAB47872.1"
FT                   /translation="MDRLASMTAFVKAAESGSFAATASALGISPQMVAKHVTYLEARLG
FT                   ARLLNRTTRKQSLTVIGKSYYDRCKVALAEVDWADAIADEARGKPRGLLRVNAAVSFGA
FT                   HCVTPVVARYLSSHPSVDVDLVLNDRFVDLIDDGFEAVFRIGPLGESNLGAIELAPFQT
FT                   IACGSPAYLKERGMPSIVSDLVNHECLLFGNWPEPTFSDWLFVRDGLTSKASVHGRLKV
FT                   NNPASLLEAALAGFGLALIGEEAVRTHLATGRLVRVLPNYETPPRPIHLLFHPDRRQTP
FT                   KLKTFIEMVVDQLGRNGQDGRRRQQGE"
FT   tRNA            complement(174602..174674)
FT                   /product="trnT-TGT"
FT   CDS_pept        complement(174730..175068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0246"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47873"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47873"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N88"
FT                   /protein_id="BAB47873.1"
FT                   /translation="MAPSRYERCNFLFPIPYSLLPIPSSHPRDMPKPEGERYETDDRGH
FT                   AGPVDIGLLYVADELHQQHPGDDDEGENDDKPDHATLQSEAIASLSYVGSGLVDFSMGR
FT                   RRRHPPPG"
FT   CDS_pept        175165..175893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0248"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47874"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47874"
FT                   /db_xref="GOA:Q98N87"
FT                   /db_xref="InterPro:IPR012413"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N87"
FT                   /protein_id="BAB47874.1"
FT                   /translation="MVASVKDPGGHHVQAHAHFRSRSRFRRHRRAGRHRPVVLGSRHAS
FT                   SPLLLRRRLWRLLVVPPPSSPSSSPWQGGYHPLMPRPVACEGRPRPPFCIFRRPTGRNP
FT                   AASPQKNQKSLEPFAAPQRQMIKRRMDRLGQRSKEIVMFKRTLVSALIATTVAGTTLVG
FT                   TVQPSAAHSHHHDLGIGIAAGVGGFVLGSLLAQQPPRTVYVDEDGGSWHVRRCFDRYSS
FT                   YDPDSDTYIGRDGYSHYCRL"
FT   CDS_pept        complement(175973..176383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0249"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47875"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47875"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N86"
FT                   /protein_id="BAB47875.1"
FT                   /translation="MRKTVQLLLVASLSGCVAPRPDAGDQHVDPIPFSLALEEVVITGI
FT                   RQHLPDPASVRLGRTLAGERTLNGRKEIVVCGFVNGKDPSGGSGGEQAFIARIYPDSAT
FT                   SFDLVAMGSASETRRLVDSTCSAAGLPISDSA"
FT   CDS_pept        complement(176518..177339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0250"
FT                   /product="transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47876"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47876"
FT                   /db_xref="GOA:Q98N85"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N85"
FT                   /protein_id="BAB47876.1"
FT                   /translation="METTEKRQRGRPRAFNGPAEASSVQSLDRALRILAIVAEGSGLSL
FT                   SEISAQSGLAASTAYRMLTTLENHGMVEFDTSDQLWSIGVETYRMGAAFLRRRKLVDRA
FT                   RIVMQELMERTGETANLGVAEDDCVVFVSQVETHQAIRAFFRPGTRSPFHASGIGKAVL
FT                   AHLEPERVGTILRKAGLQRFTDRTLSEIPALAHDLAVIKQRGWSVDDEERHPGMRCVAA
FT                   AIFNEFGEPIGGVSVSGPTVRVTPERLAEIGPMVRSAAAEVTRMIGGAQVG"
FT   CDS_pept        177553..179334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0251"
FT                   /product="glyoxylate carboligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47877"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47877"
FT                   /db_xref="GOA:Q98N84"
FT                   /db_xref="InterPro:IPR006397"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N84"
FT                   /protein_id="BAB47877.1"
FT                   /translation="MARMRAVDAAVLVLEKEGIACAFGVPGAAINPLYSALKARGTIRH
FT                   VLARHVEGASHMAEGFTRAKAGNIGLCIGTSGPAGTDMITGLYSAAADSIPILCITGQA
FT                   PRARLNKEDFQAVDIAAIAAPVAKWAVTVMEPYLVPMALQKAFHLMRSSRPGPVLIDLP
FT                   VDVQLAEIEFDIDAYEPMAPFKPAMTRVQAEKALAMLNAAEKPLIVAGGGIINADASDL
FT                   LIEFAEISGVPVIPTLMGWGAIPDDHRLMAGMCGLQTSHRYGNATMLEADFVFGIGNRW
FT                   ANRHTGSVDVYTKGKKFIHVDIEPTQIGRVFAPDLGVVSDAGAALKMLLDVATEWKTAG
FT                   KLRDWSGWAKECQARKKTMKRKTHFDQVPLKPQRVYEEMNKAFGRDVTYVTTIGLSQIA
FT                   GAQFLHVYKPRNWINCGQAGPLGWTLPAALGVRAADPERTIVALSGDYDFQFMIEELAV
FT                   GAQHKLPYIHVVVNNAYLGLIRQAQRGFSMDYEVSLAFENINRSGDPEAGYGVDHVAVA
FT                   EAMGCKAVRVRKPEEFAGAFREAQRLMKEHRVPVVLEFILERVTNISMGTEIDKITEFE
FT                   DLAESHEDAPTAIVMLD"
FT   CDS_pept        179345..180142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0252"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47878"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47878"
FT                   /db_xref="GOA:Q98N83"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR017643"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N83"
FT                   /protein_id="BAB47878.1"
FT                   /translation="MPRFSANLSMLFAEHDFLDRFDAAARAGFKGVEYIGPYDHAPEVV
FT                   AARLKKNGLTQVLFNLPAGDWGKGERGIAVLPDRVPEFRQGIAKAITYAQALGCQQVNC
FT                   LAGIAPAGVDRKVLEDVFAENLAFAAEKLERVGIRLLIEPINTRDIPGFFLNYSDQALA
FT                   LIDRVGSKNLFLQYDIYHMQIMEGDLARKIEANLGRIAHIQLADNPGRHEPGTGEINYP
FT                   FLYDHIDRIGYAGWIGAEYKPKAGTEAGLGWFRDLTGQGSAAA"
FT   CDS_pept        180247..181164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0254"
FT                   /product="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47879"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47879"
FT                   /db_xref="GOA:Q98N82"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006398"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N82"
FT                   /protein_id="BAB47879.1"
FT                   /translation="METIGFIGLGIMGAPMAGHLLDAGYKVIASDHRSKPLADLVAKGL
FT                   KTVSGHAAVAKAADIIITMVPDTPQVADVLFGDNGVASGLTRGKLVIDMSSISPIETKV
FT                   FAGKINELGCDYLDAPVSGGEVGAKAASLTIMVGGEEKAFERAKPVFEKMGKNITLVGP
FT                   NGVGQTTKVANQIVVALTIEAVAEALVFASKAGADPARVRQALMGGLAASRILEVHGER
FT                   MVKRTFAPGFRIELHQKDLNLALEGAKALGVSLPNTSTTQQLFNSCAANGGAREDHSAL
FT                   VRALERMANFEVGGAVAEVKGKAA"
FT   CDS_pept        complement(181281..181988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0255"
FT                   /product="tRNA/rRNA metyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47880"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47880"
FT                   /db_xref="GOA:Q98N81"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N81"
FT                   /protein_id="BAB47880.1"
FT                   /translation="MRLYGLHTVRAALDNPRRKIRKMLVTRNAAERLEIEDLAALTFKA
FT                   ELVEPRDIDKITGSDAVHQGVLIEAEPLKPKRLDALGDTRLVLVLDQITDPHNVGAILR
FT                   SAVAFGAGALITTARHSPQESGVLAKSASGALEHIDQIEVKNLADALGQLHEAGFQTIG
FT                   LDSDGPAELETSFAGDRIALVLGAEGKGLRQKTRETVTTLARLDMPGAIRSLNVSNAAA
FT                   VSLYAARAFLKRG"
FT   tRNA            182332..182413
FT                   /product="trnY-GTA"
FT   tRNA            182507..182577
FT                   /product="trnG-TCC"
FT   CDS_pept        complement(182660..183034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0256"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47881"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47881"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N80"
FT                   /protein_id="BAB47881.1"
FT                   /translation="MLSGRSAEQPDQPQAPAPVDPAATTASDGGLLGGLGGLLDKLKDA
FT                   GHGNVADSWVGTGQNQAINANDLGAALGPQVIREIAQRTGLDEQELLKQLSAALPGIVD
FT                   KLTPNGQVPQQHQVASAFNS"
FT   CDS_pept        complement(183067..183210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0258"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47882"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47882"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N79"
FT                   /protein_id="BAB47882.1"
FT                   /translation="MIVKTSSQLEIAPGYAIVEGGQGLVEMEDPLWDFLTTPFPAATSP
FT                   NR"
FT   CDS_pept        183249..183506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0259"
FT                   /product="transglycosylase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47883"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47883"
FT                   /db_xref="GOA:Q98N78"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N78"
FT                   /protein_id="BAB47883.1"
FT                   /translation="MGIISWIILGAIAGFLGSKIVNKTGQGLIMDIVLGIVGAIVGGVI
FT                   CSRLFGVGVTGLNISSLIVAVVGAIVVLWAYHQFSGRRTL"
FT   CDS_pept        complement(183666..183830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0261"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47884"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47884"
FT                   /db_xref="GOA:Q98N77"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N77"
FT                   /protein_id="BAB47884.1"
FT                   /translation="MINQPRELPMTDFDRNKNSDTEHKAAIRKSLVGWAMFIAGTLIFF
FT                   AAADAVLMP"
FT   CDS_pept        complement(183915..184802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0262"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47885"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47885"
FT                   /db_xref="GOA:Q98N76"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N76"
FT                   /protein_id="BAB47885.1"
FT                   /translation="MHFIPASIRGPLFMIVSTGSYLVNDTMMKLATAGLPSYEVLFLRG
FT                   VAAALWGFPLLFLLGYGKQIPLIFDGHVLRRNLLELAAILCYVVALANMQIADSTALGQ
FT                   ITPLLMLVGSSILFGERIGGQRMALIGLGFIGALMVAQPTMQGISVYALLALGNAALSA
FT                   ARDLAGRRVSAEVPGMIVAISAVVVVLIGAGAAHLVSERWVMPEARHLLLMAGAGFFLI
FT                   FGHFFIFMAYRVGPTSAVAPFYYCFTVWAVISGLLVFGQFPNALAVCGILLVVASGLTI
FT                   VSLDQRKRRLTVVA"
FT   CDS_pept        185097..186272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0263"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47886"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47886"
FT                   /db_xref="GOA:Q981F7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q981F7"
FT                   /protein_id="BAB47886.1"
FT                   /translation="MAKGKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEYKRYDQI
FT                   DAAPEEKARGITISTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAA
FT                   DGPMPQTREHILLARQVGVPSIVVFLNKVDQVDDAELLELVELEVRELLSKNEFPGDDI
FT                   PIVKGSALAALEDSNKTIGEDAIRELMAQVDAYIPTPVRPLDKPFLMPIEDVFSISGRG
FT                   TVVTGRVERGVVKVGEELEIIGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDR
FT                   EGVERGQVLAKPGTVKPHKKFVAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGIVS
FT                   LPAGTEMVMPGDNITVDVELIVPIAMEEKLRFAIREGGRTVGAGIVVTIKE"
FT   CDS_pept        186429..188093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0266"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47887"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47887"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N75"
FT                   /protein_id="BAB47887.1"
FT                   /translation="MVPGRCFNAKAWWPQALADLALLAVIVLFVLPAQAQEQSLDIPPM
FT                   RFAVVRSNAPGCEPNCPEWISAEGTIAAGTPALLKRTLKTLGGRQLPVVVNSPGGNVDA
FT                   ALALGRMIRKAKLDIAVGVTVFSGCQPEAKNCSDNKGKGADYFGVAFDDGAMCNSACPL
FT                   MFSGGIRRVVGDFAYLGVHQITTTYRREKLLYRTTYRIVNGKKKVINTKVVSRKNAGSY
FT                   KTYEMSKAVEKTLSAYLREMGIGDGVLEMMKATPASDIRQIGLDDMTAMKLVTSRDAVD
FT                   LLTSASLCAPQQPAANCREMPGSANDATPSAAATGRPRNVVPAGPETAKAGADMRFVVV
FT                   RGSNPLCNPDCPEWISAEGAITSQTPQKLRQLLATLGNRRLPVVISSRGGDLAGALAAG
FT                   RIIRERKLDVAVGRTDFVDCDPGAWNCLAKEGAYAGLSIDAGVECDTACALMLAGGARR
FT                   LVGPQARLSLYPMGQKQMVKAYLEEMAIGPALFKAIAGRSAERQLGPDIMLKAGLTTGP
FT                   QSVDALTGATICKAVPRPDNCRGLPPANAAADAPAKL"
FT   CDS_pept        188190..188672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0267"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47888"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47888"
FT                   /db_xref="GOA:Q98N74"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N74"
FT                   /protein_id="BAB47888.1"
FT                   /translation="MSRDVPTLYEWAGGSDALNRLTQTFYDKVAKDPVVGPVFKAMSPD
FT                   HPSHVAAFIGEVFGGPKTYSEKFGGHREMVMHHLGKHLTEEQRRRWINLLADAADEVGL
FT                   PDDPEFRSAFMGYVEWGSRLAKMNSNLGETCDPETEPMPAWGWGVPGGPYTPPETN"
FT   CDS_pept        188701..189252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0268"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47889"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47889"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N73"
FT                   /protein_id="BAB47889.1"
FT                   /translation="MSDDFKIVRWREWDGPGIEHLELRQRAGEVLADSVVICSGQTPFA
FT                   VRYRMECDAHWRARRVMVDMIGSGRTLVLASDGDDSWVRDGLPVPELDGVLDPDLTVTP
FT                   FTNTLPIRRLRLSNGQSAEITTAFIEFPALTVASNPQRYTCLDEGRRYLYETRASDFRR
FT                   ELEIDRDGLVVTYPDFWQRG"
FT   tRNA            189335..189407
FT                   /product="trnW-CCA"
FT   CDS_pept        189774..189977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0269"
FT                   /product="secretion protein; SecE"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47890"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47890"
FT                   /db_xref="GOA:Q98N72"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N72"
FT                   /protein_id="BAB47890.1"
FT                   /translation="MASKTTNPFVFLQQVRSETAKVTWPSRRETMISTVMVLAFAVIAM
FT                   IFFFSADQLMGLAIEQILGIGR"
FT   CDS_pept        190007..190534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0270"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47891"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47891"
FT                   /db_xref="GOA:Q98N71"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N71"
FT                   /protein_id="BAB47891.1"
FT                   /translation="MAARWYIVHAYSNFEKKVAEDIENKAKQKGLSADIEQIVVPTEKV
FT                   VEVRRGRKVDAERKFFPGYVLLKANLTDAVFSLVKNTPKVTGFLGDSKPVPITEAEAQR
FT                   ILNQVQEGVERPKPSVTFEIGEAIRVSDGPFASFNGFVQEVDEERARLKVEVSIFGRAV
FT                   PVDLEFGQVEKG"
FT   CDS_pept        190705..191133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0271"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47892"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47892"
FT                   /db_xref="GOA:Q98N70"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N70"
FT                   /protein_id="BAB47892.1"
FT                   /translation="MAKKIAGQLKLQVSAGSATPSPPIGPALGQRGINIMEFCKAFNAQ
FT                   TQEMEKGSPVPVVITYYQDKSFTFVMKTPPVSYFLKKAANLKSGSKEPGKVKAGTVSRD
FT                   KVREIATAKMKDLNANDVEAAMRMVEGSARSMGLEVVG"
FT   CDS_pept        191138..191836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0273"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47893"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47893"
FT                   /db_xref="GOA:Q98N69"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N69"
FT                   /protein_id="BAB47893.1"
FT                   /translation="MAKIAKRVSKTREGIDPNKAYALGEALKLLKDRSSVKFDETVEVA
FT                   MNLGVDPRHADQMVRGVVNLPNGTGRSVRVAVFARGDKAEEAKAAGADIVGAEDLVDIV
FT                   QKGTIDFDRCIATPDMMPLVGRLGKVLGPRGMMPNPKVGTVTTDVAAAVKASKGGAVEF
FT                   RVEKAGIVHAGVGKVSFDVKALEENIRAFADAVTKAKPAGAKGNYVKKVSVTSTMGPGL
FT                   KLDVSTLAAS"
FT   CDS_pept        192230..192748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0274"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47894"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47894"
FT                   /db_xref="GOA:Q98N68"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N68"
FT                   /protein_id="BAB47894.1"
FT                   /translation="MDRAEKRELVTGLNEAFGNAGSVVVAHYAGITVAQMNDLRSKMRA
FT                   AGGTVKVAKNRLAKIALQGTDSASIIDLFKGQTLIAYSEDPIAAPKVASDFAKGNDKLV
FT                   ILGGAMGTTSLNADGVKALATLPSLDELRAKLVGMIATPATRIAQIVNAPAASVARVIG
FT                   AYARKDEAA"
FT   CDS_pept        192803..193180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0275"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47895"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47895"
FT                   /db_xref="GOA:Q98N67"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N67"
FT                   /protein_id="BAB47895.1"
FT                   /translation="MADLAKIVDDLSKLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGG
FT                   AAAAAAPAEEKTEFDVVLTDAGAQKINVIKEVRAITGLGLKEAKDLVEAAPKPVKEGVS
FT                   KADADKFKAQLEAAGAKVDLK"
FT   CDS_pept        193431..197567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0276"
FT                   /product="RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47896"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47896"
FT                   /db_xref="GOA:Q98N66"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N66"
FT                   /protein_id="BAB47896.1"
FT                   /translation="MAQTQTFNGRRRVRKFFGKIPEVAEMPNLIEVQKASYDQFLMVDE
FT                   PKGGRPDEGLQAVFKSVFPISDFSGSSMLEFVKYEFEGPKFDVDECRQRDLTYAAPLKV
FT                   TLRLIVFDIDEDTGAKSIKDIKEQDVYMGDMPLMTLNGTFIVNGTERVIVSQMHRSPGV
FT                   FFDHDKGKSHSSGKLLFAARVIPYRGSWLDIEFDSKDVVHARIDRRRKIPVTSLLMALG
FT                   MDGEEILSTFYNKITYVRAGDHWRIPFNVERFRGLKAVGDLVDADTGEIVVEAGKKITA
FT                   RQARQLGEKGLKAIKATDEDLLGNYLAEDIVNYATGEIFLEAGDEIDEKTLKVLLGTGE
FT                   QEIKVLDIDHVNVGAYIRNTLNVDKNESRQDALFDIYRVMRPGEPPTLETAEAMFNSLF
FT                   FDSERYDLSAVGRVKMNMRLELKAEDTVRVLRKEDILAVVKTLVELRDGKGEIDDIDNL
FT                   GNRRVRSVGELMENQYRVGLLRMERAIKERMSSIEIDTVMPQDLINAKPAAAAVREFFG
FT                   SSQLSQFMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEG
FT                   PNIGLINSLATFARVNKYGFIESPYRKIVDGKLTNDVVYLSAMEEAKHHVAQANAELDK
FT                   NGGFVDEFVICRSAGEVMMAPRENVDLMDVSPKQMVSVAAALIPFLENDDANRALMGSN
FT                   MQRQAVPLVRAEAPFVGTGMEPIVARDSGAAIGARRGGIVDQVDATRIVIRATEDLDPG
FT                   KSGVDIYRLMKFQRSNQNTCINQRPLVRMGDRVNKGDIIADGPSTELGDLALGRNVLVA
FT                   FMPWNGYNYEDSILLSERIVADDVFTSIHIEEFEVMARDTKLGPEEITRDIPNVSEEAL
FT                   KNLDEAGIVYIGAEVQPGDILVGKITPKGESPMTPEEKLLRAIFGEKASDVRDTSMRMP
FT                   PGTFGTVVEVRVFNRHGVEKDERAMAIEREEIERLAKDRDDEQAILDRNVYARLSDVLV
FT                   GKEAIAGPKGFKKGSTLSKDTLDEYPRSQWWQFAVENEKLQSELEALRGQYDDSKKALE
FT                   QRFMDKVEKVQRGDEMPPGVMKMVKVFVAVKRKMQPGDKMAGRHGNKGVVSRIVPVEDM
FT                   PFLEDGTHADIVLNPLGVPSRMNVGQILETHLGWACAGMGKKIGELIDTYKAAGDIKPL
FT                   RKTLESFMPANDRNEPIREYDDESIVRLSEQMRRGVSIATPVFDGAHEADINIMLEQAG
FT                   LHTSGQSQLYDGRTGEPFDRKVTMGYIYMLKLHHLVDDKIHARSIGPYSLVTQQPLGGK
FT                   AQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVAGRTKVYEAIVRGDDTFEAGIPE
FT                   SFNVLVKEMRSLGLNVELENTKLDDAPVRLPDAAE"
FT   CDS_pept        197699..201895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0277"
FT                   /product="RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47897"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47897"
FT                   /db_xref="GOA:Q98N65"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N65"
FT                   /protein_id="BAB47897.1"
FT                   /translation="MNQEVMNLFNPQAPAQVFDSIRISLASPEKILSWSFGEIKKPETI
FT                   NYRTFKPERDGLFCARIFGPIKDYECLCGKYKRMKYKGVICEKCGVEVTLSRVRRERMG
FT                   HIELAAPVAHIWFLKSLPSRIGTLLDMTLKDIERVLYFENYIVTEPGLTALKEHQLLSE
FT                   EEYMIAVDEYGEDSFTAMIGAEAIHDLLAGMDLEKIAGDLRSELASTTSELKQKKYLKR
FT                   LKVVENFMESGNRPEWMIMKVVPVIPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRL
FT                   KRLIELRAPGIIVRNEKRMLQEAVDALFDNGRRGRVITGANKRPLKSLSDMLKGKQGRF
FT                   RQNLLGKRVDYSGRSVIVTGPELKLHQCGLPKKMALELFKPFIYARLDAKGYSSTVKQA
FT                   KKLVEKERPEVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCTA
FT                   FNADFDGDQMAVHVPLSLEAQLEARVLMMSTNNILHPASGAPIIVPSQDMVLGLYYLSI
FT                   VNQNEPGEGMVFADMGELQHALETKAVTLHAKIKGRFRTVDAEGKVVSKIHDTTPGRMI
FT                   IGELLPKNVNVPYETANQEMTKKNISKMIDTVYRHCGQKETVIFCDRIMALGFAHACRA
FT                   GISFGKDDMLIPDSKIKLVSDTEALAKEYEQQYNDGLITQGEKYNKVVDAWAKCSEKVA
FT                   DEMMARIKAVEFEDNGRQKPMNSIYMMSHSGARGSPTQMRQLAGMRGLMAKPSGEIIET
FT                   PIISNFKEGLTVLEYFNSTHGARKGLADTALKTANSGYLTRRLVDVAQDCIVNSVDCGT
FT                   DKGLTMQPIVDAGQVVASVGQRVLGRTALDDINHPVTGDLLVKAGTLMDERDVEQIEKA
FT                   GVQSVRIRSALTCEVRVGVCAVCYGRDLARGTPVNQGEAVGVIAAQSIGEPGTQLTMRT
FT                   FHMGGTAQVVDSSFLEASYEGKVEIRNRNVVRNSDGQQMVMGRNMAVLILDEAGKERAT
FT                   HRVTYGSRIFVDDGDKVKRGQRIAEWDPYTRPILTEIEGRVAFEDLVDGISVQETADES
FT                   TGITKREVIDWRSTPRGNDLKPAIVVQDAKGKVGKLSKGGDARFLLSVEAILSVEPGAQ
FT                   VRPGDVLARIPMESAKTKDITGGLPRVAELFEARRPKDHAIIAEIDGTIRFGRDYKNKR
FT                   RIIIEPHDSTLEPVEYLIPKGKPFHLQDGDVIEKGDYILDGNPAPHDILAIKGVEALAS
FT                   YLVNEIQEVYRLQGVSINDKHIEVIVRQMLQKVEITTQGDSTYIPGDHVDVIELEEVNE
FT                   RLIEDGKKPAEGQPVLLGITKASLQTPSFISAASFQETTRVLTEAAVAGKTDMLQGLKE
FT                   NVIVGRLIPAGTGGTMSQIRRIATSRDELIIDERRKASGVEVAEPMLADMTTAAQ"
FT   CDS_pept        202105..202770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0279"
FT                   /product="O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47898"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47898"
FT                   /db_xref="GOA:Q98N64"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N64"
FT                   /protein_id="BAB47898.1"
FT                   /translation="MSTKTWAAVDDYIVDALFDADLALDAVLAANRDQGLPPIDVSPAQ
FT                   GKLLSLLARIRGAKKILEIGTLGGYSTIWMARALPMDGKIVTLELDPHHAKVARSNFER
FT                   AGVSDQVELRVGPALKSLAALSAENAGPFDLIFIDADKPNNPNYLSGAMRLSRPGTVII
FT                   CDNVIRDGAVLDGGGHDANVVGARAAFSFIGGDKRLDGTAIQTVGAKGYDGFAIAIVE"
FT   CDS_pept        complement(203076..204011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0280"
FT                   /product="galactose 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47899"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47899"
FT                   /db_xref="GOA:Q98N63"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N63"
FT                   /protein_id="BAB47899.1"
FT                   /translation="MSSNNNPINIGIVGVGKIVRDQHLPALAKDQNYRLIAAASRHGKV
FT                   DGIPNFPTIEAMLDAVPELEAVSLCMPPQFRYDAARTALEAKKHVFLEKPPGATVSEVE
FT                   DLKVLAGKNGVSLFASWHSRYAPAVEAARGFLASTQIRSAAIVWKEDVRRWHPNQEWIW
FT                   APGGFGVFDPGINALSIATHILPAMFITSAVLDFPENRAAPVAAQVTFRTSNGLPVAMD
FT                   LDWLQTGPQSWDILADTDAGKMVLSGGGSKLAIDGRIVHEEPEAEYPMLYKRFAEIVRA
FT                   GTSDVDLAPLQHVADAFMLGKRNVVEAFFD"
FT   CDS_pept        complement(204123..204404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0282"
FT                   /product="two component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47900"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47900"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N62"
FT                   /protein_id="BAB47900.1"
FT                   /translation="MNDNEERPVTIITGRVWKRKGGKAEGVHVMLVAPDDDSAVRRALE
FT                   SLAAEGYAEAELDQIGDMDGVPDDEPHLSAYQGALEGEVSIVTFDAPI"
FT   CDS_pept        204878..205249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0283"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47901"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47901"
FT                   /db_xref="GOA:Q98N61"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N61"
FT                   /protein_id="BAB47901.1"
FT                   /translation="MPTVNQLIRKPRIAPVKRNKVPAMQQNPQKRGVCTRVYTTTPKKP
FT                   NSALRKVAKIRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDT
FT                   QGVKNRKQRRSKYGAKRPK"
FT   CDS_pept        205310..205780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0284"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47902"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47902"
FT                   /db_xref="GOA:Q98N60"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N60"
FT                   /protein_id="BAB47902.1"
FT                   /translation="MSRRHSAEKREINPDPKFGDLIVTKFMNAVMYDGKKSVAETIVYG
FT                   ALDQVQSKTKQEPVTVFHQALDNVAPHVEVRSRRVGGATYQVPVDVRPERRQALAIRWL
FT                   IAAARNRNETTMIDRLSGELMDAANNRGTAVKKREDTHKMAEANRAFAHYRW"
FT   CDS_pept        205810..207900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0286"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47903"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47903"
FT                   /db_xref="GOA:Q98N59"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N59"
FT                   /protein_id="BAB47903.1"
FT                   /translation="MAREYKIEDYRNFGIMAHIDAGKTTTTERVLYYTGKSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWKGRDGKMRRFNIIDTPGHVDFTIEVERSLRVL
FT                   DGAIALLDANAGVEPQTETVWRQADKYRVPRMIFCNKMDKIGADFYRSVEMIGSRLGAQ
FT                   AVVMQLPIGAETEFKGVVDLVEMNALVWRDETLGAAWDVVEIPADLQARAQEYREKMIE
FT                   AAVEMDETALENYLEGKMPSNDEIRSLIRKGTIAVKFFPMFCGSAFKNKGVQPLLDAVV
FT                   EYLPSPADVPAIKGVDAKTDAEIERHAVDDEPLSMLAFKIMNDPFVGSLTFARIYSGKL
FT                   TKGISVDNTVKGKKERIGRMLQMHANSRADVEEAFAGDIVALAGLKDTTTGDTLCDPLH
FT                   PVILERMEFPDPVIQIAIEPKTKNDQEKMGLALHRLAAEDPSFRVKTDEESGQTIISGM
FT                   GELHLDIIVDRMRREFKVEANVGAPQVAYRETITRKHEQDYTHKKQTGGTGQFARVKVL
FT                   FEPNTESEEFVFESKIVGGAVPKEYIPGVEKGIQSVMGAGPFAGFPMIGVRATLIDGAY
FT                   HDVDSSVLAFEIASRACFREAAPKLGVQLLEPIMKVEVVTPEDYVGSVIGDLNGRRGQI
FT                   QGQEARGVAVVINAMVPLANMFKYVDNLRSMSQGRAAYTMQFDHYEPVPTAVAQEVQKK
FT                   YA"
FT   CDS_pept        207968..209143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0288"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47904"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47904"
FT                   /db_xref="GOA:Q981F7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q981F7"
FT                   /protein_id="BAB47904.1"
FT                   /translation="MAKGKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEYKRYDQI
FT                   DAAPEEKARGITISTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAA
FT                   DGPMPQTREHILLARQVGVPSIVVFLNKVDQVDDAELLELVELEVRELLSKNEFPGDDI
FT                   PIVKGSALAALEDSNKTIGEDAIRELMAQVDAYIPTPVRPLDKPFLMPIEDVFSISGRG
FT                   TVVTGRVERGVVKVGEELEIIGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDR
FT                   EGVERGQVLAKPGTVKPHKKFVAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGIVS
FT                   LPAGTEMVMPGDNITVDVELIVPIAMEEKLRFAIREGGRTVGAGIVVTIKE"
FT   CDS_pept        209213..209521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0289"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47905"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47905"
FT                   /db_xref="GOA:Q98N58"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N58"
FT                   /protein_id="BAB47905.1"
FT                   /translation="MNGQNIRIRLKAFDHRVLDASTKEIVSTAKRTGANVRGPIPLPTR
FT                   IEKFTVNRSPHVDKKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL"
FT   CDS_pept        209583..210296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0291"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47906"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47906"
FT                   /db_xref="GOA:Q98N57"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N57"
FT                   /protein_id="BAB47906.1"
FT                   /translation="MRSGVIAKKVGMTRIYNDAGEHVPVTVLQMENCQVVAQRTQEKNG
FT                   YTAVQLGVGLAKVKNTSKAMRGHFATASVEPKAKVAEFRVSADNMIDVGAEITVEHFVA
FT                   GQKVDVTGTTIGKGFQGVIKRHHMGGGRATHGNSVSHRTHGSTGQRQDPGKVFKGKKMA
FT                   GHMGDTRVTTQNVEIVSTDADRGLILIRGAVPGSKGAWILVRDAAKVALPANAPKPAAI
FT                   RAAVKNEAPATEGAE"
FT   CDS_pept        210296..210916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0292"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47907"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47907"
FT                   /db_xref="GOA:Q98N56"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N56"
FT                   /protein_id="BAB47907.1"
FT                   /translation="MDLKITTLGGKDAGKVKLSEEIFGLDPREDILQRVVRWQLAKKQQ
FT                   GTHKAKGRAEIARTGAKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEHDLPKNV
FT                   RALGLKHALSAKAKSASIIVIDELKLTEAKTKALIANFATLGLSNALVIGGAELDKNFK
FT                   LAATNIPNIDVLPIQGINVYDILRRGTLVLSKAAVEALEERFK"
FT   CDS_pept        210913..211206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0293"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47908"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47908"
FT                   /db_xref="GOA:Q98N55"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N55"
FT                   /protein_id="BAB47908.1"
FT                   /translation="MTDLRHYDVIVSPAITEKSTMASEQNQVVFNVAKKASKPEIKAAV
FT                   EALFGVKVMAVNTLVRKGKIKRFRGTIGRQSDVKKAIVTLADGQSIDVATGL"
FT   CDS_pept        211229..212062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0295"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47909"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47909"
FT                   /db_xref="GOA:Q98N54"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N54"
FT                   /protein_id="BAB47909.1"
FT                   /translation="MALKKFNPVTPSTRQLVIVDRSGLYKGKPVKGLTEGLTKSGGRNN
FT                   YGRITARFIGGGHKRSYRIIDFKRRKFDVVGTVERIEYDPNRTAFIALIKYDDGELSYI
FT                   IAPQRLAAGDKIVAGEAVDVKPGNAMPLASMPVGTIVHNIELKPGKGGQVARSAGGYAQ
FT                   LVGRDQGMAILRLNSGEQRVVHGSCMATVGAVSNPDHGNINDGKAGRTVWRGKRPHNRG
FT                   VTMNPVDHPHGGGEGRTSGGRHPVSPWGKPTKGKKTRSNKATDKFILRSRHQRKS"
FT   CDS_pept        212079..212357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0297"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47910"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47910"
FT                   /db_xref="GOA:Q98N53"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N53"
FT                   /protein_id="BAB47910.1"
FT                   /translation="MTRSIWKGPFIDGYLLKKVDKVREGGRNEVIKMWSRRSTILPQFV
FT                   GFTFGVYNGQKHVPVSVNEDMVGHKFGEFAPTRTYYGHGADKKAKRK"
FT   CDS_pept        212360..212749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0298"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47911"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47911"
FT                   /db_xref="GOA:Q98N52"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N52"
FT                   /protein_id="BAB47911.1"
FT                   /translation="MGKAKAPRRLADNEARAVLRTIRISPQKLNLVAALIRGKKVATAL
FT                   SDLEFSAKRISGTVKKTLESAIANAENNHDLDVDALVVAEAYVGKSIVMKRFHARGRGR
FT                   ASRIEKPFSHLTIVVREVEEKGEAA"
FT   CDS_pept        212749..213474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0300"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47912"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47912"
FT                   /db_xref="GOA:Q98N51"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N51"
FT                   /protein_id="BAB47912.1"
FT                   /translation="MGQKVNPIGLRLGINRTWDSRWFANTGEYGKLLHEDIKIRKYLEK
FT                   ELKQAAISKVVIERPHKKCRVTIHAARPGLIIGKKGADIEKLRKKLMEMTKSETHLNIV
FT                   EVRKPEIDATLVAQSIAQQLERRIAFRRAMKRAVQSAMRLGAEGIRINCSGRLGGAEIA
FT                   RMEWYREGRVPLHTLRADVDYGTAEANTAYGICGVKVWVFKGEILEHDPMASERRATEG
FT                   DAAHGGGGDRERGRRRENA"
FT   CDS_pept        213502..213915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0301"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47913"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47913"
FT                   /db_xref="GOA:Q98N50"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N50"
FT                   /protein_id="BAB47913.1"
FT                   /translation="MLQPKRTKFRKQFKGRIHGTAKGGTNLDFGGFGLKALEPNRVTAR
FT                   EIEAARRAITREMKRAGRVWIRIFPDLPVTSKPTEVRMGKGKGAVDYWAARVKPGRIMF
FT                   EIDGVSEETAREALRLGAAKLSVRTRFVQRIAE"
FT   CDS_pept        213929..214129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0303"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47914"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47914"
FT                   /db_xref="GOA:Q98N49"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N49"
FT                   /protein_id="BAB47914.1"
FT                   /translation="MKAEDIRTKTQDQLTDDLASLKKEQFNLRFQKATGQLEKTARVRQ
FT                   VRKDIARIKTIAAEKSAAKKA"
FT   CDS_pept        214141..214380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0304"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47915"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47915"
FT                   /db_xref="GOA:Q98N48"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N48"
FT                   /protein_id="BAB47915.1"
FT                   /translation="MPKRILQGTVVSDKNEKTVVVKVERRFTHPVMKKTVRMTKKYKAH
FT                   DENNAHKVGDQVFIQESKPISKDKRWIVVSSDQA"
FT   CDS_pept        214465..214833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0305"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47916"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47916"
FT                   /db_xref="GOA:Q98N47"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N47"
FT                   /protein_id="BAB47916.1"
FT                   /translation="MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYASVGDIIVVSIKE
FT                   AIPRGRVKKGDVMKAVVVRTAKDIRRPDGSVIRFDKNAAVLVDNKKEPIGTRIFGPVPR
FT                   ELRAKNHMKIISLAPEVL"
FT   CDS_pept        214846..215160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0306"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47917"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47917"
FT                   /db_xref="GOA:Q98N46"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N46"
FT                   /protein_id="BAB47917.1"
FT                   /translation="MQKIRKGDKVVVLAGKDKGRSGEVLSVQPKDDTALVRGVNMIRRH
FT                   QKQSQSQEGGIITKEAPIQLSNIALADPKDGKPTRVGFIFQKDGKKVRVAKRSGEVING
FT                   "
FT   CDS_pept        215153..215731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0308"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47918"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47918"
FT                   /db_xref="GOA:Q98N45"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N45"
FT                   /protein_id="BAB47918.1"
FT                   /translation="MAKAQSKQATATNTPRLKQVYNETIRKALQEQFGYDNDMQVPRLD
FT                   KIVLNMGVGEATADSKKPSVAAEDLALIAGQKAVVTRARNSIAGFKVRENMPIGAKVTL
FT                   RKERMYEFLDRLVNIALPRVRDFRGLNPKSFDGRGNYAMGIKEHIVFPEINYDKVDQIW
FT                   GMDVIVCTTAKTDDEARALLKAFNFPFRQ"
FT   CDS_pept        215759..216064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0309"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47919"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47919"
FT                   /db_xref="GOA:Q98N44"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N44"
FT                   /protein_id="BAB47919.1"
FT                   /translation="MAKTSSVEKNNRRRKLADQYGPKRAALKAIIMDQSKPMEERFRAQ
FT                   LKLAALPRNSAKIRIRNRCEVTGRPRAYYRKLKVSRIALRDLGNNGQIPGLVKSSW"
FT   CDS_pept        216077..216475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0310"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47920"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47920"
FT                   /db_xref="GOA:Q98N43"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N43"
FT                   /protein_id="BAB47920.1"
FT                   /translation="MSLSDPLGDMLTRIRNAYGRKKSSVSTPASRLRTRVLDVLKAEGY
FT                   IRDYSQTDFDNGKSEIEIELKYFDGAPVVREIARVSKPGRRVYVSAKSIPHVANGLGIA
FT                   ILSTPKGVMADHEAREQNVGGEILCQIF"
FT   CDS_pept        216564..217097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0312"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47921"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47921"
FT                   /db_xref="GOA:Q98N42"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N42"
FT                   /protein_id="BAB47921.1"
FT                   /translation="MSRIGKKPVSLPQGVTATVNGQTVTAKGPKGELKFVVNDEVLVKM
FT                   EGSEIAVQPRDQTKTARSKWGMSRTQIVNILHGVKDGFEKKLEITGVGYRAAMQGKNLQ
FT                   LALGFSHDVVYETPAGVTIAVPKPTEITVTGIDKQQVGQVAAEIREYRGPEPYKGKGVR
FT                   YAGEKIVRKEGKKK"
FT   CDS_pept        217232..217591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0313"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47922"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47922"
FT                   /db_xref="GOA:Q98N41"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N41"
FT                   /protein_id="BAB47922.1"
FT                   /translation="MGTKESTQRRAQRVRRQIRKVAGERPRLSVHRTSKNIYVQVIDDA
FT                   KGHTIAAASTLEKDLKGSLKTGADTAAAAAIGKLIAERATKAGVKEVVFDRGPYIYHGR
FT                   VKALAEAAREGGLSF"
FT   CDS_pept        217643..218236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0315"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47923"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47923"
FT                   /db_xref="GOA:Q98N40"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N40"
FT                   /protein_id="BAB47923.1"
FT                   /translation="MLPEKNKEQDMAQERREGGRGREREERDDGMVDKLVHINRVAKVV
FT                   KGGRRFGFAALVVVGDQKGRVGFGHGKAREVPEAIRKATESAKRDMIFVPLRSGRTLHH
FT                   DVEGRWGAGRVLLRAAKQGTGIIAGGPMRAVFETLGMHDVVAKSMGSSNPYNMVRATFD
FT                   ALKSQMHPKDVAAARGIKYSTLQARRGTAVAAEE"
FT   CDS_pept        218261..218458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0316"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47924"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47924"
FT                   /db_xref="GOA:Q98N39"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N39"
FT                   /protein_id="BAB47924.1"
FT                   /translation="MAKKATKTITVEQIGSPIRRPKEQRATLVGLGLNKMHKQRTLEDT
FT                   PSVRGMIAAVQHLVRVVDEG"
FT   CDS_pept        218481..218954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0318"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47925"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47925"
FT                   /db_xref="GOA:Q98N38"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N38"
FT                   /protein_id="BAB47925.1"
FT                   /translation="MKLNDLRDKDGATHSKKRLGRGIGSGSGKTAGRGVKGQKARSGVA
FT                   INGFEGGQMPLYRRLPKRGFNNIFAKSFVVVSLARIQEAVDAKKLDAKATVTAEALVAA
FT                   GVIRRVKDGVRVLSDGELKAKLAFDVAGASKAAIEKIEKAGGSVKLPEKAAAE"
FT   CDS_pept        219149..220489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0321"
FT                   /product="secretion protein; SecY"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47926"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47926"
FT                   /db_xref="GOA:Q98N37"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N37"
FT                   /protein_id="BAB47926.1"
FT                   /translation="MASAAEQLASNLNFSAFAKAEDLKKRIWFTIGALLVYRLGTYIPL
FT                   PGINPDAFAQAFSSQSKGVLGMFNMFAGGAVQRMAIFALGIMPYISASIIMQLMTSVIP
FT                   SLESLKKEGEQGRKVINQYTRYGTVLLALVQAYGISVGLENGHGIVNDPGMFFRISTVV
FT                   TLVGGTMFLMWLGEQITARGIGNGISLIIFSGIVAGLPRAISGTLELGRTGALSTGLIL
FT                   AIIVLAIVVIALIVFFERAQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTSGVIPPIFA
FT                   SSLLLLPATIAGFSQTTNMPAWASTILASLGHGQPLYMAFYAAMIVFFAFFYTAIVFNP
FT                   KDTADQLKKHSGFIPGYRPGERTADYIDYVLTRITVVGAIYLVLVCLLPEFLISATGVP
FT                   FYLGGTSLLIVVSVTLDTVAQIQGHLIAHQYEGLIKKSKLRGGKKAR"
FT   CDS_pept        220486..221082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0322"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47927"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47927"
FT                   /db_xref="GOA:Q98N36"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N36"
FT                   /protein_id="BAB47927.1"
FT                   /translation="MRLILLGPPGAGKGTQAQRLVEKHGIPQLSTGDMLRAAVQAGSEV
FT                   GKRAKAVMDAGELVSDAIVNAIVAERIDQADCAKGFILDGYPRTLVQADAVESMLSERG
FT                   IGLDTVIELVVDDRALVGRIVKRAEDAKAAGQPVRKDDNPAVFEERLREYYKKTAPLTG
FT                   YYYAKGKLKTVDGLASIDAVTNEIEAVLTAAAEAR"
FT   CDS_pept        221301..221669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0323"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47928"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47928"
FT                   /db_xref="GOA:Q98N35"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N35"
FT                   /protein_id="BAB47928.1"
FT                   /translation="MARIAGVNIPTNKRVVIALQYIHGIGKKFAQEIVDKVGIPAERRV
FT                   NQLTDAEVLQIRETIDRDYQVEGDLRREVSMNIKRLMDLGCYRGLRHRRSLPVRGQRTH
FT                   TNARTRKGPAKSIAGKKK"
FT   CDS_pept        221782..222171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0324"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47929"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47929"
FT                   /db_xref="GOA:Q98N34"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N34"
FT                   /protein_id="BAB47929.1"
FT                   /translation="MAKEAARVRRRERKNISSGVAHVNSTFNNTMITITDAQGNSIAWS
FT                   SAGAQGFKGSRKSTPFAAQMAAEDVAKKAQEHGMRMLEVEVCGPGSGRESALRALQAAG
FT                   FTITSIRDVTPIPHNGCRPRKKRRV"
FT   CDS_pept        222276..223286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0325"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47930"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47930"
FT                   /db_xref="GOA:Q98N33"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N33"
FT                   /protein_id="BAB47930.1"
FT                   /translation="MIQKNWQELIKPNKIEFSSKKKTLTTLVAEPLERGFGLTLGNALR
FT                   RVLLSSLRGAAVTAVQIDGVLHEFSSIAGVREDVTDIVLNIKEIAIRMEGDGPKRMVVR
FT                   KQGPGAVLAGDIQTVGDVEILNPDHVICTLDEGAEIRMEFTVDTGKGYVPAERNRAEDA
FT                   PIGLIPVDSLYSPVKKVSYKVENTREGQVLDYDKLTMTIETDGSISGEDAVAFAARILQ
FT                   DQLGLFVNFDEPQKEVAAEAVTELAFNPALLKKVDELELSVRSANCLKNDNIVYIGDLI
FT                   QKTEAEMLRTPNFGRKSLNEIKEVLAAMGLHLGMEVPDWPPENIEDLAKRYEDQY"
FT   CDS_pept        223391..223822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0326"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47931"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47931"
FT                   /db_xref="GOA:Q98N32"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N32"
FT                   /protein_id="BAB47931.1"
FT                   /translation="MRHGFKGRRFARSISHRKSMFANLAVSLLEHEQIVTTLPKAKDLR
FT                   PIVEKLVTLGKRGDLHARRQVIAQIGNEGVVKRLFDTIAPRYANRNGGYLRIMKAGFRH
FT                   GDNAAMAVIEFVDRDTSAKGAGDRARLEAEGTDAEAAAA"
FT   CDS_pept        224211..225497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0328"
FT                   /product="heat shock protein HtrA like"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47932"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47932"
FT                   /db_xref="GOA:Q98N31"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N31"
FT                   /protein_id="BAB47932.1"
FT                   /translation="MQLSFAPLVKQTAPAVVNVYASQTAKVTSPFEGDPFFEEFFGRAQ
FT                   PRAQSSLGSGVLVDPSGVIVTNFHVIKDADEVKVATADGREFTSKVMLKDETLDLAVLK
FT                   IESDKPFPVIAIGDSDALEVGDLVLAIGNPFGVGQTTTSGIVSALARSHIGVSDSGYFI
FT                   QTDAAINPGNSGGALINMGGQLVGINTAIYSRSGGSIGIGFAIPANMVRAFADAAKAGL
FT                   DFFERPYIGAEFEAVTPQIADSLGMEKPTGALVSSVDATGPAGKAGLKAGDVVLQINGK
FT                   PVESIEALDYRMATLSIGTKANFAVLTKGQKAAMDIALERAPEGAKASEVTLHGRSPFS
FT                   GAKVAELSPRLAQKLGLRTDLKGVTVIDINRDSPAADFGFLPGDIVREVNGTTIDTAAT
FT                   LAQVAQQDTRWWRFTVERGGQILRQVLRY"
FT   CDS_pept        225539..226846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0329"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47933"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47933"
FT                   /db_xref="GOA:Q98N30"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N30"
FT                   /protein_id="BAB47933.1"
FT                   /translation="MADLFSVDEPEKAPPGRPLADRLRPKNLGEVVGQEHLTGPDGALT
FT                   RLIGSGSLGSMIFWGPPGTGKTTVARLLAGETSLAFEQISAVFSGVADLKKVFETAKLR
FT                   RANGRQTLLFVDEIHRFNRAQQDSFLPVMEDGTVVLVGATTENPSFELNAALLSRARVM
FT                   VFHSLGEESIAKLMVRAEETEGRALPLDDEARAMLIRMSDGDGRASLTLAEEVWRAAKP
FT                   GEVFDPEGLQRIVQRRAPIYDKGQDGHYNLISALHKSVRGSDPDAALYYLARMFDAGED
FT                   PLYLGRRLVRMAMEDIGLADPQALVVANAAKDAYDYLGSPEGELAFAEATVYLATAPKS
FT                   NAVYTAFKAATQAAKQHGSLLPPKHILNAPTKLMKEEDYGAGYRYDHDEPDAFSGQDYF
FT                   PEKMGRQTFYDPPERGFERDIRKRLDYWAKLRKERE"
FT   CDS_pept        226864..227526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0330"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47934"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47934"
FT                   /db_xref="GOA:Q98N29"
FT                   /db_xref="InterPro:IPR009273"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N29"
FT                   /protein_id="BAB47934.1"
FT                   /translation="MVVTLRSEASPWGISTSVALHALLAAMLALMPLPKRPKRLDEERV
FT                   SVDILTPQQFEASTRPPAPAPLPAPEAQASAPTPTPSAPRPTPPTAPTMIRPTEMLSAK
FT                   TLADPRSRQARADLATFASDERMVQLCNLEAMDQIRRWRADFRPERVVPYATAEEKVRG
FT                   TTIAADGAAFRSRKNWYSLKFKCRLARDGESVIGFEFLVGDPVARDKWDELGLPAVH"
FT   CDS_pept        227581..228516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0331"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47935"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47935"
FT                   /db_xref="GOA:Q98N28"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N28"
FT                   /protein_id="BAB47935.1"
FT                   /translation="MRRPKKPYQGARPGGGRCRDWAHSFATGSRSARGKMTKTLRKSLR
FT                   KFAIAIPLLALGFYFIPILTTIFIVCGLIDVLRNDRKDLALFSGYFLGNGLFTWLLSPF
FT                   NLLVDLLCYRNPGVWKLEQFPEDYQREVNEVLDIFRARKDEIIADIDANFGVGRRGMYV
FT                   YQWYGKHRIDNVAEFNKDFKYIKTIAVSVFSKRESTSWHFGPLRLSLRILYNLVPVKAE
FT                   IFVECGNVKNYWYDNPQFIFDDTLLHRSVNEYDGRRYCVFMDIIRPSPFPRLIAGMLAI
FT                   VSVSVERINSMFYKNWKMIGSTKPKKVETT"
FT   CDS_pept        228765..230420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0332"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47936"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47936"
FT                   /db_xref="GOA:Q98N27"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N27"
FT                   /protein_id="BAB47936.1"
FT                   /translation="MTKNKIFGFWTGTYLCTLLLGIAVSAAYINLEESVYYWDFAAYFN
FT                   MFNQQGALLVESPFEWLSQLGTSIATEDYGVAILVPLMPFHLVFGGSRLSFIAGIVAVY
FT                   LVPAVLLIGRISYQEAFSETPSRSWIAVWIAAFLYTPFWAPTLRGMPDIAGCLALTAAT
FT                   YFLWKSRFLTREPVIGGISVGACLWLAFMLRRWYAYGAIGITVSAAFFCLLQIARERDL
FT                   PALRNAALGGACAIFLIAATALNFQLPLIAKILQTSYADLYSGYKTTFVTQLGDVGSRL
FT                   SYLNWALIVVGLYISVVRRNRFAVFCAMASVLTFLVFIRTQDPERHHSLPMFLWLFPAY
FT                   AQAIVSIVSVPGLKSRWPTAAMTVVAGFAFLGTFFPAGRQLLSPVGFVFAGEATLPLRL
FT                   DNLPEYRRLIDDLVARMGPEDRFSVFASGPVMSDALLFGMKRDLVAHVGWICQVDSRDR
FT                   FQPDALKSRYVVVTDRPVTHLQPGAQICVTIPNQYILEGKGIGAAYRRIAQYQLSGGVE
FT                   GYLYEQVRPVSKAELDALYVEFRKKYPDWAAPEW"
FT   CDS_pept        230468..230842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0333"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47937"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47937"
FT                   /db_xref="GOA:Q98N26"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N26"
FT                   /protein_id="BAB47937.1"
FT                   /translation="MFNLLLVVVGGGIGAGIRHLTNMGALRLVGPNYPWGTMAINIVGS
FT                   FAMGLFIAILARRGGSNEVRLFVATGIFGGFTTFSAFSLDFATLWERGATLPAFGYALA
FT                   SVIGAIIALFLGLWLARSLP"
FT   CDS_pept        230905..231885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0334"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47938"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47938"
FT                   /db_xref="GOA:Q98N25"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N25"
FT                   /protein_id="BAB47938.1"
FT                   /translation="MAGVEQITVEAGEAGMRLDRWFKTHFPGLGFGHLQKLLRSGQIRV
FT                   DGGRVKADSRVEPGQVVRIPPLEVDKKGESALTGHSIRNQGDADVLAKMLIHEDPKVFV
FT                   FNKPAGLAVQGGSGVTRNVDDMLEAWRNQKGEKPRLVHRLDRDTSGVLVVARTRLAAMK
FT                   LSEAFRARETKKTYWALVKGVPPKREDKISTWLIKEPTEDGDRVRVAAHGEKGADHAVS
FT                   YYRIIEQAAQTMTWLEMEPYTGRTHQLRVHAAYIGCPIIGDPKYFEADTNWDFPGGIQN
FT                   RLHLHARRIIIPHPDKGLIDVTAPMPPHMRQSWNLIGFDDASAED"
FT   CDS_pept        231933..232805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0335"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47939"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47939"
FT                   /db_xref="GOA:Q98N24"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N24"
FT                   /protein_id="BAB47939.1"
FT                   /translation="MAVAAIMVGLTFSWGLNYVAAKISYAGYDPVFLSIARSIIGGFCV
FT                   FLWCRWRGIALFTRDGTLLAGIAVGVLFGIEFLCLYVGLEHTTVARNTLLVNSMPFWML
FT                   IGGHLLLGEQITMRKFLGLLLAFAGLAAVFSDKLGGGGDMLFGDLLSLGSGFFWALTNI
FT                   LIKRSKLVEASAEKLLLYQLAGAAMVGILVLPLAGPPVRDPSLLPTLALLFQAIYIVAF
FT                   TYVLWFWLLRRYPASGLSSFTFLSPVFGVLCGAVILNEPLTMRIFLALGLIAAGLIIVN
FT                   RPARKLTPV"
FT   CDS_pept        complement(232440..233714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0337"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47940"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47940"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N23"
FT                   /protein_id="BAB47940.1"
FT                   /translation="MPGHHGKNDRKRPPTAERRWDYDFGIRCSAAIALGSDLERFEKAD
FT                   DGHHVAFAGGASRDRFGVLPPMFDLPILVDMAGGPGSLGVELAEIDRQRQQRRTGQRGH
FT                   EVDGGQPQRLGALIEMTAQNGDRLTRLLDMDDPLGKVEASPQCSAHPIDDRIPLLVLPL
FT                   DQPLGGVGAVTEQIRRGKTQYVFQHRLRIARNTVDGGVDQAHHRHRHRIDGLALFREFV
FT                   CNQHSRRLGRERQQRLARRAHRLAVEMHGETSVYRRNRSGLVEALGQRRLHLDLGATHR
FT                   IRIRKILARFEVVEDVTHEKSLSHRCQLACRPVDDDQARRNQAKCQKNAHGQRLVQDDR
FT                   AAQDAENRRQEGEAGQAGGRIAAQQPEPQDVGEGDNVDRLEKQRQCRQQGRVAHRRTGE
FT                   RQDQYADHRRAGELIEQQLFGARLD"
FT   CDS_pept        233793..235682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0338"
FT                   /product="probable integral membrane sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47941"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47941"
FT                   /db_xref="GOA:Q98N22"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N22"
FT                   /protein_id="BAB47941.1"
FT                   /translation="MAMASTAGRTSRGMTREEKKVIFASSLGTVFEWYDFYLYGSLAAF
FT                   IGSTFFSPTIPEATRNIFALLAFAAGFLVRPFGALVFGRIGDLVGRKYTFLVTMTIMGL
FT                   STFLVGLLPGYATLGIAAPVILIALRMLQGLALGGEYGGAATYVAEHAPDDRRGFYTSW
FT                   IQTTATLGLFLSLIVILIVQGSLSKETYAAWGWRIPFIVSFVLLAVSIWIRLSLSESPT
FT                   FQKMKDEGKGSKAPLSEAFGQWKNAKIALLALLGLTAGQAVVWYNGQFYALFFLQNVLK
FT                   VDAQSVNIMIAIALALGSIFFVVFGWLSDKIGRKPIIMAGLALAIVCTFPLFKALTWAA
FT                   NPALATAQQNTRATVTAAPGDCKFQFNPVGTAKFTTSCDIATSFLTKNSVPFDVVSTAA
FT                   AGTPATVKIGNETVASYDAVAAGDQAKAKDAAFVKAVNMSLKDGGYPLKRAAIKVADQK
FT                   LDAFIAANPELKLDAATIRGGEKATVPTEQAVKDKLVTSEEAAGAPEVTVYNIPGGGAF
FT                   AMFADPAAVNWPMTIGILFILVLFVTMVYGPIAAILVEMFPTRIRYTGMSLPYHIGNGW
FT                   FGGLLPATVFALSAYRGDIYFGLWYPVVIAAMTLIIGMIFVKDTLGTDLRAKE"
FT   CDS_pept        236271..237311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0339"
FT                   /product="glutamine synthetase II"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47942"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47942"
FT                   /db_xref="GOA:Q98N21"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N21"
FT                   /protein_id="BAB47942.1"
FT                   /translation="MTKYKLEYIWLDGYTPVPNLRGKTQIKEFAEFPTLEQLPLWGFDG
FT                   SSTMQAEGRSSDCVLKPVALYPDPARTNGILVMCEVMMPDGVTPHESNSRATILDDEDA
FT                   WFGFEQEYFFYKDGRPLGFPESGYPAPQGPYYTGVGYKNVGDVARKIVEEHLDQCLAAG
FT                   INHEGINAEVAKGQWEFQIFGKGSKKAADQIWMARYLLLRLTETYGIDIEFHCKPLGDT
FT                   DWNGSGMHCNFSTKFMREVGGKAYFEALMAQFDKNLMDHIAVYGPDNDKRLTGKHETAP
FT                   WNKFSYGVADRGASIRVPHSFVKNDYKGYLEDRRPNSQGDPYQIASQVLKTISQVATDA
FT                   KVSAAA"
FT   CDS_pept        237410..237604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0341"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47943"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47943"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N20"
FT                   /protein_id="BAB47943.1"
FT                   /translation="MRVRLPFSAGDSPTHLQRRQHFGMGQARAAVAVAADHVRVGDQRI
FT                   EHRLLGRLHDGCIEIVHAG"
FT   CDS_pept        complement(238290..239699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0343"
FT                   /product="glutamine synthetase I"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47944"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47944"
FT                   /db_xref="GOA:Q98N19"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N19"
FT                   /protein_id="BAB47944.1"
FT                   /translation="MTTAKDIMKQIKDNDVKFVDLRFTDPKGKLQHVTMDVVEVEEDMF
FT                   ADGVMFDGSSIAGWKAINESDMVLMPDPDTVHMDPFFAQSTMVILCDILDPVSGESYNR
FT                   DPRGTAKKAEAYMKSEGIGDQIFVGPEAEFFVFDDVKYKADPYNTGFKLDSTELPSNDD
FT                   TDYETGNLGHRPRIKGGYFPVPPIDSAQDMRSEMLTVLAEMGVRVEKHHHEVAAAQHEL
FT                   GIKFDTLVRNADKMLIYKYVVHQVANAYGKTATFMPKPIFGDNGSGMHVHQSIWKGGKP
FT                   TFAGNEYAGLSESCLFYIGGIIKHAKAINAFTNPLTNSYKRLVPGYEAPVLLAYSARNR
FT                   SASCRIPFGSSPKAKRVEVRFPDPGANPYLAFAAMLMAGLDGIKNKIHPGQPMDKDLYD
FT                   LPPKELKKIPTVCGSLREALQSLDKDRGFLKAGGVFDDDQIDSYIELKMAEVMRFEMTP
FT                   HPVEYDMYYSV"
FT   CDS_pept        complement(239761..240099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0345"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47945"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47945"
FT                   /db_xref="GOA:Q98N18"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N18"
FT                   /protein_id="BAB47945.1"
FT                   /translation="MKKIEAIIKPFKLDEVKEALQEAGLQGITVTEAKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEVVLGDDAVEGAIEAIRKAAQTGRIGDGKIFVSNIEEVVRIRT
FT                   GETGMDAV"
FT   CDS_pept        240456..241994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0346"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47946"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47946"
FT                   /db_xref="GOA:Q98N17"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N17"
FT                   /protein_id="BAB47946.1"
FT                   /translation="MSDELLTSAEMGEADRLTIAAGPLDGYGLMQRAGEAVAAVVLARY
FT                   PAASRVHVLCGPGNNGGDGYVVARILAGSGVATTIWASGAPRPQSDAALAAAQCPIASR
FT                   PLSGFEAESGSIVVDALYGAGLSKPLSGDAARAVGVATDRRLPVVAVDLPSGVSGDSGR
FT                   VLGVAFTAAVTVTFARKKPGHLLLPGLERCGEILLADIGIGDDIIARLQPRTFENRPAH
FT                   WLRDFPVPAVDAHKYKRGHVGVFSGGPSATGAARLTALAAARSGAGAVTVLSPGNAMQV
FT                   NAAHLTSIMLRKTDDVADIREFVGERRPSAFVLGPGFGVGDKTRSFGLALLASGPAQDA
FT                   ATQVDGLVFDADAITAFRDEQGVLFEAARGPHAPALVMTPHEGEFARLFPDIADDNASS
FT                   KLDRARAAAARANAVIVYKGADTVIAAPDGRAAINSNGAAWLATAGSGDVLSGISAGLL
FT                   AQAMPAFEAACAAVWIHAEAGSRFGAGLIAEDLPLALVPVLRELVEARRKVPVE"
FT   CDS_pept        241871..243991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0347"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47947"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47947"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N16"
FT                   /protein_id="BAB47947.1"
FT                   /translation="MDPCRGRQPVWCGADCRGSASGTGTRVARTGRSTSQGARRMKRFA
FT                   LAVAAVIALFASHGVRAEQPVTVVDDPAVLATLDAKGFGFAGIFGADGADDLKTLYAKA
FT                   PAYHAIVDTVASDIATLRAEMKAGGRTLYEVTDGNVGRIMDMRWLKTEAARFRLVGVVN
FT                   RLDRRDFAALEGDKSCGEVRFIYRLAYSFTKDGKVLASRLPFNFNAVYSAAPDADGGCV
FT                   GVSGRWTPQLDEGVDAGWLTGGPLERAGLTFKQLELNAQVVRFPSGQETEFGGQAAYLM
FT                   RIFGIDGAAVGEKPLENTPDTARLSQDAALRKSLADYVSANVASVDVGVYELPNEFLAK
FT                   KVISWSTFGSARQANHPFSQIFQPNEFVSLDYSSLKLVRTPEGLVERLDNGSCQGCHQA
FT                   GSTAGFHFIGLDDRTTSPLNRIEVGISPHLHAEIPRRQAWLRATQEGKEPNRYRPLSFA
FT                   PPATWTETGDIDYAPAKMAMPCLMPEDAKRFGATWQCGGGTVCTPLATASDVRITLAQC
FT                   LLPKDSEKMFSGHPCLTGSIASNPSQPFNDRYKITGQFAAFAPGISRTAYTCRPPKIGV
FT                   PAGIAYRACDDKDRNFAAFKKGKPMPNEICGLVGGKKFDTCVATNNFDQCLGGAVNRGN
FT                   RPACSADHFCREDYMCQSLPPDTPGDAKVKGIGFCSPTYFIFQMRIDNHATPWASATSA
FT                   PRDAGFGAAGEE"
FT   CDS_pept        complement(244032..245654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0348"
FT                   /product="propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47948"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47948"
FT                   /db_xref="GOA:Q98N15"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N15"
FT                   /protein_id="BAB47948.1"
FT                   /translation="MQQKPTRKPTLALPDGHHYHKSSFYFGDRAMKDVLKELERRREIA
FT                   RMGGGQARIDAQHKKGKLTARERIEVFLDEGSFEEFDMYVEHRSTDFGMEKTKIAGDGV
FT                   VTGWGTVNGRPVYLFAKDFTVFGGSLSEAHAEKVIKVQEMALRNRAPIIGLYDAGGARI
FT                   QEGVAALGGYAEIFQRNVLASGVIPQISVIMGPCAGGDVYSPAMTDFIFMVRDTSYMFV
FT                   TGPDVVKTVTNETVTAESLGGASVHTTKSSIADGAYDNDVEALLQMRRLVDLLPASNTS
FT                   DIPEIECYQSVTDHDLSLDRLIPDNANKPYDVKELILKVADEGDFFEIQQSFAKNIVTG
FT                   FGRVEGRTVGFVANQPMVLAGVLDSDASRKAARFVRFCDCFSIPIVTFVDVPGFLPGTA
FT                   QEYGGLIKHGAKLLFAYAEATVPKITVITRKAYGGAYDVMASKHLRGDMNYAWPTAQIA
FT                   VMGARGAVEIIYRKDIGDAEKIASHTKTYEDRFLSPFVAAERGYVDEVIMPHSTRRRIA
FT                   RALRMLRNKDMQNPWKKHDNIPL"
FT   CDS_pept        245975..247378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0349"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47949"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47949"
FT                   /db_xref="GOA:Q98N14"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N14"
FT                   /protein_id="BAB47949.1"
FT                   /translation="MPSNVTAELSGFAALGITGALLKATHNAGFTEPKPIQMQAIPPQL
FT                   EGRDIFGIAQTGSGKTAAFALPILSKIIALGTKRRAKTTRALILAPTRELAVQIEDTIK
FT                   ILAKGAHVSTALVLGGVSRFSQVKKVAPGVDILIATPGRLTDLVREGDLILSDTKWLVL
FT                   DEGDRMLDMGFINDVKRIAKATAPDRQTALFSATMPDEIAELAKGLLKNPVRIEVSPQS
FT                   TAAAEIVQGVVFARTKQKRQVLSTMLADEAMKSVIIFSRTKHGADRVTKDLERDGFKAA
FT                   VIHGNKSQNARQKALNDFREGSVRILVATDIAARGIDVPGISHVVNFDLPDEAESYVHR
FT                   IGRTGRNGMDGIAITLCDPSENSKLRQVERIIRTKLPIVADHLGSPDPQRNPAEKNERF
FT                   EPANDRNDRNGRRDGRRPGGENKGNGFGKKRFGDKPAFAGERKPEGAKPFKGNNKRRFG
FT                   GKRPAARAA"
FT   CDS_pept        complement(247486..248460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0351"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47950"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47950"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N13"
FT                   /protein_id="BAB47950.1"
FT                   /translation="MGRRIVLAVLALVAVLALAFVYGPRVPVNTTIRFDPSVIGDDPQA
FT                   YVAKEEAAVPGIRDGLEKEIVWANPMVHAKTPLSIVYIHGFSASKGEVRPLPDDVADLL
FT                   EANLFYTRLTGHGQDGAAMTQGSVNGWINDYEEALAIGRAIGDKVIVISTSTGGSLAAW
FT                   AATQPGASNGVAAIAFISPNFGVKASGAEILTMPWGKQIAELVIGKERSFVARNALHQK
FT                   FWTTRYPVAATLPMQALTELAYRAPVEKADIPALFIFSDSDRVVRPDRTREIAGRWGAP
FT                   HELVPVDDTGDPDNHVIAGDVLSPSTTAFLAQRIAVWVEAVAK"
FT   CDS_pept        complement(248555..249376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0352"
FT                   /product="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47951"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47951"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N12"
FT                   /protein_id="BAB47951.1"
FT                   /translation="MTLYRADPKHGVAWVTGGSSGIGRSLARDLASQGYAVAVTALDDD
FT                   PIDTLIVETAQMPGSVTAFPCDVTDEPRMARTVAAIEKELGPIVLAVFNAGNYISTPGE
FT                   ALVVKDFRRTFEVNYFGIINGLVPVVEYMRVRSRGHVVLVGSVTAYFGWPTTAAYGGTK
FT                   AAINILAESLKYDFDKMNIRVQVINPGFVDTPLTEKNMLPMPGLMPVTRATRRMIKAIK
FT                   SGGFEVTFPYRTSWPLKFLALLPRPISRWVISLMTSWKARPLHYERKPPNE"
FT   CDS_pept        249603..250637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0353"
FT                   /product="O-acetylserine(thiol)lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47952"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47952"
FT                   /db_xref="GOA:Q98N11"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N11"
FT                   /protein_id="BAB47952.1"
FT                   /translation="MPRSVIDAIGNTPLIRLNKASEETGCEILGKAEFMNPGQSVKDRA
FT                   GLFIIRDAERRGLLKPGGVIVEGTAGNTGIGLTLVAKALGYRTVIVIPDTQSQEKKDTI
FT                   RLLGAELIEVPAVPYKNPNNYVKLSGRLAEQMARTESNGAIWANQFDNVANRDGHIRTT
FT                   AEEIWAQTGGKVDGFVSAVGSGGTLAGVAFGLKAKSKDVKIALADPLGAALYSFYTSGE
FT                   LKSEGSSITEGIGQGRITANLEGFTPDFSFQIKDEDALPIVFDLIQEEGLCVGGSTGIN
FT                   IAGAIRLARELGPGHTIVTILCDYGTRYQSKLFNPEFLREKNLPVPGWMELQSKISVPF
FT                   EKVE"
FT   CDS_pept        250634..251380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0354"
FT                   /product="alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47953"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47953"
FT                   /db_xref="GOA:Q98N10"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N10"
FT                   /protein_id="BAB47953.1"
FT                   /translation="MMAHKTEALFRDDAYLATADAAVAAVNDRGGIIFDRTIFYATSGG
FT                   QPGDTGHLERADGSRIAIAATITGETKDEIIHVPAPQQAALAVGEKVKLAIDWERRHLL
FT                   MRMHAACHLLTVVCPFPITGAAVSEDDSRVDFDIPDASFSKEEVTASLMDLVRANHPIF
FT                   TRLISDEELAANPGLVKSKNVRPPVGTGKIRLVCIGENGAVDSQPCGGTHVKSTGEIGE
FT                   IHIGKIEKKGRENRRFRIRFGPMPAA"
FT   CDS_pept        251420..252301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0355"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47954"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47954"
FT                   /db_xref="GOA:Q98N09"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N09"
FT                   /protein_id="BAB47954.1"
FT                   /translation="MAQDSPFTVDADWLQARLGEPGLTIVDASWYLPAQKRDARAEYNA
FT                   AHIPGARFLDQDAVSDPDAALPHTLPSPQHFAQYVGSMGVSADDTIVVYDGPGFFSAPR
FT                   AWWMFRIMGVFQTYILDGGFDAWKTAGRPVTAEPTKIAPSVFHADFDAGRVASLADMRR
FT                   IVETSASQIADARGPGRFTGAEPEPRAGIRSGHMPGARNVPYSALSENGMLLSKDRLRK
FT                   VIEEAGIDLSKPVVTSCGSGVTAAVVTLALETLGHTDNRLYDGSWTEWGGLSDTPVVTG
FT                   PATPGPAKTGKE"
FT   CDS_pept        252298..252870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0356"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47955"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47955"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N08"
FT                   /protein_id="BAB47955.1"
FT                   /translation="MNAMENGVLQDIEVTVTFLEMDAPPAVSPPVPYNRQVALLKTKDI
FT                   PLHFYRYLMDRVGRKWHWVNVLRLDDEELSAGIHREDRDIRVLYLDGAPAGFFDLKPHL
FT                   PDEVELAYFGMMEHATGQGIGRWFLGSAISAAWSHGPKRVTVQTCTLDHPAALPLYQKL
FT                   GFKPVAQKKEVVHPLPFAERSASVMRP"
FT   CDS_pept        253084..253512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0358"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47956"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47956"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N07"
FT                   /protein_id="BAB47956.1"
FT                   /translation="MKLRPNERVTIREFKRRPDLRRMARSIDIQSINFGFGLAAISSSQ
FT                   YDKIENIADALQRILRRDPGARADRRTHRRSRLLPVEPGPVRTTGPSLKGTLVREFGVP
FT                   GYALETVGCGEEFLLMPTQNENWQNRRVTLRRFDYFIR"
FT   CDS_pept        253684..254151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0359"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47957"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47957"
FT                   /db_xref="InterPro:IPR009593"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N06"
FT                   /protein_id="BAB47957.1"
FT                   /translation="MAIQFKALPTEHVRALQRGGPDAYSQTPERRISDGDGMPCRHCLK
FT                   NIAAGDAYLILAYRPFPELQPYAETGPIFLHAEECERAAETEALPEVLESPDYIVRGYG
FT                   RDDRIVYGSGGVIPTGAIAARAETLFERHDIAYVHVRSARNNCYQCRIERA"
FT   CDS_pept        complement(254386..255678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0361"
FT                   /product="outer membrane protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47958"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47958"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N05"
FT                   /protein_id="BAB47958.1"
FT                   /translation="MFLRVSAKSFLLGAVSAVALMSAAQAADVVQPVEASGFNWSGAYI
FT                   GIGGGFGASVHKFSVAPIIDFNGIGGNGVFGELTAGYDYMVSDRFLLGGFIDANGGNIG
FT                   PSISIPGADIDLTNSYGFDVGLRAGYLLNPDTLGYVLGGYSWQHFKLDGSGFAEGLNFT
FT                   QNRSGYVLGVGMETVLRGNWTLKTEYRYAAYGDKSVIDFGGGSLNVEPSTHTFHIAANY
FT                   RFGAQNGGGASFAAPTYNWTGFYVGGALGAGTAVHDLGVDLGGGALDLNGIGSEGVLGE
FT                   ASIGYDYDFGSWVAGVQLDASYSGIRSKLDIPGGSIKLDNDYGFDALARVGAKVNESTL
FT                   AYVIGGYSYQHFDLHASDPVGDIIDWNKSGFTVGGGLETAVSSNMTVGLEYRYSQFGKK
FT                   DFSSEFGAPDGTLTDKASFQTVRIGAKYKFN"
FT   CDS_pept        complement(255890..257005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0362"
FT                   /product="alanine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47959"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47959"
FT                   /db_xref="GOA:Q98N04"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N04"
FT                   /protein_id="BAB47959.1"
FT                   /translation="MRVGCPKEIKNHEYRVGLTPGSVREYVAHGHEVLVEAGAGAGIGA
FT                   DDNAYRAAGATIAKTAADVFAKSDMIVKVKEPQPNEWVQLRDGQILYTYLHLAPDPEQT
FT                   KGLLASGVTAIAYETVTDDRGGLPLLAPMSEVAGRLSIQAGATALQKANGGRGVLLGGV
FT                   PGVLPGKVTVLGGGVVGLHAARMAAGLGADVTIIDRSIPRLRQLDDLFAGRVHTRYSTV
FT                   EALEEECFSADIVVGAVLIPGAAAPKLVTREMLSGMKKGSVLVDVAIDQGGCFETSHAT
FT                   THAEPTYEVDGVIHYCVANMPGAVPVTSAHALNNATLHYGLQLADKGLKALVDDHHLRN
FT                   GLNVHKGKITNRAVAEALGYELVEPKAVLAA"
FT   CDS_pept        257163..257636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0363"
FT                   /product="leucine-responsive regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47960"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47960"
FT                   /db_xref="GOA:Q98N03"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N03"
FT                   /protein_id="BAB47960.1"
FT                   /translation="MPLDRIDIAILETLQKDGRIPNAALAEKVGLSQSACSRRLDNLEK
FT                   SGTIRGYHARLSNAALGHQMTAIVHISLSGQFEKTLSDFEAAIKRCPNVLSCHLMSGEY
FT                   DYILRIAAKDLVDYERIHKEWLSAMPHVTKINSSFALREIVDRTAMGMKPEMA"
FT   CDS_pept        complement(257669..258262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0364"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47961"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47961"
FT                   /db_xref="GOA:Q98N02"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N02"
FT                   /protein_id="BAB47961.1"
FT                   /translation="MHELDPEFRAPLSDWTDVRRWRKAERERLIGARLAVSADARAAMS
FT                   QRIAEGLDTIIGEIRGRMVSLYWPFRGEPDLRPWMASINEHGGRTALPIVVEKGHPLIF
FT                   RAYKPGDRLEKGVWNIPIPAEGDPVLPDIVIAPIVGIDPANYRLGYGGGFFDRTLAAMP
FT                   FKPLVIGVGYELQRIATICPQPHDIPMDRIVTEA"
FT   CDS_pept        258472..259746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0365"
FT                   /product="NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47962"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47962"
FT                   /db_xref="GOA:Q98N01"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N01"
FT                   /protein_id="BAB47962.1"
FT                   /translation="MNEMNQASHHVVVVGAGFGGLELTHALAGQPVRITMIDKRNHHLF
FT                   QPLLYQVATTALATSEVAWPIRHLLRKRKDVTTLLANVTGVDRAGKRVLLDDGSAVAYD
FT                   TLVLATGARHAYFGHDEWEPFAPGLKTLEDATTIRRRILLAFEQAERETDPAKREALLT
FT                   IAIVGGGPTGVELAGTIVELAHDTLRGEFRNIDTRQTRVVLIEAGDRILANFAPKLSDY
FT                   ASKALERLGVTVELGRAVTRCDAEGVVFGDKQLAARTILWAAGVAASPAAEWLGAKADR
FT                   AGRVLVEPDLGVPGSPEIFVIGDAALVLRPDGRPVPGVAPSAKQEGRHVAATIKARLGG
FT                   DNTARPFHYKHAGDLATIGKRAAAIDFGWIKLTGWLAWWLWGIAHIYFLIGFRNRLAVS
FT                   LSWLWIYVTGQRSARLITQGDDDKT"
FT   CDS_pept        259897..261876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0366"
FT                   /product="probable multifunctional phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47963"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47963"
FT                   /db_xref="GOA:Q98N00"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041827"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N00"
FT                   /protein_id="BAB47963.1"
FT                   /translation="MSQLLHPVSRRGFLAGAAATGALIVLHPFSARAQANQAHLRIMET
FT                   TDIHVNVLPYDYYADKANDTMGLSRTASLIDAVRKEAVNSMLIDNGDLLQGNPMGDYIA
FT                   YEKGLKDGDLHPVMKGMNLLGYECSTLGNHEFNYGLSFLDKVLAGANFPFVCANLIRGT
FT                   ELAANPRDDKLYLKPYVILDRKIKDGSGAEQPIRIGIIGFVPPQIMVWDLKNLEGNVKT
FT                   RDIVEAATAWVPQMKEEGADIVIALSHSGIDVKQGDMMENASFFVAGVDGIDAVFTGHQ
FT                   HLVFPGKKDFQSLEGVDTQKGTLQGKPAVMGGFWGSHMGLIDLMLERDGSKWKVVSATS
FT                   EARPIFERVDNKAKPTVSDDKRIIAALEQDHQATLAYVRRPVGKTSAPLYSYFALVADD
FT                   PSVQVVSQAQTWYLKDILKSTQWKDVPLLSAAAPFKAGGRNGADYYTDVPAGDIAIKNV
FT                   ADLYLYPNTVRAVEITGAQVKEWLEMSAGIFNRIEAGKADQALINTDFPSYNFDVIDGV
FT                   SYKIDLSQPPKYDAKGGVANAGANRIVDLMFGGKPIDPNQKFVVATNNYRAGGGGNFPD
FT                   INASKIIYEAPDTNRDVIVRYIVSQGTINPSADGNWSFGPLPGTSVVFETGVKAKDFIA
FT                   DVKSLMIEPAGEGEAGFAKYRILL"
FT   CDS_pept        complement(262402..263538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0368"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47964"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47964"
FT                   /db_xref="GOA:Q98MZ9"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MZ9"
FT                   /protein_id="BAB47964.1"
FT                   /translation="MNLPRGSLKVRMPDGRAVLVGGKGPGPDAELVLKNWRLPGRAFSG
FT                   GTIGVAESYMDGDWESPDVTSFLELFVVNSAIGERVAGGASWLINTVQRIRHWFNENTR
FT                   TGSKRNISAHYDLGNAFYREWLDPSMTYSSALYANGANDLESAQAAKYRALARDTGIGG
FT                   KDHVLEIGCGWGGFAEFAAREIGCRVTGLTISREQHDFAKARIAKAGLADKVDIKLQDY
FT                   RDETGTYDRIASIEMFEAVGEKYWPVFFSKMKSCLRPGGTAGLQIITINEAAYDTYRAR
FT                   PDFIQRYVFPGGMLPTPSILKSLGKDHGLAHLRERVFPDDYARTLAEWRNRFWGSWEKI
FT                   VPLGFDDRFKKLWEFYLHYCEAGFRASYIDVRQVVYKA"
FT   CDS_pept        264266..264511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0370"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47965"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47965"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MZ8"
FT                   /protein_id="BAB47965.1"
FT                   /translation="MEAVRTGLLVLGNIPHSSLFEVTLNTKVDPLSDEVDVVVYAEFPD
FT                   DAALAAYKAHPLYAQTTAKVKPLRELRYSADVVAGS"
FT   CDS_pept        264605..265495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0372"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47966"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47966"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MZ7"
FT                   /protein_id="BAB47966.1"
FT                   /translation="MTDRPTTGTHPLDHLVLPTGSLEVARARLTSLGFVVAPTGIHPFG
FT                   TENCCVFLADGTYLEPLAIGNEQAAIDATADGNVFVARDRLHRDSRGDEGFSAVALGTD
FT                   NADADHARFVDAGLSAGDTLSFSRAFTDTSGKSDTASFRLAFAATRGAPDAFLFACQRI
FT                   NAPMVDRTALQAHANGATGILEVVAISDQPAEQYRMISVAANDPAANGEGRTFLLPNAT
FT                   LSVLDAKSFTARFGIPAGSSTKLRFAAIVFAVRSIDVASSLLAANAIQHDIAGTDIVVR
FT                   PASGQGAAFIFREIP"
FT   CDS_pept        265492..266352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0374"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47967"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47967"
FT                   /db_xref="GOA:Q98MZ6"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MZ6"
FT                   /protein_id="BAB47967.1"
FT                   /translation="MNKPQVPNSMAPNSSVTVGNVVFDNNAALALIAGPCQFESRQHAF
FT                   DMAGALKELTARLGIGLVYKTSYDKANRTSLSATRGAGMDAALPVFDELRKEFSLPVLT
FT                   DVHTEEQCAIVAPHVDVLQIPAFLSRQTDMLVAAAKTGKVINVKKGQFLAPWDMKNVVA
FT                   KITGSGNPNVLTTERGASFGYNTLVSDMRALPVMAEIGAPVIFDATHSVQQPGGQGGSS
FT                   GGERRFVETLARAAVAVGVAGVFIETHQDPDNSTSSDGPNMLPLKDMPALLERLMAFDR
FT                   IAKGR"
FT   CDS_pept        266413..267090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0376"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47968"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47968"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MZ5"
FT                   /protein_id="BAB47968.1"
FT                   /translation="MSVLAGGSHVRRPRHRNHLIVKEEFSGRHREGNRPRVENPEERRR
FT                   RLDPGSEDRRRGRQDRCLSRQHEGDFHPRGVIGRRRKSRELSPVLLIVEAEFNDNEEQI
FT                   MTTQTGHTEAIAASRVIGTSVYNTEGRSIGSIEDIMLDKTSNGIMFAVIGFGGFLGIGE
FT                   KYHAIPWASLDYDENRGGYVVPFSKEQLKAAPAYSINELAGADGEAARDASYEYYKVTP
FT                   YWH"
FT   CDS_pept        complement(267134..267343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0377"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47969"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47969"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MZ4"
FT                   /protein_id="BAB47969.1"
FT                   /translation="MRPDVHFGLWLLSRGAKQEEFRHVRVERYRQFVPDRGCVADVVRQ
FT                   QAIATKGSCAFVGVEHQRIGVRVE"
FT   CDS_pept        267476..268750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0378"
FT                   /product="enolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47970"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47970"
FT                   /db_xref="GOA:Q98MZ3"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MZ3"
FT                   /protein_id="BAB47970.1"
FT                   /translation="MTAIIDIVGREILDSRGNPTVEVDVVLEDGSMGRAAVPSGASTGA
FT                   HEAVELRDGGARYLGKGVLKAVEAVNGELFEAIGGMEAENQIHIDQTMIELDGTPNKSR
FT                   LGANAILGVSLAVAKAAADAAGLPLYRYVGGTKAHILPVPMMNIINGGAHADNPIDFQE
FT                   FMILPVGAPTLREGVRWGSEIFHTLRKKLKDAGHNTNVGDEGGFAPNLKSAPVALDFIM
FT                   ESIEKAGFKPGEEIALGLDCAATEFFKDGNYVYEGEKKTRDPKAQAKYLAKLAADYPIV
FT                   SIEDGLAEDDWEGWKYLTDLIGKKTQLVGDDLFVTNTARLRDGIRMGVANSILVKVNQI
FT                   GSLTETLDAVETAHKAGYTAVMSHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRMAK
FT                   YNQLIRIEEELGKQARYAGKSVIKG"
FT   CDS_pept        complement(268924..269520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0380"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47971"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47971"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MZ2"
FT                   /protein_id="BAB47971.1"
FT                   /translation="MIVSYAGHSPAIDTDAWVAPDATVCGDVVIGAGSRVMHGARLVAE
FT                   AGGSIRIGRDCIVLENAVIRATASHPCTMGNHCLVGPNSHVVGAEIGDEVFIATGAAVF
FT                   HGAHIGRGSEVRINGIVHLRTRLEPGMVVPIGWIAVGDPAQILPPDQHEAIWSHQKPLD
FT                   FPGFVYGVERDSPDIMRKITANLSAALGVHRTESA"
FT   CDS_pept        complement(269517..270053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0381"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47972"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47972"
FT                   /db_xref="GOA:Q98MZ1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MZ1"
FT                   /protein_id="BAB47972.1"
FT                   /translation="MTYAYAMQLLDANKLGALGAMIRDRTEASLRELSPSAAAVLSMLH
FT                   FKPGLTTTELAEVVGVSQPTAVRLIDGLERQALIVRGNPEGRVTPLTLTETGHAEVKEM
FT                   QALRLAALDGLLSALQPDKRRHFVSMLDEILAGATTSRALARTTCRLCEHDLCGHEICP
FT                   IGCRAAEIERKESGR"
FT   CDS_pept        270215..270577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0382"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47973"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47973"
FT                   /db_xref="GOA:Q98MZ0"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MZ0"
FT                   /protein_id="BAB47973.1"
FT                   /translation="MEPHEFAAARIRIMWTRQHKQRNTGRLIIPSLCVVFLAYFGFHAY
FT                   HGEFGINSKYQLEAQTVALQAQLDAIKARRMELERRVRLMHDGTLEKDMLDEQARRALN
FT                   LSQADEITIMLPASSK"
FT   CDS_pept        270771..271808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0383"
FT                   /product="pyruvate dehydrogenase E1 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47974"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47974"
FT                   /db_xref="GOA:Q98MY9"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MY9"
FT                   /protein_id="BAB47974.1"
FT                   /translation="MATAARKAPAKSKSEGKSGLSAPKPAEFTKDEELAAYRHMLLIRR
FT                   FEEKAGQLYGMGFIGGFCHLYIGQEAVVTGMKMALIDGDQMITAYRDHGHMLAMELSPR
FT                   GVMAELTGRRGGLSKGKGGSMHMFSKEKHFYGGHGIVGAQVSLGTGLAFANRYRDNNNV
FT                   SLTYFGDGAANQGQVYESFNMASLWKLPVIYIIENNRYAMGTSVSRSSAETNFSHRGAS
FT                   FKIPGIQVDGMDVRAVKSAGDQATEWCRAGNGPIILEMQTYRYRGHSMSDPAKYRSKEE
FT                   VQKMRSEHDPIEQVKARLTEKKWATEDELKTIDKEVRDIVADAAEFAQNDAEPDPSELW
FT                   TDIVL"
FT   CDS_pept        271824..273209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0384"
FT                   /product="pyruvate dehydrogenase E1 beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47975"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47975"
FT                   /db_xref="GOA:Q98MY8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MY8"
FT                   /protein_id="BAB47975.1"
FT                   /translation="MPIEILMPALSPTMEEGNLSKWLKNEGDKVVAGDVIAEIETDKAT
FT                   MEVEAVDEGTLAKIVVPAGTEGVKVNAVIAVLAVEGEDTDKAGEGIGEEPAKAETASPA
FT                   PVAAKSEAAAPVAAAPKTEIAADPDIPAGTEMVSTTVREALRDAMAEEMRRDGDVFVMG
FT                   EEVAEYQGAYKITQGLLQEFGPRRVVDTPITEHGFAGVGVGAAMAGLKPIVEFMTFNFA
FT                   MQAIDQIINSAAKTLYMSGGQMGAPIVFRGPNGAAARVAAQHSQCYAAWYSHIPGLKVV
FT                   MPYTAADAKGLLKAAIRDPNPVIFLENEILYGQSFDVPKLDDFVLPIGKARIHKQGKDV
FT                   TIVSFGIGMTYAVKAEAELRGLGIDAEIIDLRTIRPLDLDTIIASVKKTNRLVVVEEGF
FT                   PQSSVGDHIANQVSQRAFDFLDAPVITIAGKDVPMPYAANLEKLALPNVGEVIEAVKAV
FT                   TYR"
FT   CDS_pept        273228..274589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0385"
FT                   /product="dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47976"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47976"
FT                   /db_xref="GOA:Q98MY7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MY7"
FT                   /protein_id="BAB47976.1"
FT                   /translation="MPINITMPALSPTMEEGNLSKWLVKEGDKVSPGDVIAEIETDKAT
FT                   MEVEAVDEGTVAKLVVPAGTEGVKVNALIAVLAAEGEDASAAAKSGGGAAPAKAEAPKA
FT                   DAPKAEAPKAEPAAAAAPKAEPAPVANGHAAGERTFASPLARRIAKEAGVDVSAVTGTG
FT                   PHGRVVKADVDAAIAGGGAKAALAAKAPAGAPAAPAPAVKPMSDDQVLKLFEQGSYELV
FT                   PHDNMRKTIARRLVEAKSTIPHFYLTLDCELDALLALRTQINAAAPMKKTEKGDVPAYK
FT                   LSVNDMVIKAMAMALKAVPDANASWTETAMVKHKHADVGVAVSIPGGLITPIIRKADEK
FT                   TLSTISNEMKDLASRARSRKLKPEEYQGGTTAVSNLGMFGIKDFAAVINPPHATILAVG
FT                   AGEERAVVKNGELKIATVMSVTLSTDHRAVDGALGAELLVAFKRLIENPMGMLV"
FT   CDS_pept        274605..275021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0386"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47977"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47977"
FT                   /db_xref="GOA:Q98MY6"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MY6"
FT                   /protein_id="BAB47977.1"
FT                   /translation="MRKFFTSLFAFFISGFAGSLVALGLAIATDAQEEYILVFMASVLV
FT                   TIVVTILFFVAQFFSNAPAIINWLALCTMVLFVLVGLGLIGWTFSQPIDKRQWGSDLPI
FT                   VAGLVLPSLATVLIHWLFVRWRVGRGLMNAQVNA"
FT   CDS_pept        275018..275653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0387"
FT                   /product="arylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47978"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47978"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MY5"
FT                   /protein_id="BAB47978.1"
FT                   /translation="MKTVLCYGDSLTWGYNAEGGRHALEDRWPSVLQASLGGGVQVIAD
FT                   GLNGRTTAFDDHLAGADRNGARLLPTALTTHAPIDLIVIMLGANDMKPWIHGNPVAAKQ
FT                   GIQRLIDIVRGHDYPFDWPAPQILIVSPPVVSRTENADFREMFAGGDEASKQLAPQYAA
FT                   LADEVGCGFFDAGTVAQTTPLDGVHLDAENTRNIGKALTSVVRVMLEL"
FT   CDS_pept        275670..277115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0388"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47979"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47979"
FT                   /db_xref="GOA:Q98MY4"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MY4"
FT                   /protein_id="BAB47979.1"
FT                   /translation="MAENYDVIIIGSGPGGYVTAVRSAQLGFKTAIVEREHLGGICLNW
FT                   GCIPTKALLRSAEIMHYSDHLKDYGLKLDGKVSVDTSAVVDRSRKVSLRLNGGVAFLMK
FT                   KNKVDVIWGEAKLSKPGEVVVSKTAKTPMEPQPPVPKGVKGEGTYTAKHIILATGARPR
FT                   ALPGIEPDGKLIWTYFEAMVPKEMPKSLLVMGSGAIGIEFASFYRTMGADVTVVELLPA
FT                   VMPVEDAEVSKFAQKQFEKQGMKIILEAKVTKVEKGANSVTAHVEMKDGKVEKITADRM
FT                   ISAVGVQGNIENLGLEALGVKTDRGCIVVDGYGKTNVPGIYAIGDVAGPPMLAHKAEHE
FT                   GVVCVEKIAGFPGVHAIDKLKIPGCTYCNPQVASVGLTEAKAKAEGKDIRVGRFQFAAN
FT                   GKAIALGEDQGFIKTIFDKKTGQLLGAHMVGAEVTELIQGFVVAMNLETTEEELMHTIF
FT                   PHPTLSEMMKESVLDAYGRALNA"
FT   CDS_pept        277215..277472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0389"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47980"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47980"
FT                   /db_xref="GOA:Q98MY3"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MY3"
FT                   /protein_id="BAB47980.1"
FT                   /translation="MHLNGVGWIAAIIIGGLAGWFAEMVMKSNTGIFMNIIMGIVGAVV
FT                   LNAILQALNFGPFGVGWIAYLITGFIGACLLIWVGRLVRR"
FT   CDS_pept        277610..278575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0392"
FT                   /product="lipoic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47981"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47981"
FT                   /db_xref="GOA:Q98MY2"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MY2"
FT                   /protein_id="BAB47981.1"
FT                   /translation="MVTVLDAIANAPRLRHPEKAHKPDQEVLRKPDWIRVKAPVSKGYA
FT                   ETREIVKSHKLVTVCEEAGCPNIGECWEKKHATFMIMGEICTRACAFCNVATGIPTALD
FT                   PDEPARVAHAVKQMGLSHVVITSVDRDDLADGGAQHFADVIRAIRAATPSTTIEILTPD
FT                   FLRKDGALEIVVAARPDVFNHNLETVPSNYLKVRPGARYFHSIRLLQRVKELDPSIFTK
FT                   SGIMVGLGEERNEILQLMDDLRSANVDFMTIGQYLQPSKKHHPVIRFVTPEEFKSFETI
FT                   GRTKGFLLVASSPLTRSSHHAGDDFARLRAAREAQLQKSV"
FT   CDS_pept        278586..279041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0393"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47982"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47982"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MY1"
FT                   /protein_id="BAB47982.1"
FT                   /translation="MPKFEATRRVAHTPQQMFALVADVEAYPQFLPLCEALTVRTRKER
FT                   DGRTVLLADMSIGYKAIRETFTTQVLLKPDESAIDVKYIDGPFKYLSNVWRFEPDGAGC
FT                   AVRFFIDYEFKSRILGALMGTMFDRAFRMFAEAFEKRADVIYGVAPA"
FT   CDS_pept        complement(279044..279547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0394"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47983"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47983"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MY0"
FT                   /protein_id="BAB47983.1"
FT                   /translation="MSNAELANSLLLACQQRGIMLATAESCTGGLIIAALTDIAGSSAV
FT                   VDRGFITYSNEAKMDMLGVAAKTLDAHGAVSRETVLEMAAGALAHSRASLSLAVTGIAG
FT                   PSGGSADKPVGLVWFGLALAGQPVVAERQLFGHKGREFIRHETVRHALQFGLRALGQGT
FT                   DSPR"
FT   CDS_pept        complement(279544..280767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0395"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47984"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47984"
FT                   /db_xref="GOA:Q98MX9"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR026596"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MX9"
FT                   /protein_id="BAB47984.1"
FT                   /translation="MTEASENASATGGVAVVIVAAGRGARAGQANGPKQYQNIGGRAVI
FT                   AHTLEIFLAHPRTDRIVVAIHADDHELFRQAAGSQAERVTAIIGGPTRQESVRLGLLAL
FT                   KEHAPGQVLIHDAVRPFVDADLIDRTISAIGENEGALPALPVADTLKRESAAGVVAETV
FT                   SRSGLHAAQTPQGFPYGPILAAHDKAFQLGRLDFTDDAAIAEWAHIPVKLVPGSPDNVK
FT                   LTWARDIAMAHQRLSSERTHFPDIRTGNGYDVHAFEPGDHVTLCGVAIPHDKKLSGHSD
FT                   ADVGLHALTDALLATCGAGDIGTHFPPSDPQWKGAASRIFVEHAAKVVRQRGGRIANAD
FT                   ITLICEAPRVGPHREAMTAALSRMLGISADRISIKATTNEKLGFVGREEGIAAIATASV
FT                   VFPGEVPE"
FT   CDS_pept        280968..282041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0396"
FT                   /product="nitrogen reguration protein; NifR3"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47985"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47985"
FT                   /db_xref="GOA:Q98MX8"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MX8"
FT                   /protein_id="BAB47985.1"
FT                   /translation="MARECATNGHAWFLCMVNSARLAAPLNVGGVEIRNRVFLAPMSGI
FT                   TDEPFRRRAHAHGAGLVVSEMVASGELAKGRAGFDLRIRHSGLPVHMVQLAGREAIHMA
FT                   EGARIAAGEGADIIDINMGCPAKKVTGGYAGSALMLDLDHALSLIEAVVGAVKVPVTVK
FT                   MRLGWDEGALNAPILARRAEQAGVKMVTVHGRTRCQFYQGKADWRAIARVKEAVSIPVV
FT                   ANGDVCSPAEAAAILDQSGADAVMVGRAHYGAPWIAGGIAAAAAGEVAANVPENRAALA
FT                   DYIVGHYEDMLALYGVESGLRQARKHLGWYLDRHAVGVADDDRKAILTAFDPARVIALL
FT                   RNVFSRDPQPLSLRSAA"
FT   CDS_pept        282038..283180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0397"
FT                   /product="nitrogen reguration protein; NirB"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47986"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47986"
FT                   /db_xref="GOA:Q98MX7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MX7"
FT                   /protein_id="BAB47986.1"
FT                   /translation="MNAIAGQGAEMVDAAQIVLNTIRRPVIMISEEGFITFANADAEDF
FT                   FRSSATMLARNTLSKLVPFGSPLLTLVDQVRERRAPVNEYRVDVSSPRLGIEKVVDLYV
FT                   APVPEFPGSVVVMFQERSMADKIDRQMTHRGAARSVTGLAAMLAHEIKNPLSGIRGAAQ
FT                   LLELSASDEDRALTRLITDETDRIVSLVDRMEVFSDERPIDRYPVNIHVVLDHVKAIAK
FT                   NGFAKKIRILEDYDPSLPPVFANRDQLIQVFLNLVKNAAEAIGTDPHGEIVLSTAFRPG
FT                   IRVSVPGTQDRVSLPLEFCVRDNGPGVSEDILPILFDPFITTKPNGSGLGLALVAKIVG
FT                   EHGGIIECESTPRGTTFRILMPAWKETPFGAEEDGEGDRK"
FT   CDS_pept        283177..284637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0398"
FT                   /product="nitrogen assimilation regulatory protein; NtrC"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47987"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47987"
FT                   /db_xref="GOA:Q98MX6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MX6"
FT                   /protein_id="BAB47987.1"
FT                   /translation="MTARGNILVADDDAAIRTVLNQALSRVGHEVRVTSNASTLWRWVA
FT                   AGEGDLVITDVVMPDENAFDMLPRIKKARPELPVIVMSAQNTFMTAIRASETGAYEYLP
FT                   KPFDLTELLNIVNRALSEPRRPKIDARPDEQPETMPLVGRSAAMQDIYRMLARMMQTDL
FT                   TVMISGESGTGKELVARALHEYGRRRGGPFVAINMAAIPRDLIESELFGHEKGAFTGAQ
FT                   NRSTGRFEQAEGGTLFLDEIGDMPMEAQTRLLRVLQQGEYTTVGGRTPIKTDVRIVAAT
FT                   NKDLRTLINQGLFREDLFYRLNVVPLRLPALRERSEDVPDLVRHFFKLGEMEGLQTKRI
FT                   SSGGIELMKRYPWPGNVRELENLVRRLAALYSQDEISAEIIEAELKTGERPVVPGGGNL
FT                   IPDDLSIGQAVEHFLQRYFASFAGELPPAGLYQRILSEVEYPLVLASMTATRGNQIKAA
FT                   ELLGLNRNTLRKKIRELGVNVYKSSRPG"
FT   CDS_pept        284838..287054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0399"
FT                   /product="nitrogen regulation protein; NtrY"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47988"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47988"
FT                   /db_xref="GOA:Q98MX5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MX5"
FT                   /protein_id="BAB47988.1"
FT                   /translation="MLALPGVVAVVGALVMAAISFTILVGATPIAPDARTTWALIALNA
FT                   AFVLFLMALVGREVHRIVMARRHGKAASRLHVRIVAMFALVAAIPAIMVAIIASITLDI
FT                   GLDRWFEIRTKTIVNSSLSIADAYVQENARNLQGTTLSMAYDLDASRSLYGLDRTGFLD
FT                   LLNKEAVGRSLAHAALIKPDGSFVMSAQTDADFAMPEPPEGSVSSATDGKPVLIEPRTR
FT                   NIMGAIVKLREIEGLYLYTIRLVDPEVIKARQIVRSNTDEYRNLEDNRRTSQVAFALPY
FT                   LSLTLIIILSAIWTGIAVADRLVRPIRQLIGAADEVATGNLDVAVPVRSSDGDVASLGD
FT                   TFNKMLLELKSQRNEILSAKDLIDERRRFSEAVLAGVTAGVIGVDPYGIVTIVNRSAES
FT                   MLAISASAALGQNLSAILPHVGRVFEIGRQSGKPVYREQVTFFRAGTERTFNVQITIEA
FT                   GDDGSEEKSYVVTVDDITDLVQAQRSSAWADVARRIAHEIKNPLTPIQLSAERIKRRYG
FT                   KVITEDREVFDQCTDTIIRQVEDIGRMVDEFSAFARMPKPEMKAIDLRESLREASFLVE
FT                   VSRADITFERIFGNEPLKGTFDSRLLAQAFGNVIKNAAEAIDGLEQKDGSHGIIRIQAG
FT                   RQNGAIRIDVIDNGKGLPRENRQRLLEPYMTTREKGTGLGLAIVKKIVEDHGGRLELHD
FT                   APADFHGGRGAMISIILPLAAVTPLRGEGKTEHERETEKVGNGV"
FT   CDS_pept        287044..288405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0400"
FT                   /product="nitrogen assimilation regulatory protein; NtrX"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47989"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47989"
FT                   /db_xref="GOA:Q98MX4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MX4"
FT                   /protein_id="BAB47989.1"
FT                   /translation="MASDILIVDDEEDIRELVAGILSDEGHETRTAFDADSALAAIADR
FT                   APRLIFLDIWLQGSRLDGLALLDEIKTMHPTLPVVMISGHGNIETAVSAIRRGAYDFIE
FT                   KPFKADRLILIAERALETSKLRREVSDLKQRSGETFDLIGMSSAMSQLRQTIERVAPTN
FT                   SRVMIIGPSGSGKELAARAIHTLSARKGAPFVTLSAANITPERMEIELFGTESNGVERK
FT                   VGALEEAHRGILYIDEVADMPRETQNKILRVLVEQQFERVGGTKRVKVDVRIISSTSQN
FT                   LEAMIADGRFREDLYHRLAVVPVMVPGLAERREDIPYLVDNFMKQIARQAGIKPRRIGD
FT                   DALAVLQAHNWPGNVRQLRNNVERLMILARGDDVDAPITADLLPSEIGDVMPRTPNQSD
FT                   QHIMALPLREAREQFEKDYLIAQINRFGGNISKTAEFIGMERSALHRKLKSLGV"
FT   CDS_pept        288507..289370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0401"
FT                   /product="D-alanine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47990"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47990"
FT                   /db_xref="GOA:Q98MX3"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MX3"
FT                   /protein_id="BAB47990.1"
FT                   /translation="MPRIAYVNGRYVAHADASVHIEDRGYQFADGVYEVCEVARGFIVD
FT                   MPRHLARLNRSLTELSIAWPVARNVLPLILREVVNRNHVVNGLVYVQVTRGVASREFVF
FT                   PSADTKPSLVVTARKADPAAGAKRAETGIAVITVPENRWDRVDIKTVGLLPNVLAKQKA
FT                   KEAGAQEAWFVDTDGNVKEGGSSNAWIVTRDGVLVTRPADHGILRGITRTTMFEVAAKL
FT                   GLKIEERGFSVAEAKAAREAFISSATTIAMPVVAIDGDPVANGHPGSVTLSLRQAFFDI
FT                   AEKSPA"
FT   CDS_pept        289516..289761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0402"
FT                   /product="host factor-I or probable NfrA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47991"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47991"
FT                   /db_xref="GOA:Q98MX2"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MX2"
FT                   /protein_id="BAB47991.1"
FT                   /translation="MAERSQNLQDLFLNSVRKSKNPLTIFLINGVKLTGVVTSFDNFCV
FT                   LLRRDGHSQLVYKHAISTIMPSQPVQMFDGEESQGA"
FT   CDS_pept        289858..291153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0403"
FT                   /product="GTP binding protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47992"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47992"
FT                   /db_xref="GOA:Q98MX1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MX1"
FT                   /protein_id="BAB47992.1"
FT                   /translation="MPVLTRQPRGDDDTNRPRLTRSADARHDEAVGLARAINLDPVHTA
FT                   VVTVNDPRPATLLGSGKVEEFAQIVKDNDAELVIVDHPLTPVQQRNLEKELHAKVLDRT
FT                   GLILEIFGERARTKEGTLQVELAHLNYQKGRLVRSWTHLERQRGGAGFLGGPGETQIES
FT                   DRRQLQEKIIKLKHELETVRRTRDLHRAKRKKVPFPVVAIVGYTNAGKSTLFNRLTGAD
FT                   VLAQDMLFATLDPTLRRVRLPHGTPIILSDTVGFISDLPTHLIAAFRATLEEVVEADLV
FT                   IHLRDISDPDTAAQAEDVERILADLGVDAGDTKRVIEVWNKVDLLDEGNRSRLLADAVD
FT                   GSKGPPIAISAVTGEGIEALKAVIETRMAGELEDLTVTIEPAQFGLVDWLYRNGDIVSR
FT                   ADNEDGSATISLKATQSAREEIESRLRRKNNG"
FT   CDS_pept        complement(291212..292036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0404"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47993"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47993"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MX0"
FT                   /protein_id="BAB47993.1"
FT                   /translation="MTPSKDISRLIEIMAALRAPKTGCPWDIEQDFSTIAPYTIEEAYE
FT                   VADAIARGDLNDLRDELGDLLLQVVYHAQMAEEAGEFAFPDVVQAITTKMIRRHPHVFG
FT                   DEEARGAGMAKGMWEKIKAEEKAEKRQARLARGLDPEDNGKGFLDSVPVALPALTRALK
FT                   LQEKAARVGFDWSEAAPILDKIEEEIGELREALARGETASIKDEFGDMLFAVVNLGRHL
FT                   KLDSEAALSGTNEKFRSRFHYVEQALEKSGNTLEKATLDEMEALWQEAKSAK"
FT   CDS_pept        complement(292117..293301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0405"
FT                   /product="aromatic-amino-acid transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47994"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47994"
FT                   /db_xref="GOA:Q98MW9"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MW9"
FT                   /protein_id="BAB47994.1"
FT                   /translation="MFEDLQPAPADKILALIGLYRADPRPNKVDLGVGVYKDRDGKTPV
FT                   MRAVREAEKRLLNSQDTKTYLGLAGDTGFNAVMAKLAFGPGADMTRIRAAQAPGGSGAL
FT                   RLVAELLKRTRSDATIWLSDPTWPNHMPVMRAAGLQIREYPYFDAASGAVRFDDMLAAL
FT                   RTAKSGDVVLLHGCCHNPTGANLDAAQWQAVTDLMVERGLLPFVDIAYQGFGDGLEADA
FT                   LGLRLLAAKVPEMVVASSCSKNFAVYRDRVGAAMVLARDSAQADVAMSQMLSAARAMYS
FT                   MPPDHGAAAVRIVLEDASLRADWEAELEEMRLRMLRLRVAFAEALRRQSNSDRFDFVAS
FT                   HRGMFSRLGLTEAQVERLRAEHGVYMVGDSRINVAGLPEDGMDALAKAIVSVLD"
FT   CDS_pept        293478..294071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0406"
FT                   /product="probable phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47995"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47995"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MW8"
FT                   /protein_id="BAB47995.1"
FT                   /translation="MLVRLTMICNGATAATRRGSFPLDEPLEPRSLTRAKAMRGTLRHA
FT                   DRAWTAPALRARQIAEALSLEAAVEPLLADQDHGSWAGKSFEDVQAEQPGDIAAWLADP
FT                   DAAPHGGESLADVARRASGLMEKLMAEPGHTIAMTHASVIRTAIVHVLGAPLAACWKID
FT                   IEPLSITDFRSDGRRWVLRACGVTSPKAAKPLLR"
FT   CDS_pept        294149..294700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0407"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47996"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47996"
FT                   /db_xref="GOA:Q98MW7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MW7"
FT                   /protein_id="BAB47996.1"
FT                   /translation="MLRKQGMKRSMPRFDIIGQLGSLRRYAQSLTRDSADAEDLVHDAL
FT                   VRAYERRGTFRSGGNLRAWLLSIVHNAFIDRMRSRRSEAVRIEQAGYLADAATPAPQEH
FT                   SVRLAQVRDAFFNLPEEQRSALHLVAIEGLSYQQAANATGVPLGTLMSRIGRARAALRQ
FT                   MEDAAPARGKNHLRIVGGEP"
FT   CDS_pept        294697..295470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0408"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47997"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47997"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MW6"
FT                   /protein_id="BAB47997.1"
FT                   /translation="MSALVDPVTDTDLDAYVDDQLDVTRRIEVEAFLSTRPEAAARVMS
FT                   DLRTRDELRVALAGSKGMARPATADAARRLERGLARGRIFGVLQRSAAVAAFVAAGWLA
FT                   NGIIGPMSVTKVVASPQPPAYVDEAVRAHRTTLVRETMPSQPEAPNYSAGEIRAATAIV
FT                   MPSLPKDWKVRDVQIYPSRFGPSVEMAVDTKDMGLVSLFAIRPGTFDVVKPTVAPSGDI
FT                   SSAYFQIGEVAYAVVAKSGVRDLDRAAETLARTLY"
FT   CDS_pept        295495..296211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0409"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47998"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47998"
FT                   /db_xref="GOA:Q98MW5"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MW5"
FT                   /protein_id="BAB47998.1"
FT                   /translation="MNTPNLGYRVGTGAQAGAVFDEGLRQHMLRVYNYMGLGLVVTGLV
FT                   AFLVSSTPALYVPIFSSPLKYVVMLAPLAFVLLFSFRMQTMSAASAQAMFWAFCAVMGL
FT                   SLASVFLVFTGTSIARTFFIAATMFGATSLYGYTTRRDLTQFSSFLIMGLIGVVIASIV
FT                   NIFLGSTALQFAISVIGIAVFIGLTAWDTQTIKEQYAENFDAESRQKLAVFGAFSLYLN
FT                   FINIFQLLLNFTGERE"
FT   CDS_pept        296380..297264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0411"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47999"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47999"
FT                   /db_xref="GOA:Q98MW4"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037481"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MW4"
FT                   /protein_id="BAB47999.1"
FT                   /translation="MAQDSQTLQGDGISAIIVGQGAELVSLRDGQGSEFLWQAGPEWRR
FT                   HSPVLFPIVGRLKGDQLRHRGRTYPMTQHGFARDKPFTWEERGPRSCTLVLTDDADTRA
FT                   HYPFAFRLAVTYTLGRQQLGVALEVTNTGDEMLPASVGAHPAFNWPLLPELPKEAYRLI
FT                   FANDEPAPVRRLKDGLLLPATSPTPIEGKTLVLSERLFDDDAVILDRPASTSVRYAADH
FT                   GPAIEMSWQGAEELGIWSKPGGAPFLCIEPWHGIASPADFDGEFSDKPGVMLIEPGAKR
FT                   SLSYQIGLEQGRR"
FT   CDS_pept        complement(297466..298398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0412"
FT                   /product="probable agmatinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48000"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48000"
FT                   /db_xref="GOA:Q98MW3"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MW3"
FT                   /protein_id="BAB48000.1"
FT                   /translation="MTASPSFLGLPDRLDGRTPRAVIFGAGHGSTYPGKDSSGHALAAD
FT                   AIRAASQDDASLVEHWDFDLGGPLFNGKPASCVDAGDISTILHDNAENRVRIEAKTREV
FT                   LALPAVPILLGGDDSVVIPFLAGFADHGPIWVLQIDAHIDWRDEVLGERHGYSSPMRRA
FT                   SEMPHVAGIVQVGLRSVGSARLAEIEAARHYGSRFVTAREVHAQGVDAALRHIPEGARV
FT                   VATFDCDSLDPGIMPGVAARTPGGLTYTQAIDLIAGLGKRARIAGFDLVELYPPADIDG
FT                   LSALTAARLLVNVIGTIASMTVSQSSSTA"
FT   CDS_pept        298932..299510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0414"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48001"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48001"
FT                   /db_xref="GOA:Q98MW2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MW2"
FT                   /protein_id="BAB48001.1"
FT                   /translation="MTKHKVGYLIGSLARESINRKLAKALVQLAPPQLEMSEISFKDLP
FT                   LYSYDYDADFPPVARAFKDAIAAVDAVLFVTPEYNRSIPGGLKNAIDWASRPYGKNSFA
FT                   RKPSAVIGTSPGTIGTAIAQQGLRSVLSFCNSPQMNAPEAYIQFTPGLITDAGEVTVES
FT                   TQEFLSNYMAEFSMFITRVLQVLPRQASA"
FT   CDS_pept        299710..300051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0415"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48002"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48002"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MW1"
FT                   /protein_id="BAB48002.1"
FT                   /translation="MANAPEAIVVYLLGDGAPFRQYVAVDGDDIVGRVRSVGAVGATWC
FT                   ADMYVEPSRRRRGIGQALMAKMLRDDQARGSRCSGATATHAGALLYPCMGYERTGTLLI
FT                   LGPTSRTAS"
FT   CDS_pept        complement(300065..300883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0416"
FT                   /product="probable hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48003"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48003"
FT                   /db_xref="GOA:Q98MW0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MW0"
FT                   /protein_id="BAB48003.1"
FT                   /translation="MTGRLRLTILGCGSSPGTPRITGDWGNCDPANPRNRRMRTAALVE
FT                   RVAADGGRTTVVIDTGPDFREQMLLASVKRIDAVVYTHPHADHIHGIDDLRGYVLEQRH
FT                   LIDIHADQPTMLRLRQAFGYCFETPPGSSYPPIVRAHIIDHAKPVVIEGEGGALALEPL
FT                   PQIHGDIISLGFRIGGLAYCPDISDFPDPTADRLRGLEMLVIDALQYNPHPSHLSLGQA
FT                   LGWIEKLAPKQAVLTHMHVPLDYAKVKGEMPANVTPAYDGMVIEIPYESA"
FT   CDS_pept        complement(300887..301681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0418"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48004"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48004"
FT                   /db_xref="GOA:Q98MV9"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MV9"
FT                   /protein_id="BAB48004.1"
FT                   /translation="MLVDSHCHLDFPDFAEERAAIVARAKAAGIGRMVTISTRVKRFPQ
FT                   MLEIAETFDEVYCSVGTHPHNAAEELDVTTAELVRLSAHPKVVAIGEAGLDYFYDKAPR
FT                   DAQALGFRNHIAAARATGLPLVIHSRDADDDMAAILEDETGKGAFPFILHCFSSGRRLA
FT                   EVGVSLGGYVSFSGILTFKNSAELRAVAADVPHDRLLVETDAPYLAPIPFRGKRNEPAY
FT                   VAHTAKVLAETVGVSEAEIADLTTSNFFRLFGKMPRPAELSA"
FT   CDS_pept        complement(301681..303231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0419"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48005"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48005"
FT                   /db_xref="GOA:Q98MV8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MV8"
FT                   /protein_id="BAB48005.1"
FT                   /translation="MSREKYYLTTPIFYPNGKPHIGHAYTVIATDALARFQRLDGKDVF
FT                   FLTGTDEHGLKMQQTAEKEGITPQALADRNSAIFRSMTEAVGGSNDEYIRTTEPRHYAS
FT                   CQAIWKAMAANGDIYLDRYSGWYSVRQEAYFDESETTLGEDGVRREPLGSPVEWNEEES
FT                   YFFRLSAYQDKLLALYESQPDFVGPAERRNEVMSFVKSGLKDLSISRTTFKWGVPVPGD
FT                   DKHVMYVWVDALTNYITAAGYPDTKSDQWRYWPATHIIGKDIVRFHAVYWPAFLMSAGI
FT                   ELPKRVFAHGFLFNRGEKMSKSVGNVVDPFALIEHYGLDQVRYFFLREVPFGQDGSYSH
FT                   DAIVNRTNADLANGLGNLAQRSLSMIAKNCGGVVPKRGEMTDADSAILDQAVAALTTAR
FT                   KAMAGQGIHLALAAIFDVVAEADRYFAGQAPWALKKTDPERMETVLWTTAELVRRVAVL
FT                   CQPFIPGSAAKLLDLLAVPADKRDFVHVHADYALVPGTALPAPEGVFPRYVEQPGANA"
FT   CDS_pept        303476..304639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0421"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48006"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48006"
FT                   /db_xref="GOA:Q98MV7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MV7"
FT                   /protein_id="BAB48006.1"
FT                   /translation="MGRCKGRSRSVVSRRCKRQTGMATTTQYDPRQSLDARLRQAGASK
FT                   TVYALVTPEIETVKAELLGNSGGNGPDPIRVAYLDQFRHAWTGKQNALHRRFFDTWLGW
FT                   AKPMAPLDAADYPFSYPTSGASEPLFHLIADYGNRARLERFPPRLVIFRGEYEGYKAYA
FT                   EACGIAVAEYERHAWRDVADTVDPKDLLCLSQPSAIDGMVWPQANAFLRRLSLRANPAQ
FT                   LVLDLTYVGATAEPPAETILAGAPCVSAVVISLSKPFGAYYDRIGGVFCRSENLGLFGN
FT                   QWFKNLTSLQLGIRLMERFDVFAMARRYTGIQGSVAEHAGRALGLALTPADVFILAQAT
FT                   ASAENDPDLAAYLTRAPGAADSRPRLCLTPGMAERIGMAGANSGTLS"
FT   CDS_pept        304573..305487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0422"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48007"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48007"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MV6"
FT                   /protein_id="BAB48007.1"
FT                   /translation="MPDARHGGTDRHGRREFRDVVMKNLLPLVTSDDIHAHCLAHWKTE
FT                   AFRSSHRQGGYIHGIVDQYARLPRFSCETTNDRLERAHFCTWWGLTMRRDDYAAPAIED
FT                   LYLLHEIWHAAHMPFIPGIGFEAFHGKMERNELEASVASELLVYFKIDGLRESAFPHPI
FT                   YADRFLNDPAMRLLWRENEVVATNTLLEARRNVMYSKPEGDMDLSERWIRKFTMQNRQW
FT                   SIVWADRYLEIEDHMHRFQQIALGGDRKAASDFHADWIEAEAAMDMVDHVPFRDQALLF
FT                   ATIYWANRAKYDSALAVQRATQS"
FT   CDS_pept        complement(305542..306591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0423"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48008"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48008"
FT                   /db_xref="GOA:Q98MV5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MV5"
FT                   /protein_id="BAB48008.1"
FT                   /translation="MIFERIAPEQHDTLDGVPEPSETPRLVGHGQAAEMLAAAYRSGKL
FT                   PHALIFAGPVGIGKATLAFHLAHHLLKHPAFEQAPERLANPDPASPLFRQIATGAHPGV
FT                   LHLTRPMNDKTKSFKTVVTVDEIRRVSRFLSMTSHDGSYRVVIVDPADDMNANAANALL
FT                   KNLEEPPARTLFILIVHAPGSLLPTIRSRCQVIRLTPLDADDLLAVLETAEPPPPDDPA
FT                   ARAALVERAGGSARNAILLTQYGGLEIAGTLDALVAKGKSDIGGAYRLAEAVAGRDQTI
FT                   QFDIFNRRALDLLSDAASQAALSGDLARAKILSDTWHEALDAISETDTYNLDKKQHALT
FT                   MIDRLKSVM"
FT   CDS_pept        complement(306588..307262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0424"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48009"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48009"
FT                   /db_xref="GOA:Q98MV4"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MV4"
FT                   /protein_id="BAB48009.1"
FT                   /translation="MARGFFITFEGGEGAGKSTQIERLARKMHAKKYDVLLTREPGGSP
FT                   GAEAVRHVLLSGAAEPFGPKMEALLFAAARSDHVEQVIRPAVERGSIVLCDRFLDSSRV
FT                   YQGVTGGIDPAFMATLEQIAINGMMPDMTLIFDIDPAEGLRRATLRRGSDAGADRFEKE
FT                   TLAIHQARRAAFLAIAAAEPERCIVVDASADPNTVEDVVTAAVFAALEARAPARNRQAA
FT                   PV"
FT   CDS_pept        complement(307339..308505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0426"
FT                   /product="penicillin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48010"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48010"
FT                   /db_xref="GOA:Q98MV3"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MV3"
FT                   /protein_id="BAB48010.1"
FT                   /translation="MQLRAFPPFAGLLGLALLLLCLAPAHAQLFETKATQAFMIDADTG
FT                   TVLFSKDADKPIPPASMAKLMTMEVVFNAIKSGRLKLDDTFVVSENAWRKGGAPSGTST
FT                   MFAKLKSAIRLEDLIQGVTVQAANDGCIVIAEGMAGSEDNFAAQMTERARQIGLKTSTF
FT                   VNSTGLPADGQQTTVRELAQLALHLWRDYPDFYRYYGLKDFTWNKISQKNRNPLLAMDI
FT                   GADGLAVGASEVAGFGIVASVSHNGTRVIMAMNGLANDKERAEEARKLLDWGARSFEKT
FT                   EIFAKDEVVGEAQVFGGAKSGVTLKAKGPIDIFLPITNRDKLTARIVYTGPVAAPVEEG
FT                   QPVGALRVWIGDTLSQETPLFAAESIGVGTLPQRALDAVKELAIGWLR"
FT   CDS_pept        complement(308589..309812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0427"
FT                   /product="rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48011"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48011"
FT                   /db_xref="GOA:Q98MV2"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MV2"
FT                   /protein_id="BAB48011.1"
FT                   /translation="MQATTRPRLRRASTLTLLAASAALLAACASQPEPRAMVNPKHRSK
FT                   EYFAETEYGVKASPRVNFMRRGGGRDQLGKPYQVRGKWYYPKEDRHYAKVGLASWYGDA
FT                   FHGRLTANGEVYDMTHLTAAHPTMPLPSYARVTNLETGSSVIVRVNDRGPYHEGRIIDV
FT                   SERAAQMLDYDKVGTAKVKVEYVGRAPLDGNDDQYLMASYHPGNRIPDPSDGLPTGVMV
FT                   AMNGPSPSVPVGAAAVPFPGQLTNSGEAAQPSLSAQAPAFGDLALPDFGPIVPERPEIG
FT                   LPPQSPFAVASLSYADERVQRADVFAALDDSGMSPADILRSWKKSNPQASPSNADYVAA
FT                   GTFDDAAEAKRVASALQPFGRTEIQRSDLDGNDWYAVNLYPNGHGGLDELLQAAWSHGA
FT                   PDALAVRN"
FT   CDS_pept        complement(310805..311530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0428"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48012"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48012"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MV1"
FT                   /protein_id="BAB48012.1"
FT                   /translation="MVARALSSGMARDPLKVIENRRRYNAKHREELLAKGRSPASLEKQ
FT                   RKRRAENPEKTAEHRRLFKLRHPDRVKAGWKAYRVANSEKIAAYYATYSVEHKAEILAT
FT                   DRVYRAKNRDKVEMWQERRKLKARSISAIRHNPDEVYRVVSRAVSSALPRFMRDDVINS
FT                   MLLAVLEGELLLQNVGARVKDYLGRYNKQYDTFKTLSLDAPMGGADLRRIDLLAAPEPE
FT                   QEEEEDPDIVMLRGGLSRW"
FT   CDS_pept        complement(311880..312605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0429"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48013"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48013"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MV0"
FT                   /protein_id="BAB48013.1"
FT                   /translation="MPNTSVRAAAEGMPKITRRHALMMSSGAIVALAVAPNAHAAVAVD
FT                   DVSEVRALIKAHRDAEAAFEKALVADGEMEEAYFAAHPERELLIPLSIGGAQSLYIRFE
FT                   AQEYLDDCVKAIASTYNAKRQSLAALRQIAPALANDAVATLDRAEAVDLSTLDATWKAE
FT                   QAKRKAFGWGKTRRAYNSTCDAMHRALDAICTYRCSSPAANRARAAYLLKVTGGKFADL
FT                   ENYQVRALLRSMRAREAQS"
FT   CDS_pept        complement(313639..313878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0430"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48014"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48014"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MU9"
FT                   /protein_id="BAB48014.1"
FT                   /translation="MEFATMARSKPSQQLSQAEIERFLVAAEALHWSIVKPFISPHCEH
FT                   YRATRVLHEVLLKSVRDVTGKEVEFIRWFGGGSA"
FT   CDS_pept        complement(313936..314181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0431"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48015"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48015"
FT                   /db_xref="InterPro:IPR008486"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MU8"
FT                   /protein_id="BAB48015.1"
FT                   /translation="MSFELIATMSTRGINFLDQWIANNIPETTKADVISVDELTHKLIA
FT                   DAKSLGIKRGEIDEEVDSLYRTILDAIVHYDPGLPE"
FT   CDS_pept        314231..314539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0432"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48016"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48016"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MU7"
FT                   /protein_id="BAB48016.1"
FT                   /translation="MGQGIKVGDTVAITATVRKRVTDDRVSVLILSYGQPHSIVDSTPH
FT                   ISSGQKIELTGEVLRVDEDTVTVGGKDLGITVKHSAVRLVTSHVAPKRKTPLVDKPA"
FT   CDS_pept        complement(314557..315024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0433"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48017"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48017"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MU6"
FT                   /protein_id="BAB48017.1"
FT                   /translation="MVRFLLSLVPVLFCSTLLQAQAWQQFGVRQFGFTFDVPPGFVLAH
FT                   RSDQGAAFQGENNAFLAVWGASLGDASFPAEIEHRMIEDEKLGWKLTYRRFTPRWASYS
FT                   GIKDGQIRYVRAIAICNDRAALFTINYSRSEKIPYDPVVVRMVRSLKAEGC"
FT   CDS_pept        complement(315189..315449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0434"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48018"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48018"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MU5"
FT                   /protein_id="BAB48018.1"
FT                   /translation="MSLQSARYTDVMRKPSKTPFTKLLAAETTLLSADRLLGLLKLQTD
FT                   RGDIELVMNRVVAERLMSTVVDFLQAGQGDDGPTFAVERSQ"
FT   CDS_pept        complement(315661..315882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0435"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48019"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48019"
FT                   /db_xref="InterPro:IPR008486"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MU4"
FT                   /protein_id="BAB48019.1"
FT                   /translation="MSTRGTDFLHKWISKLVPKTAGADIISVADLTEKFFADAKAKGMS
FT                   STEIEEDTGSVYEAILDAIVHHDPGLAD"
FT   CDS_pept        complement(317216..317560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0437"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48020"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48020"
FT                   /db_xref="GOA:Q98MU3"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MU3"
FT                   /protein_id="BAB48020.1"
FT                   /translation="MVWVETVMHDFFDLLGIKAPVVVAGLSGGILRALSRHRYKLREMV
FT                   ASPVCGALAAAYLTLPVVAYFRATGVPLPDPADDTTTLAAAFLIGVSAMWISDILFEMI
FT                   VRKFKPRAEE"
FT   CDS_pept        complement(317539..317748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0438"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48021"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48021"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MU2"
FT                   /protein_id="BAB48021.1"
FT                   /translation="MGKVLNLPALLLLAACVTTAPVNNPRKIWCDHNQPRRPSLVVINV
FT                   MTRAELDEMNTFNAQGAKWCGWKP"
FT   CDS_pept        complement(317733..318029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0439"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48022"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48022"
FT                   /db_xref="GOA:Q98MU1"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MU1"
FT                   /protein_id="BAB48022.1"
FT                   /translation="MIPTSARRREMGALIVSILGALVGNKVIMTLFAAVVGGLYVAGGI
FT                   NRAKKDKAATAARDLAAAQDQLEMDREATAAEKQAAGMTNAQAKAEATKWAKS"
FT   CDS_pept        complement(318001..318225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0440"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48023"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48023"
FT                   /db_xref="GOA:Q98MU0"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MU0"
FT                   /protein_id="BAB48023.1"
FT                   /translation="MWSKIKDFFLHSETIFLARLQVFVGVVVATFLSLDPSLFQTYVPT
FT                   KWLPVYMLAVGVLTEYARKRNDPNIGKAP"
FT   CDS_pept        complement(318704..319630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0441"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48024"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48024"
FT                   /db_xref="GOA:Q98MT9"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MT9"
FT                   /protein_id="BAB48024.1"
FT                   /translation="MDLSPAGAAFVRVEEGVELKFYLDSVGVGTIGIGFTWGSAAFRQW
FT                   WADNKPGMTFGIGATMTRNEAEKALIYCFANEYGKAVNAFLGHEVPQNVFDGMASPVYN
FT                   LGTGSLGWKWAAFAKRGDYSACAAVLRSTGTTAKGKTLAGLVRRRREEAALIESGIYAG
FT                   VGKIQAATDDPVDTAMLDSVLTRGERGPSVAALVSNLAALGYYKGKLDDVFGYGTEAAV
FT                   LAFQRDHGLTADGYAGEITLAAITAALAAPKPPQTPPIGGPSQQPAAPARSMGSGKVAA
FT                   AAGIGALIYVAVISWWHEITRFVSNLF"
FT   CDS_pept        complement(319664..320056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0442"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48025"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48025"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MT8"
FT                   /protein_id="BAB48025.1"
FT                   /translation="MMEYRNAAFNQFGTVDLEINHPEYGWIPFTASPDDSEELGREIFA
FT                   SASPIAASYDPKTTVPARPMVRKSVVQARIIAAGKMPAAYVALTANPVYFARWFAPDHP
FT                   EVYCDDPDAVALVQALGLDPAVILAP"
FT   CDS_pept        complement(320053..321102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0443"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48026"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48026"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MT7"
FT                   /protein_id="BAB48026.1"
FT                   /translation="MPMPRDGSGVMSWPPNGNAVTATPIDSSKYNARFADLLSDLNAAR
FT                   PITAGGTGANTAIGGNDNLNTAGANIASASTVNLASATGVAVTITGVARINSFGTAAAG
FT                   VERVLTFAGVLPLTYNATSMILPGAADIVTAVGDVGTFRSLGGGNWRCVSYETADGQPI
FT                   SSTFTSSQTFNAGLAANNSTGQAIGVLAGPAATATLFYGHALAGAGNAAFITLDRPGSF
FT                   AANFGIDTDNKWKVGGFSMGANAYEIVHMGNYTTLLDPRYFQTANFASTLAGLAVGAVG
FT                   TSALLGANPAADLSPGNTVAGSNLRFTHAGGFVGSGATAPSGTWRAMGNTTSAGFNTSA
FT                   GATVFLRIS"
FT   CDS_pept        321164..321568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0445"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48027"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48027"
FT                   /db_xref="GOA:Q98MT6"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MT6"
FT                   /protein_id="BAB48027.1"
FT                   /translation="MCDAVTLVQLYPPIAAALIVGFLWAVVEYRLYKRDLPAGPNNESV
FT                   LQALWLVLPTAATGCYFWWVGIDTNSTSYVHIFFCTLAGLGFATIAIFGVKLIFYDRTT
FT                   FKQKSTGYILFVSLLFVLGIIVGPAFIQVR"
FT   CDS_pept        complement(321579..323684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0446"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48028"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48028"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MT5"
FT                   /protein_id="BAB48028.1"
FT                   /translation="MAQLVPVDTDPFATTPAAAAPVAVPAQASPALVPVDHDPFAGTNQ
FT                   PPGVPVYVPPGVKGYDPQTGEVAPGQYTTGNDLGLAFTSSVLNGVPIVGPYLKQGAESL
FT                   GAKVNSALSGKSEADVRYASDQATNRAVNDNPYTAGSGNIVGAVAGTLPAVVAAPELFG
FT                   AGEAGLGMRSVVSALTGGTINAADSGVRSGGDPAAMERRGLIGAGFGLIAPGGGTLIGK
FT                   GIGSAVDYLTRPGASELGNFSRATLAKITGAMNADGLTPQAVQQRLTRLGPDAMLADAG
FT                   PNLQQTAAGLVAKPGEARGIIQDAIAQRDAGANQRIRSTLDSELGPAPVPSQINAGITA
FT                   NQAALSPEYRVALQNAGPVDTLPIARYLDQDIQTLRGEPQRVLQRVRAMLDHVPTPQEI
FT                   AQARALGQPPPGNSLVTDAGELLNARHAVDDMLQTTQGSNALNALSTARQAIDDELRAS
FT                   VPGIKEVDAKYSELARQRDAVQRGQTVLSSGRESPRPAELAQEVQQGAQPQGMQVGPSA
FT                   VPVRLREGARAEIERIVGTNLNDRVALQGLIKGQGDWNPQRLATLFGQDKAQRLLDVLD
FT                   AERTFANTSNFVTKNSATAARLQAVKSLDGGDVPGLGMVDSYKAGGLLGLGRAGALKGL
FT                   GPVVEAIRSKGANAANSALARGLVSGDHDAVVKALIAASPVPIPTKAISKVAEALLLGS
FT                   GSAAMRP"
FT   CDS_pept        complement(323685..326231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0448"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48029"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48029"
FT                   /db_xref="InterPro:IPR041219"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MT4"
FT                   /protein_id="BAB48029.1"
FT                   /translation="MALSFIYDPNKETPAGLASKRAVVQALMMSQRAPRNVGEGLNALG
FT                   DGIVENVLNSRIAAADAAGRASAADTMSGLAGGGTFPAAPGTAKAGGGMANSDGTLPAV
FT                   DVSKSASGSVDPQTVFAGLKARGLNDAQAYATLGNWKQESEFRPEAVNPGEGAIGFDQW
FT                   RLGRADALRQFAQQAGKSPTDADVQMDFYVKELKNHPGGQDFLASNDIPSANRALKTFI
FT                   AYGSPYDKGGEGTRLANALAYQKMGFGAPADQNAASGDGSGPALAFAQTPDQVPLPPAM
FT                   PGQTQASAAPPVQTASLDPSIGIAPATKPAPDPGILAAAANAAPTDPGILASPSLPASA
FT                   PIPTPPPNAGYVPGAPGATSPAGQRVLSTMMQEDPLSGPGGVVQALSAANPPAPAGAPS
FT                   TVAAALASAQQPQQAAPSSPGVQKVAQAMSPQDASLPVMAGGSSDAIAPGMQQQGPSVQ
FT                   QLMQAMSNPWMSENQQQLIGSMLSARLTPHKIEMVSLGNGVTAEVDSMTGQIVGQIKGQ
FT                   PDLKTIKDAAGNEYMFNPADPTHPITADTLLGGQTGGQAAGGQPGQTGQADPYASPFPR
FT                   TIARTDTMKDYEGYLAQSKALGTAPIPFSEYQMNLKKEGAQSVVFNQENAANKAVGEAI
FT                   GANMADYINTAKDARTKLQALNMIKGVLDQYGNNISTGPGARTMLAGKQMLANAFPGTF
FT                   GDQAGPTEMLQKLSTQLATADAKGLASRPTQFDFATYLKNNPGIQMSVAGQKALVDLKL
FT                   QQAQHDYELGSMATHKQYANDPGGWADVVAQYDKDHPLINPLTGKPADPTATDFPDPTA
FT                   PTSAGAPPVSGATKAPDGNWYVPDPARPGKYLKVVP"
FT   CDS_pept        complement(326235..326927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0449"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48030"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48030"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MT3"
FT                   /protein_id="BAB48030.1"
FT                   /translation="MATPFDGSNDATESRLLQLGRERLDPILAQQSDALQTQLSNQGIK
FT                   LGSAAYDRAMTQQALHANDATDQLILQGHGQAFAEGQAIRNQPINEITALLSGSQVSNP
FT                   QAAAYTPSTIPTTDNAGIIANNYQQKMDAYNAQMSQASSLAGGLFGLGGKLISLSDDDA
FT                   KKDKERLADITPEMGLWKFHYKGEPADAPMRLGLMASEVEKVRPDAVSRRPDGYRQVDY
FT                   GKALSLGA"
FT   CDS_pept        complement(327235..327630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0450"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48031"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48031"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MT2"
FT                   /protein_id="BAB48031.1"
FT                   /translation="MTPGCEAGFGNCKAIGVLDDDDELVAGMVFHDWQPRSGLIQISSA
FT                   SKTPRWLTANVRHIMFSYPFDQIGCQMVVLQVSARNERMVRIAKAFGFTPYLIERMRGR
FT                   DEDGFVFTLTDDQWRNSRFTRKFHGQA"
FT   CDS_pept        complement(327678..329264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0452"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48032"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48032"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MT1"
FT                   /protein_id="BAB48032.1"
FT                   /translation="MRAGFRRVPVQAQAQQRHSTMTFPAPTRGKISNENLAAAGPKGAK
FT                   VLENWFPTSTGIRLRGGAARHATIGTIPVVSMMSYDGPAGSFMFAADGTNIFDVTTPAS
FT                   PTVPPTAVVTSLTSGYFSYVQMPTPGGYYLSALNGTDSMRQFDGTTWTTVAALGPSINT
FT                   NQLSFIWTYRNRQFFVQKNTLNVWFLPVDSISGTAQAYSLAGVFQDGGSVLCGGTWSLE
FT                   TGGGIDAKCVIISDRGEVAVFQGTNPADATAWSLVGRYAMSPLLGPRALMQAGGDLLMG
FT                   MADGIVPISQAIQKDAAALALISVTRAIEPDWRKEVAARTVLPWELLKWPQFNMGIVAL
FT                   PASPGQDRKVFVVNLQTGAWADYTGWDACCLVLHAGWAYFGTSDGKIMQCEVGGIDDGM
FT                   PYVCTYVGLFDHMKAVARTKIIHMARTVFIASRKFVPKLSVSTNYQVSLPSPPPSAPDD
FT                   VTLDTWDSGLWDKAVWDAGWVKAVTTKWTSVGQSGFIIAPQVQVTSGVTPTPDAELVEI
FT                   DMTYEVGAVVV"
FT   CDS_pept        complement(329261..329962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0453"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48033"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48033"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MT0"
FT                   /protein_id="BAB48033.1"
FT                   /translation="MTILSVIQQVCPVIGLNVPTAVFSATDRELVELQALSNEMAQRIA
FT                   FDTRDWTKFKTLCTLTGDGSTVGFNFPSDYKRMLKKARVWPSASPFAPYTHYSDTDQWL
FT                   GITVQNFRSIIGAWTMIGEQILIKPAMANLSTAQFYYITNQIIKDKDGAPKVAFTADDD
FT                   VFRLDERVLKLGMIWQWKANKGQAYAEDMTNYEDALAVYAGADKGSNIIAVGRGRTPVD
FT                   TDLAFPGIITP"
FT   CDS_pept        complement(329969..330796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0454"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48034"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48034"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MS9"
FT                   /protein_id="BAB48034.1"
FT                   /translation="MNAHTNSQANTNVTNVVFRTHTQPDEAASKKAGRPIFTDIEVCDI
FT                   TFPANRQTRATFPAHDAEPNATRESMANGGGVMTYAQVYNAQYLAYKSGVAQPMGGTPL
FT                   SEAPFLTESKRRELKALNVHTVEALASLDGMPLKQLGMGGRELKNQAVAYIDNAAGSAD
FT                   VTNLAAQVAILTQQLAEERRMREEFTNAALARRERIKAGEEIEDDEQPEDDEPAELEPE
FT                   PDDFEPVLPPTFAEIDAMDDEALKVYIAKETGSRPRGNPNRDTLVAAAKELAS"
FT   CDS_pept        complement(330878..331420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0455"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48035"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48035"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MS8"
FT                   /protein_id="BAB48035.1"
FT                   /translation="MAYVPHTPYLGLPPIASTIAPTASTLSLGRGSPGPWLGDIITAQD
FT                   PVYGVGEFIYLLGVAGTIVGSLVTFDGANAGTPTWQTALAPSTANLNAPLAVAMSANVA
FT                   GQYGWYQLFGSAVVATNGTLAAGPGPVYLAGSGQVTSTQANGKQVVNARNETATGTPAA
FT                   GLAVVKINYPYAQGQIV"
FT   CDS_pept        complement(331433..332449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0457"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48036"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48036"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MS7"
FT                   /protein_id="BAB48036.1"
FT                   /translation="MALTSVEKNQEILSLALEDRSQGYQDLVSNSCALLHVLQSKGNFR
FT                   EYSGPRIRERLLYTKTGSAVWYNGFGFLNPVPTELFNDAEYTPKMCAVAVTLSNEDILN
FT                   NEGENQIMDMMESHIAAAESELEDEVDISLHGNGTRFGGRELGGMQLAVPTVNNSGTYG
FT                   GIDRGANAIWRTSSFDANSFAVDIGTQVTATTVRPMLNRIMTQRARGKKAADMLLMSGE
FT                   HYAAYDAATVAIQRVNDTNALGKLGFTSLKYYGAGRSADIVLEGGIGSNMPANTTYGLD
FT                   TDNLRVRYHPERNFNKIGKAMVPINQDAVVQYIGFMGELTMVNPLFQWKFFDSNPAA"
FT   CDS_pept        complement(332475..333665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0458"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48037"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48037"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MS6"
FT                   /protein_id="BAB48037.1"
FT                   /translation="MFRLNNQQSLRRSNPMDDMNGGASAPAETNPVAAEPVSTPNPIST
FT                   DPKTVEAKPEPKADKAPTTREALKAAAAKVAEKAKADEGDEGKKPAPVQSQPKTGEKPA
FT                   DKAALPDPKPTKGAETTTTAKPADTTMRAEPKATSHHEAPARFKSDAAAMAEWEKAPEP
FT                   VKAAVHRSIRELEAGIEKHRVSAEAFEQVKDFDDLAKRNNTSLRDAMTRYTNLERTLLT
FT                   NPLQGIQQVCEYAGISLRDLAAYVVGQKPEQVQSQNDATIRELRQQVAQLQQSVGGVTT
FT                   SMQQQHVAGIEAQVEKFKADNPRFEELAEDIAFFLKSGKTKDLAEAYSLAERLNPAAAR
FT                   SVTAAPQTRTAPDPQAQTLKGQKSVTGAPSAGSDPATKRASTSIKDSLRRAMAQTG"
FT   CDS_pept        complement(333649..333975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0459"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48038"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48038"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MS5"
FT                   /protein_id="BAB48038.1"
FT                   /translation="MEFAWFDLGDGRQVFRKVETAKPKRSALSAPMINSDTMSETQSML
FT                   DGKYYTSKSELRKTYRQAGVEEVGNDPARLRRRQKPKVDRKAIKDTVQKAKARFDRGER
FT                   VSPQ"
FT   CDS_pept        complement(333976..335175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0460"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48039"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48039"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MS4"
FT                   /protein_id="BAB48039.1"
FT                   /translation="MAATVIFLTTTGAGTWTVPADWNNSNNSIETIGAGLLGGGAYSKK
FT                   NNVTLTPGGSVNYSVGSASSGVANDTFFGATTFAASICAAKAGGASLGGDAASGIGDVK
FT                   YSGGARGLANGGGGGAAGPHGNGAAGGSGGGSGGGGNGGGSTGAASSFPSGGAGGNNFG
FT                   GTGGGAGGAATALPGAAGTNGGGGGGGSPDDSDTPGVGGNGGNGTEWDATHGSGGGAGA
FT                   GGDASTAGGSGGLYGGGAGRSNLSGGQGIIVITYTPGGAPDITGTLAATLAGGYIANIT
FT                   GTVQPLPPVNQIDMHDGKPREDHAAARNQAKREAHYKLRNAVRKAARKANGAADEPAEQ
FT                   PADLKEMARAIQAEIKTDGIVARLRDIRKLVAEYQAELARLAQEAEDETVAILLLTGDI
FT                   "
FT   CDS_pept        complement(335179..335538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0461"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48040"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48040"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MS3"
FT                   /protein_id="BAB48040.1"
FT                   /translation="MSVILATAVKTAVLTAIRDQVAAGSLEILDASNVLLAAFTLSGSG
FT                   GSVAGAVWTLTFASSTVASGAAGTAAKAQIKNSGGTALITGLTVGTTAADIILTSTTIA
FT                   SGQNVILTSATITHP"
FT   CDS_pept        complement(335535..337919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0462"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48041"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48041"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MS2"
FT                   /protein_id="BAB48041.1"
FT                   /translation="MIDDDQDAIDTIDDAVDPSLKLKSSKGWLKLITDQEKAGYSDYQE
FT                   KCTNIEKQYADLAKLASVTRDRQFQIFWANIEVLKPSMYSRPPVPAIVPRFQDRSPIPR
FT                   TASEMLERSAAVALQREDIDSVMRQVRDDLAILARGCIWVRYETRSKDNDYTEKVCIDH
FT                   KNRRDFAHDPAREWKEVDWVAGGAWMTKKEMRKRFRSTSGDAYMNAEFATRKDDKNNSD
FT                   GKLKARVWEVWCKSQNKVVWVSPGVDVLLDEGEPHLTLEGFFPCPRPAFGTVQRNSLIP
FT                   VPDFVFYKDQIEEVNDITNRISALSDALRVRGFYPAGAGEIGDAIEAALKSTNDRQIMV
FT                   PVSNWAMLGGSAKDMIVWLPLDMVVQTITQLIQLRKQLIEDIYQISGLSDIMRGETNPN
FT                   ETATAQNIKTQYGSVRIRDRQAELVRIALDTVRIIVEIMAENFKPDTLQEMSLMELPTD
FT                   ADVAKVVKGLENQAQQIVAELQHAKTDPEVQQMAQQNPDAAKQIMDQAQQQVQALSKQV
FT                   DDQKATVTIDQVIKFLRDQKIRAFSLDIETDSTIQPDEQAEKASRAEFLTALAGVLAQL
FT                   GPMVEARPETAPFAAELLKFAIAPFRVGRQMDTAIDEFADNMKAAAAQAKPPPPDPAML
FT                   KAQAEIQALQAKSEAEAQSHAQEHAYKMQTLAAERDVKVQEAQIRVGNENARHARDMQV
FT                   KDADMRSKLAEAGYPPDFSIDGANQMNQAQFQQIMAELTATREQSVQQGQQLGQTLVQA
FT                   LQLVVQSNQDTAKAMIAAATAPKRIVRDHAGRPIGAETVMQ"
FT   CDS_pept        complement(337916..339253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0463"
FT                   /note="similar to bacteriophage terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48042"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48042"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MS1"
FT                   /protein_id="BAB48042.1"
FT                   /translation="MFRRIREDLIKNHMEGPQGFRSMLAGWVECGFCTIVEDEIRFWNG
FT                   SRIYLCHCKDEKDRFKYQGAEIHVLLIDELTHFTEVIYRFLRNRVRMVGIKLPAKYAGR
FT                   FPRILCGANPGGIGHQFVKATFIDGATAMKVYTTEASEGGMRRQFIPAQLEDNPSMNDN
FT                   DPGYENRLMGLGSESLVRAMRYGDWDVVEGAYFDNFERRRHVVKPFTIPDHWIRFRAGD
FT                   WGSAKPFAFGWYVVASDDTIIAPGVVVPRGALVKYREWYGVKIDKSGKFLPDVGLKLHA
FT                   EAVGAGVRQRDYDDIIVYGVLDPAAFSQDGGPSIAERMTRGTTGSNGSTFRRADNKRTA
FT                   GRGAMGGWDQLRGRLTGDGDGRPMLFFFDTCIHTIRTLPALQHDEANPEDLDTKQEDHA
FT                   ADETRYACMSRPWIAKSKVPAPQVPEGHIALPGAPDEAAGNRRIRI"
FT   CDS_pept        complement(339402..339866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0464"
FT                   /note="similar to bacteriophage packaging protein gp3"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48043"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48043"
FT                   /db_xref="InterPro:IPR032066"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MS0"
FT                   /protein_id="BAB48043.1"
FT                   /translation="MPAPEGNQFWKVRSTHGRSPIFVNPEKLWAACCEYFEWVDANPLY
FT                   EAKPFAYQGDVKVENIAKMRAMTISGLCIFLDIARVTWAEYAKREDFAYITSQVEEIIR
FT                   TQKFEGASADLLNANIIARELGLADKSELTGKDGQPLPLAPVVNVTISRS"
FT   CDS_pept        complement(340515..340844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0465"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48044"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48044"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MR9"
FT                   /protein_id="BAB48044.1"
FT                   /translation="MSILSKFLRNLFRKGVSHMSAIDYAELAKSLETGATLIKEAATEF
FT                   GSAATQAAQIDKLTADNATLTSQLQTAQTDLAASQAQVADLVAKSNANNDALAAVLAPP
FT                   APPQQ"
FT   CDS_pept        340927..341196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0466"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48045"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48045"
FT                   /db_xref="GOA:Q98MR8"
FT                   /db_xref="InterPro:IPR010674"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MR8"
FT                   /protein_id="BAB48045.1"
FT                   /translation="MTDDEMKAVFALRHVRARIMGVVDAREHKGAQIEDRYLGQAIAFI
FT                   AQAPMDGFDVRAAVVLYGERGNESLRAQDCAQLWAKYGKTIAEN"
FT   CDS_pept        complement(341292..341996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0467"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48046"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48046"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MR7"
FT                   /protein_id="BAB48046.1"
FT                   /translation="MRQKKLKPAGVRVDGSKRIDLKEKRTRRKQNRQVASAKLLQAAPV
FT                   EDTRVADVWRRDELRSSLRIKAEGQARRMTRLSKADGGKEGIRVTAVKVRISAQRSETQ
FT                   AIRSRPGTFEWRYGRKRQDALFHAGSHLAVLWERAGIAVASSADFLRGIGSGYASGISD
FT                   GRVAAIDKLDGFVKEMGRVPAERMIDYCVSGLTTAEIAMKHGAKEREMAPVLHFDLRNC
FT                   AVHFKFISGNRR"
FT   CDS_pept        complement(341996..343093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0468"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48047"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48047"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MR6"
FT                   /protein_id="BAB48047.1"
FT                   /translation="MLLTEANNKMDEKVRFYPVFTGMPDDDYLSRWREHIGQTGRPEDF
FT                   ENVSTNKPTQLENIVLLSEEISVPVGRRPGGERVPCPFCATTSPKFIRGRMALFPDEKA
FT                   VRFIGHRCAETHFGENFRHAERAFRRQTACRSYIDMWSEIGREESGLQVFVGQMSAVAD
FT                   DIQFARDQFDKQAKGFRTFLHRELAQTDGELFVNSDLGMTDRLGSTVIQKMSIGTAAGL
FT                   RLLADGYDVALDMRQLKAALIDAAKPLPEWAPTSPEHPSTDEILRRGRFVERAMKHMVF
FT                   ALADVEDGTRFFARKNLALIHRWGNRPETPFSQFEMKLSDRQLLVRSDTFVGRHYANVI
FT                   VPERVTSTDDLPPPPILQTITRKVA"
FT   CDS_pept        complement(343274..343600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0469"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48048"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48048"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MR5"
FT                   /protein_id="BAB48048.1"
FT                   /translation="MSDEQQAQMPLDLSTVEPSEPDQTATKPRKTNPWTMDWDDGEEIV
FT                   VNNQSAIAVYTNQKLGIVIRQERTWDEEEDTLIILSTPGAAYRVIEAIQRELEANKERK
FT                   KNGG"
FT   CDS_pept        complement(343597..343815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0470"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48049"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48049"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MR4"
FT                   /protein_id="BAB48049.1"
FT                   /translation="MRLVRETIGILEKRRGAAADRFWRSTVRQQIGRMQVCGLHDRNVI
FT                   NDQIEKFALVVFDALRSSAPQQDGDAA"
FT   CDS_pept        343822..343983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0471"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48050"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48050"
FT                   /db_xref="GOA:Q98MR3"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MR3"
FT                   /protein_id="BAB48050.1"
FT                   /translation="MQWKRNDRCRFVSVLFHLARNSHMAECFVTVALFGAVVGVYRAIS
FT                   ALEGRKAL"
FT   CDS_pept        complement(343873..344838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0472"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48051"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48051"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MR2"
FT                   /protein_id="BAB48051.1"
FT                   /translation="MSIANAAKARHRANRTGKMKVGRCILADKPKPTGPFQINNARVRE
FT                   LERIIVSRYGAILPETDDADLFIEVAAYSLNAHCLSKGLDLDKVLSDWCRRWAPWALQR
FT                   AGTIIRPILNMLVGRRYQMKADEAARKICLTLLERTALEIRTMGASDFSARVRKGIAKD
FT                   VKRSGDRARQTAKRRARGVEPRESWLAKNSLSKGRPWDAEGISRAQWYRRFRETGPSLV
FT                   GVSTKSDTLVSSVPVEPSQEAPSRGPSSLTLAKKSSLSGAEGPPVGRNAALVSGSAGVV
FT                   VALPSKCLPSLQSRNGAVDANDGAEQCDGDEALRHMGVAS"
FT   CDS_pept        complement(345036..345380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0473"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48052"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48052"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MR1"
FT                   /protein_id="BAB48052.1"
FT                   /translation="MPDVAGAQASVNSHSKTPNKKFTLTVKIEPDGQTMCLDGRVAWAM
FT                   KQLIDAGKGGCTAITHPGPRWSDYVFKARALGFVIETVHEGHGGQFPGHHARYLLHTKL
FT                   SILEDMAVAA"
FT   CDS_pept        345774..346442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0474"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48053"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48053"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MR0"
FT                   /protein_id="BAB48053.1"
FT                   /translation="MVSPRYCTQSTGFSCHVGGHGVALWHYMGVLGMAKDVTRGGKSET
FT                   LTIRLDPKTRFILEYLSRLKGQNITTVVERAIVAAASQEMVPDPQWPDQPDGWQRFWDV
FT                   SDGCRALRMAERAEFFPTYEEERRLAFAKSHWPFFYSSEDRARFVNHYIDVLWPRIDEF
FT                   IQIYDDQKQSDYFAAGKAMQAALRAAQLAAPEWPIPAKTKPPEKPKPAPNRELDDEIPF
FT                   "
FT   CDS_pept        346455..347654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0475"
FT                   /product="bacteriophage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48054"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48054"
FT                   /db_xref="GOA:Q98MQ9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ9"
FT                   /protein_id="BAB48054.1"
FT                   /translation="MKGHIRERSPGHWAIVLDVGEVDPKTGKKKRKWHSFTGTKREAQK
FT                   ECSRLITVLDQGLYVEPTKQTVAEFLNEWLAFVKPSVAPKTHERYTEICRKGLSPLIGN
FT                   VILSKLKTDRIDAAFTTALTAPRVDHRTKKDQREPLPPLAPRTVHHYRRVLVKALGQAV
FT                   TWERLSRNPATATTPPKVERQKMLAYDVGQTATLLETLRPTRMFVPVLLAVTCGLRRGE
FT                   ILALRWRHLELGDNRRQMSIEESAEQTADGVRYKEPKSGRARTVALSASTVAELKAHRA
FT                   RQAEEQLRLGIRPDADSFVVAQVDGQPLQPRSLTHEWVRVLGKTSLPRIRFHDLRHTHA
FT                   TQMLSAGVHPKIASERLGHSNIGITLDLYSHVMPGMQADAAEQVDVALQAAISSERKGK
FT                   "
FT   tRNA            347728..347814
FT                   /product="trnS-TGA"
FT   CDS_pept        complement(347894..348763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl8587"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48055"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48055"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ8"
FT                   /protein_id="BAB48055.1"
FT                   /translation="MYDQTQTTGITALPYTVVRIRAGDVANPQAVHKGTGFFYHFREGA
FT                   GNVPLIVSNKHVLVGKEWLEFDFALLDNQGKRVFGPANTFRLTKNQLPIFEHPDPTVDL
FT                   AAIPIQPIVEAMRGQGKEIFNLLLGRETIAPDNIQAILHAATSVLMVGFPSGIMDEKNN
FT                   LPVVRRGILAVNYLTDYRGETNFVVDIAAFGGSSGSPVFAFFENMLPDGSGGVTMLAQP
FT                   QVYFLGVLHSGPSMTATGKIVPVPVPTSDQIAQTQMMLHLGYCVKASRVEELVETIRAK
FT                   ISEPTASG"
FT   CDS_pept        complement(348772..349311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0476"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48056"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48056"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ7"
FT                   /protein_id="BAB48056.1"
FT                   /translation="MFPISALIGFEKDGQWRGALALAGEAMAQTAEDNFRIEVWDREEK
FT                   NLVETICRSPDSFISQAAWQAAIRRRPGMVLIHYNSRHVMEKIITPGEPKVPPQTIVDG
FT                   SVHAGQDVALGDLREWHKLRAWCKNCSHHAEVKPAALIKRYGEAALFSTVERALFCTGC
FT                   DRGGPVRLEIHKLPRN"
FT   CDS_pept        349847..350212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0478"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48057"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48057"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ6"
FT                   /protein_id="BAB48057.1"
FT                   /translation="MALALGGALMKWRLYFVVMTLAVTSGCAADYLNNYDTVTLASGDA
FT                   NHTNSLLQTVDPFNPNSNNTHIEGDGQRIVGVVQRYRSPISAGGGYSGNCPTDNSVAAD
FT                   GSHCGKRSAESRPGGAM"
FT   CDS_pept        350305..351066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0479"
FT                   /product="succinoglycan biosynthesis protein; ExoI"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48058"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48058"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ5"
FT                   /protein_id="BAB48058.1"
FT                   /translation="MPLRLVLVTVAAASALATQFVMHNGGSLPEINLQNLIKPKPVAIS
FT                   GVASVIDGDTIEMHGQRVRFNGIDAPESAQYCDDAKGFEYPCGRRSAEALDGFLAASKP
FT                   VQCAFVTWDRYGRFVGDCTRADGSSVAAWMVEHGQALDWPKYSNGAYAAQQAKAKAAKV
FT                   GLWIGSFQAPWDWRAQHSDDAQTPTAPLFATGNGNPGCNIKGNISASGERIYHLPGQKY
FT                   YAVTVISQNKGERWFCSEAEAVAAGWRRSKR"
FT   CDS_pept        351083..351436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0480"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48059"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48059"
FT                   /db_xref="InterPro:IPR022444"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ4"
FT                   /protein_id="BAB48059.1"
FT                   /translation="MKPHVRAAVAAIALSHSSGRNVSSVYSYSELKYVNIDASVQGNVV
FT                   DAYDYNNSCHIDGTLPSLYHYGQNSHIDLQPQSGGQYDGYDYGSNSHFELTVSGNSAEL
FT                   YDYGEGGFFSFST"
FT   CDS_pept        complement(353170..353601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0481"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48060"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48060"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ3"
FT                   /protein_id="BAB48060.1"
FT                   /translation="MDNSDRTGKDPSTGRFLPGHSGFKKVGSRSRVSRQAIDTANEHAA
FT                   TAMTMLVGKMLAGDIRAAEILLRYGADPFLPKNRTVELPDVENPTSENLATAVLSAAWS
FT                   GEISPDEAKQLLDAIAAGKGIIEDAELLRRVEQLEAVKR"
FT   CDS_pept        complement(353719..354537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0482"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48061"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48061"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ2"
FT                   /protein_id="BAB48061.1"
FT                   /translation="MIKDFKRIDGASSRGSLFQWNYNGSVISAFWPNEYSTMSPDIDAA
FT                   ASALNNGVLAAGNAVIGAAERLKRTDEIRDVSLEAIARYVAAPFRYLRDRAIDERNSVG
FT                   ISRNSLAQPIQIPNPTPFSIAADSLERQEVRRMLDGFDQIGEAFDWVMQSPGITVLNAV
FT                   APSIDLTIFSKDQQLAGLIVEEFAIRKWARTIDNPSNDNLATAANPLKNKMSDDLVRDL
FT                   AKARLDGLKLREQAVSDAEKLLLAVIAFASQAGNLTPDEAFKMLMGQKVA"
FT   CDS_pept        complement(354787..355407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0483"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48062"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48062"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ1"
FT                   /protein_id="BAB48062.1"
FT                   /translation="MANYVILRTLVMKNRASTITADHANFAKLGQIADHAFLWLSGRTR
FT                   EWASPVNPSEFQYRDECLDMVSGYEGNIRTTFSFDKTYQSYSFMFDAATTDGHPFVVWG
FT                   TLGGCADNMVVSSTHFSFGIINGVMSASVDQSDNWQFEDSSSTVVSEMLDRHLQPWRDF
FT                   PTGVARQSKELPPAIIRALVKLGYRSKDTRRWTAPNQFAENIH"
FT   CDS_pept        complement(355481..357823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0485"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48063"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48063"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ0"
FT                   /protein_id="BAB48063.1"
FT                   /translation="MRDGSSVRLPPELLPYRQFVVWRLEQKPGSPKPAKMPYSANGGRA
FT                   DTTNPATWSDYPTAVRALASGQYAGIGFVFAENDPFFVIDLDGCRDATTGELSAEAAAI
FT                   TRMFPNAAWELSQSGEGIHIFGRCDKVALGGFRNKWAGWCEFYRTKRFVAFGPGGIQGN
FT                   IDIDWTNQLAILVPARGVGEQDASQEAVERDPRWIGPDDDEELLRRFLASTGGTKAKLQ
FT                   ASPTNLQLWEAHAAALAQYFPSATGKPFDHSSADQALANVLAFWTGRDYGRIIRLFGRS
FT                   ALGRREKWTRRAAYRNSTVNAAVRSCQTVYGGNGQERRSRQVQENVRIGSDIGADIHTR
FT                   VMTLEDMLQDLWFIRHSKSGGAIADSRTLNVLPFATAQREYSASRYEVAASTIDPKTGD
FT                   FKKRYLPVFNQWEQSPSRKSVDVITWKPNGAVICEAPESQGAGFNTWRGFQPYRLPDGS
FT                   QSLVEVWSEHLAYLIPIEAERVRFEQWLAHIVQRPEELPQSAYLFITEETGIGRNWLSS
FT                   VLVRVLRGYVAAGIDIQEMLDGTFNGRLSRKLLAVVDEAKAGMQGYGRWSHSEKLKSMI
FT                   NPEMRRINEKHGLEFVEWNCCRWLFFSNNWDALPFDASDRRFNVVANPTHRQSPDYYER
FT                   IYSQIANPDFISAVRKRLELLDISGFKPGAIPDMNEAKRKALGAMASDLDNLLAAFRDE
FT                   WPGPLAERSDVINYLHVSIAKLPGEKTINKLIEQAGMKLVERISIGPNKYRFVVVRDYT
FT                   AQQIETNPQWAYAEAVNARGKYGFRQG"
FT   CDS_pept        complement(357816..358046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0486"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48064"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48064"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MP9"
FT                   /protein_id="BAB48064.1"
FT                   /translation="MECVAMAGNLRVREMNQSAIVLSIPQVCATLGISRPTLDRYIKDN
FT                   PSFPRKKKIGPRLVGFLRSDIETYIGSLPDA"
FT   CDS_pept        complement(358249..359457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0487"
FT                   /product="probable prophage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48065"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48065"
FT                   /db_xref="GOA:Q98MP8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MP8"
FT                   /protein_id="BAB48065.1"
FT                   /translation="MLTIREIQSLVHKGEPGQWSHTKALYFFIAPSGRPFWAIRYMLKG
FT                   RRRQMSLTDSIPATVRELKQIELLSETEREKVRKGIDPLAEREAAKAASPEPVRQLVTF
FT                   KSVALDYIAANRGGWKNAKHVQQWENTLATYVYPVIGHLEPQSITTAEVLKILQPLWAT
FT                   KRETASRVRSRVETIIGAAKAKGMSEKPEIWANHHNPARWADNLEFWLNGKQEKNHFSA
FT                   MPYPEIPAFAQSIAEREDYSTKALQFLILTATRTNETLGAEWSEIDTEKAVWTIPASRM
FT                   KSGKEHRVPLSSEALKLVASLLRIEGNPYLFPGAIRNKSLSNMALLMVMRGLKLGHYVP
FT                   HGFRSAFRDWAAEETVYPNHIVEMALAHTIKNKVEAAYRRGDLMEKRRQLMEDWSAYLA
FT                   SAR"
FT   CDS_pept        360340..360933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0488"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48066"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MP7"
FT                   /protein_id="BAB48066.1"
FT                   /translation="MSNAATLQNEGGIVMLINRRRVLEVAAALPIISVASSITTSAASA
FT                   AAFDFSSIKTVKQFGAEVIGRADLSRAACEVALKKATRADAKEFAGFELKEAETVIAVL
FT                   KELGTPLPPMGDAAKSALEHIAGSAAGTAFDTAYIGAEYENHAFLRDLAEAYLKNSDPS
FT                   DPSEQHGRQLATVAHWAFWEHTALTQRIARELAA"
FT   CDS_pept        complement(360993..361934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0489"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48067"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48067"
FT                   /db_xref="GOA:Q98MP6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MP6"
FT                   /protein_id="BAB48067.1"
FT                   /translation="MKGSTDLESRLPSAGAYGDRFASYFKLAKASVFKTGSLRTGEIAY
FT                   TETSGYCHKPEPSVPVPPEDAFLVQTQLQDYPNHISWEDGRPGIVGTLRAGHTILRDLQ
FT                   RKPNAIIMGPHHTVHFYIPRATFNTVAEDLEARSISELAYVPAQPIDDDVIRGLIGTVR
FT                   AAIKAPEETNRLFLDHLMMAAAVHLAQTYGGLKPRSLQHRGGLAPWQARLAIELLEGDL
FT                   TGQLPLKDVAAACKLSVSYFSKAFCKTTGLAPHQWLLYRRVERAKSAMINEKTTLAEVA
FT                   LSCGFSDQSHFTRVFVRLVGTSPATWRRARNL"
FT   CDS_pept        complement(362562..362795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0491"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48068"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48068"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MP5"
FT                   /protein_id="BAB48068.1"
FT                   /translation="MDASEMSAIGDTLMRIVTPDMSPKQLVKAAQKAHPKASKKDIARA
FT                   AFFSIIANADQDIGKAKNLQAFAIAERTQPSD"
FT   CDS_pept        362981..363928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0492"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48069"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48069"
FT                   /db_xref="GOA:Q98MP4"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MP4"
FT                   /protein_id="BAB48069.1"
FT                   /translation="MTLWSAPQFHGSATRVARTPASSLWKGEMWFSPEAEARAVLARGG
FT                   NRGGRMDIFGIKGLLICALIFIPFEHLFHERPQKALRKGLGVDLIYVLFNGLIVKVVIV
FT                   LIAANTLEAAAMLVPQSITQAVGGQPVWLQVPEIILITDIGVYWAHRAFHTIPALWKFH
FT                   AVHHGIEELDWLGAFHSHPFDAILTKALSLTPIFFLGFSEASIAVFSVIYFWHTLLVHS
FT                   NVRIPFGPLKWLIASPQFHRWHHANQREAYDKNFAGQLPVLDMVFGTYNATGDKVPEKY
FT                   GVDDPIPSSYFGQVSYPLLSGEKRSNRPVPSTKA"
FT   CDS_pept        364073..364879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0493"
FT                   /product="probable peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48070"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48070"
FT                   /db_xref="GOA:Q98MP3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MP3"
FT                   /protein_id="BAB48070.1"
FT                   /translation="MDHHDDDLAKFEARGATPLPATRDEGQVEHEGAKIWYATFGAGLP
FT                   VILLHGGLGHSGNWGFQVPALLKAGYQVVVIDSRGHGRSSRDERPYKYELMASDVLAVM
FT                   DALRLKKAAMVGWSDGACVALILGMKAPDRVTGVFFFGCNMDPSGAREFEPSPVIDRCF
FT                   ARHAKDYAELSATPDQFDAFVKDVGLMMKTEPNYTATDLARTRVPVAIVQSEHDEFIRH
FT                   EHASYLASSIPGSELITLPGVSHFAPLQRPGQFNSVLLAFLENIHS"
FT   CDS_pept        364947..365645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0494"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48071"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48071"
FT                   /db_xref="InterPro:IPR018679"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MP2"
FT                   /protein_id="BAB48071.1"
FT                   /translation="MNETSLYAPVKRFLESLDFVVKGEIGGCDIVALRGGEPPVVVICE
FT                   LKLQFNLELVLQGVDRATACDEVWLAARMSARGKGRESDARFRNLCRRLGFGVLGVTAN
FT                   DKVEVLVSPAAPEPRRNARRRSRLVDEHQRRRGDPVAGGGSRNPIMTAYRQSALTCAAA
FT                   MADGPKRPRDLKALTPIAPKILQHNVYGWFARVDRGLYDLTDAGRASLVRWPQTPHDEV
FT                   RHEILIASTP"
FT   CDS_pept        365702..366109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0495"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48072"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48072"
FT                   /db_xref="InterPro:IPR009273"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MP1"
FT                   /protein_id="BAB48072.1"
FT                   /translation="MLLVPPMKTLCMMAIASLTLAFPASAMDNALRAGLMKLDPQTRLE
FT                   QRCDAEVLDRITHDDRKFKADRVVAYAFATPEMSADAIRSPGAAFRSKGQWYRLKFKCQ
FT                   TGPDHMDVLQLRYRIGDEIPEADWAKYNLYD"
FT   CDS_pept        366295..366981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0496"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48073"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48073"
FT                   /db_xref="GOA:Q98MP0"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MP0"
FT                   /protein_id="BAB48073.1"
FT                   /translation="MEIFTAAGISALFQVIAIDLALAGDNAIVIGLAAAGLPAAQRKRA
FT                   ILVGIAAATVLRIFFALITQWLLTIGPMLLIAGGLLLLWVCWKMWRELRVSHDEERDAT
FT                   EALSNGDFDKDGVVGGKGSGKTFSQAAWQIVIADVSMSLDNVLAVAGAAMNHPTVLVIG
FT                   LALSIALMGFAASFVARLLHKYRWIAYIGLAIILYVAVKMLLDGAVQQFPEHFAFLAPW
FT                   FGSGGH"
FT   CDS_pept        367148..368461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0499"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48074"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48074"
FT                   /db_xref="GOA:Q98MN9"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MN9"
FT                   /protein_id="BAB48074.1"
FT                   /translation="MSAPRVSFVSLGCPKALVDSERIITRLRAEGYEIARKHDGADLVV
FT                   VNTCGFLDSARDESLNAIGSALSENGRVIVTGCLGAEPDVIREKHPNVLAITGPQAYES
FT                   VMAAVHEAAPPSHDPYIDLLPPQGVKLTPRHYAYLKISEGCNNRCTFCIIPALRGDLVS
FT                   RPAADVLREAEKLAKAGVKELLVISQDTSAYGIDIKYQTSMFGDREVRAKFLDLSEELG
FT                   KLGIWVRMHYVYPYPHVADVIPLMAEGKILPYLDIPFQHASPQVLKNMRRPAHGEKTLE
FT                   RIRGWRDVCPDLAIRSTFIVGFPGETDEDFEMLLDWLDEAKIDRAGCFKYEPVKGARSN
FT                   DLGLEQVPQDVKEARWHRFMQRQQKISATQLAKKVGKRLPVLIDEAHGTSAKGRTKYDA
FT                   PEIDGSVHIQSRRPMRAGDIVTVKIERADAYDLYGSAV"
FT   CDS_pept        complement(368538..369605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0501"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48075"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48075"
FT                   /db_xref="GOA:Q98MN8"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MN8"
FT                   /protein_id="BAB48075.1"
FT                   /translation="MKKLLIALMTTTAALSLAASAEAADKLKACWVYTGPIGDFGYSYQ
FT                   HDQGRLEVEKALGDKVETAYLENVSEGPDADRAFERLAREGCKIIFGTSFGFMDAEVKV
FT                   AKKFPKVMFEHATGYKTGDNLGIYNARFYEGRYVLGQIAAKESKSGVAGYIVSFPIPEV
FT                   VMGINSFMLGAQSINPNFKAKIVWVNSWFDPGKEADAAKALFDQGADIIVQHTDSTAAL
FT                   QVAEERKLHGFGQSSDMIKFAPNAQLTSLTDEWGPYYISRVQAAIDGTWKPDNVWLGIK
FT                   DGAVKLAPYTNMPDDVKALAEATEKKIAGGWNPFTGPIAKQDGTPWLKDGEVADDGTLL
FT                   GMNFYVKGVDDKLPQ"
FT   CDS_pept        complement(369657..370577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0502"
FT                   /product="permease protein of sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48076"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48076"
FT                   /db_xref="GOA:Q98MN7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MN7"
FT                   /protein_id="BAB48076.1"
FT                   /translation="MDITVNILLTIATAATPLLIAAIGELVVERSGVLNLGVEGMMIMG
FT                   AVGGFGAGYLTGSPWIGLLAAIAMGALFSLLFAVMTLSLATNQVATGLSLTLLGLGLSG
FT                   MIGTSFVGQPGVRLPNLDIPGLSSIPVVGKLLFGQDPVFYISIVLTAAVMWFLFKTRTG
FT                   LTLRSIGDSHTSAHALGIKVIRYRYLAVIFGGACAGLAGGHLSLVYTPQWVENMTAGRG
FT                   WIALALVVFASWRPWRVLAGAYIFGAVWIGQLHAQAFGIPVPSQMLSSLPYLATVVVLV
FT                   LISRNKRLTMMNTPASLGQPFVPDR"
FT   CDS_pept        complement(370577..371704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0503"
FT                   /product="permease protein of sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48077"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48077"
FT                   /db_xref="GOA:Q98MN6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MN6"
FT                   /protein_id="BAB48077.1"
FT                   /translation="MRLELVKRPQRSALFSALSPFIAFALTIIAGAVLFALLGVNPLTA
FT                   FRIYFIEPISQVWQLHELAIKAAPLILIAVGLSVCYKANIWNIGAEGQFIFGAIFGSAI
FT                   PVLFPQFEGPLVLPLMLLLGMVGGAAYAAIPAFLKTRFNTNEILTSLMLVYVAQLFLDW
FT                   LVRGPWRDPQGHGFPQTIQFGDSAVLPELMPDAGRANWGFVFALVAAVLIWILMGRMLK
FT                   GFEVRVLGSSPRAGRFAGFGLSRMVFFAFLLSGALAGLAGISEVSGAIGQLQPVISPGY
FT                   GFTAIIVAFLGRLNPLGIIAAGLVLALTYLGGEAVQSALGISDKVARVFQGMLLFFVLG
FT                   CDTLIHYRIRLIGMALTKQEGTAKLDAAPKLKEAR"
FT   CDS_pept        complement(371704..373281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0504"
FT                   /product="ATP-binding protein of sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48078"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48078"
FT                   /db_xref="GOA:Q98MN5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MN5"
FT                   /protein_id="BAB48078.1"
FT                   /translation="MGGTVSANHDGANLLEVRGLTKIFGTLTACDHIDLNIAKGEIHAL
FT                   LGENGAGKSTLVKMLFGSLEPNSGEIFWNGQAVRITSPGAAKKLGIGMVFQHFSLFEAL
FT                   TAAENIALSLDDGSPISSIAAKARALSYSYGLPLDPDSLVGDLSVGERQRIEIIRCLLQ
FT                   TPQLIILDEPTSVLTPQEADKLFETLERLRAEGKSILYISHRLEEVKRICDRATVLRHG
FT                   KVVGHCNPREETAASLARMMVGNEVQAVVRAPVEGIETAQPLLEIRSLTRKPATPFSIP
FT                   LKAISLNVRAGEVIGIAGVAGNGQGEFFESVSGEVLQQDAASVRIRGKDAGGLTITGRR
FT                   LLGAAFVPEERLGHGAAPRMKLSENLLLSRHATDGKAFVGTGGMVKSGAIYAASQRIIE
FT                   AMDVRKSAPDPEAAALSGGNLQKFIVGRELDRRPSVMVVNQPTWGVDAGAAAHIRQALI
FT                   ELSRSGSAVLVISQDLDELFEISDAIAVMHNGELSKPMPIAEATFEKVGLLMGGAEPGH
FT                   AEHTLETA"
FT   CDS_pept        complement(373581..374558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0505"
FT                   /product="quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48079"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48079"
FT                   /db_xref="GOA:Q98MN4"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MN4"
FT                   /protein_id="BAB48079.1"
FT                   /translation="MSKAIRIHAHGGPEVLTYEDADPGQPGSGQILVRHTAIGLNFIDV
FT                   YHRSGLYPPPGGFPLIPGSEAAGVVREVGEGVDWLKPGDRIAYSTNVGAYAEQRVIAAG
FT                   LVVKIPDGISDEQAAAMMLKGMTAEYLLRRTFKVKAGDTILFHAAAGGVGLILGQWAKH
FT                   LGATVIGTASSTDKIELAKAHGFDHVINYREQDFVAGVAAITGGKKCDVVYDSVGNDTF
FT                   PASLDCLKPLGMFVSFGQSSGPIPPFSMSLLAQKGSLFATRPTLFVYNAKREDLDASAA
FT                   ALFDVVLSGAVKIQINQRYALKDAGKAHADLEGRRTTGTTILIP"
FT   CDS_pept        complement(374587..375393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0506"
FT                   /product="phosphatidylcholine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48080"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48080"
FT                   /db_xref="GOA:Q98MN3"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR026027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MN3"
FT                   /protein_id="BAB48080.1"
FT                   /translation="MAARKAAKKLTDRIPRPKKKVTWPQARAFSVHLLTASGSFLAFLS
FT                   LVAASEERWTAMFWWLGLALFVDGIDGPIARKLEVKEILPTWSGELLDNIIDYVTYVLI
FT                   PAFALYQRGFMGEGLSFLSAAIIVVSSAIYYADTGMKTKENFFKGFPVVWNMVVFTLFV
FT                   IEPGQWVSFAVVVVAGILTFVPINFIHPVRVVRLRPFNLTMTLLWCAFGALALAQAALA
FT                   AFYDQIGVLGAQVSTFIKIGITITGLYLACIGGIMQFFPNLGAKKA"
FT   CDS_pept        complement(375417..376034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0508"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48081"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48081"
FT                   /db_xref="InterPro:IPR009758"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MN2"
FT                   /protein_id="BAB48081.1"
FT                   /translation="MSGGSSMTDQGWAMKGELVLSCNCTVFCPCVLSLGNHAPTEGYCQ
FT                   TWAGFRIDAGHFGEVDLSGLNLGLIMEIPGYMSRGNWTAGLFIDKRASIYAVKALTKIF
FT                   TGKAGGTTSLLSILVGKFLPITYETRDKMRIFQIPKIIDGAVTPIAGKDREKDTVITNS
FT                   EYWIAPEIIVARSDKSKMRAFGRNWNFAGRSAEICKLDWRGP"
FT   CDS_pept        complement(376031..376918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0509"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48082"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48082"
FT                   /db_xref="GOA:Q98MN1"
FT                   /db_xref="InterPro:IPR018688"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MN1"
FT                   /protein_id="BAB48082.1"
FT                   /translation="MTGHQDDFSHLDRAGRATADVARNPRLTVNIVVGASILLAWSSLA
FT                   TMAIRGAEARGSAPGDALLRGLPQLPLPDFLEPFFALCLSPAPLDASIVPRALALILMW
FT                   FLMAIAAMLPSAAPMIRTYCEIADTARIKGEPVVHPLVLVAGYLGVWLAASMLFTALTL
FT                   CVHAFAASGEIYDPLLGVAGALALLVAGLYQFSGLKEACLKKCRNPFSILFSNWSAKPV
FT                   RVFRLGAAQGIWCLGCCWALMLVMFAVGVMNIFWMALIGLFTLIEKQTPGRLPTRLAGA
FT                   ILLVWAAALLVVSL"
FT   CDS_pept        376907..377143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0510"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48083"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48083"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MN0"
FT                   /protein_id="BAB48083.1"
FT                   /translation="MAGHDTRMSRIAALINPHELTYMLLDWQVWWPASHRKPETDLGAS
FT                   GNSANTDCRNRSGGADRGAGFRRCRLPGDAGRA"
FT   CDS_pept        377031..378245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0511"
FT                   /product="probable 2-octaprenyl-6-methoxyphenol
FT                   4-monoxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48084"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48084"
FT                   /db_xref="GOA:Q98MM9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MM9"
FT                   /protein_id="BAB48084.1"
FT                   /translation="MEHQETARILIAGTGPAGLIAALAFADAGFPVTLVGPEASAPDGR
FT                   TTALMNPALKVLERLDVLEAIRPKAAPLKVMRIVDATSRLIRSPVVTFRASEIDEDQFG
FT                   LNLPNSVFGPALADKVAAHPGIEWRRSMVKTWHLDADRAHAVLADGSEVGASLAVAADG
FT                   RQSPAREAAGISTGSHAYPQAALVLNFGHRSEHAFTSTEFHTETGPFTQVPLPGNRSSL
FT                   VWVVKPETAKELAALDDATLSLRVEQQMQSMLGRVTVEPGRQIYPLSTVTPLRFARDRV
FT                   ALVGEAAHVFPPIGAQGLNLGIRDIDDLVGIAKENGGDPGAAKALAAYDFKRRPDILAR
FT                   SSAVNLLNLSLLSDMLPAQMARGAGLGVLGGFAPLRAFFMREGLRPGSGFAALAGGLRK
FT                   PMRRQ"
FT   CDS_pept        378193..378717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0512"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48085"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48085"
FT                   /db_xref="GOA:Q98MM8"
FT                   /db_xref="InterPro:IPR011722"
FT                   /db_xref="InterPro:IPR036623"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MM8"
FT                   /protein_id="BAB48085.1"
FT                   /translation="MVLQHSQAAYENPCGGSSDLADFIATSRHQSKPLRRILRSLKALK
FT                   RFGIELTRSLRQIKSRNSVVSTMKTAKFAIGQVVRHRLFPFRGIIFDVDPQFANTDEWY
FT                   EAIPADVRPRKDQPFYHLLAENSETEYIAYVSEQNLLEDRSGEPVRHPQIKEMFDKRPD
FT                   GRYEPKRQSRH"
FT   CDS_pept        complement(378826..379464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0513"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48086"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48086"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MM7"
FT                   /protein_id="BAB48086.1"
FT                   /translation="MHDMMSLNSNAYRLSVMAAGVVGFLGAGLPSASAQQQQQIPQGWF
FT                   KACTKQEDVDICNVQNIVTAGNGQLVTGVSLIELKGKVNRKVFQVTVPTGRLVPPGIGL
FT                   QIDTGKAVKLDYVICFPDRCVAEVPLTDQLVASFKKGQGITLTSINFQNQANPIKIALQ
FT                   GFSGAYDGPPLQQSDIEDRQKKLQDFVAKNNQDFAKKLKDEQDKAKTAN"
FT   CDS_pept        379691..381511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0514"
FT                   /product="probable binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48087"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48087"
FT                   /db_xref="GOA:Q98MM6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MM6"
FT                   /protein_id="BAB48087.1"
FT                   /translation="MGRVLVWLITAISLFTLSPRPAMSEPKHAIAMQGEPALPPDYTHF
FT                   DYVNPDAPKGGSITYCVVGSFDNLNPFILKSLRTTARGMMDLTYGNLVFEPLMQRNYDE
FT                   AFSLYGLLADSADMDSERKSIEFHLNPNAKWSDGEPVTPEDVLFTYDVFTDKGRPPYNA
FT                   RMSLIAKLEKTGDHSVRFTFNDKANRETPMIIALTPILPKHAFDKETFDKTTLKPLIGS
FT                   GPYTIAQVAPGQRIVFKRNPDYWGKDVPAKRGFDNYGQITIEYFLNANAKLEAFKKGLC
FT                   AIDDDGDPVKRERDLDFPAFHRGEVVSETFDTGIPPVVTGFLFNTRLPKFSNPVVRRAL
FT                   GMLYDFEWANKNLFGGKYTRTMSYWQNSELSALGHPADDREKALLAPYPGRVPPDVMDG
FT                   TWKPPVTDGSGQDRKVLKAAFDLLKSIGYHVQDGTMLDPDGKPFGFEILTASQDEERLA
FT                   GIYQRTLEKIGINVSIRSLDGDQIQSRKQRFDFEALIGSSGFNNSLSPGFEQLGRWSSE
FT                   AAKAEGSFNLAGVADPAVDAAIEAMLRARSKEDYVAAVRVLDRLLISGNYMVPMQYNTQ
FT                   QWLAYWNYLEHPKKTPIFGYQLPTWWRKPN"
FT   CDS_pept        381528..382208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0515"
FT                   /note="similar to FrnE protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48088"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48088"
FT                   /db_xref="GOA:Q98MM5"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MM5"
FT                   /protein_id="BAB48088.1"
FT                   /translation="MSEANAVTVDVVSDVVCPWCFIGQKRLDKAVAAAGDVDVHIRWRP
FT                   FQLDPTIPPQGKDRREYMLAKFGSDERIREIHARIEPLGEAEGISFAFDAIKVAPNTLD
FT                   AHRLIRWAGAAGEAVQNRLVRRLFQLNFEEGVNIGDHAVLVEAAREAGMDASVVATLLP
FT                   TDADVEAVRTEIATASRMGISGVPCFLLEGKYAVMGAQDVDTLADAIRQVAAAKARGEL
FT                   DKVG"
FT   CDS_pept        complement(382242..382736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0516"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48089"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48089"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MM4"
FT                   /protein_id="BAB48089.1"
FT                   /translation="MLPTPMVVQQESFPMFTRATASAAFILIAWLSLFTWGSLANAAEQ
FT                   SIPASAEGQIEFNTPSDNIGCIYTPKGGTNTYEPQDGGPELSCSRVEPSYITIILGPKG
FT                   PATLIKNPGEQPCCSDVTRLAYGNSWSAGPFSCQSSTKGLICAASNGHGFFISKAKVTV
FT                   K"
FT   CDS_pept        383247..385232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0519"
FT                   /product="ATP-binding protein of ABC-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48090"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48090"
FT                   /db_xref="GOA:Q98MM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MM3"
FT                   /protein_id="BAB48090.1"
FT                   /translation="MIRIGRRSQESVPDRLHRGPAGRSHLTPVSSMRSFWGLMKAYWFS
FT                   ERWKEAWTLTVVIALLTALSSKAGVWFALALGELGNSIAFFHDAANTSPLQAILTNAGI
FT                   LVLLVVLKDAGFTGVRGLVSATLHRKWRGWLNSQFNKALLDGNHTHFHAQHGSAAGGIV
FT                   APDNIDQRIQESIKDMTGGAIGLAMGVLGVATSLYFIGENLIGSSVEVKGLEFLGGYGS
FT                   AVLAFLAVAIYVPLNTWIAVKLGRLLERLNIRMQQAEGSYRSELTTFLRRSFHVAASHG
FT                   EDVQKSMHDKLYVDIDKTWGKLNVVNNGYTSFELIYNFLGARIVAYGPGLVSFIHNRLD
FT                   YKGYITGSEMVAQLISQCSWFIHVMPAIATLRANSQRVTELANAIENVQHPQAFYSQTG
FT                   QSDFHYASQNPVFGLTIQKLELAHQGEDATPFLSAANLRFRRGEWTFLKGESGCGKTSL
FT                   IKAINGLWPYGRGTIVFPDGVKSFYAAQEVKLQQVSLKQLVCLPGSEHDHGDAQVASAL
FT                   HKAGLGDFIEHMANESREGKSWDQVLSGGQKQKLVVARIILQQPGLLFLDEATGALDPE
FT                   GKIAFHQAIKDNCPDVTVISVMHEAVAPRSAAGTEFYHSIVLIADGVATKKPLTPTLPV
FT                   ELTTILTQPRPVEDKWLRFSRRLKQK"
FT   CDS_pept        385505..386869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0521"
FT                   /product="Mg2+ transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48091"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48091"
FT                   /db_xref="GOA:Q98MM2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MM2"
FT                   /protein_id="BAB48091.1"
FT                   /translation="MNDFSPVADDEAVAIARILANDHVADVVEALNHESRETATDLLCA
FT                   VPFERLVEIFDQPELDGAPELADALPRAKASKLLTAMSVDRAADILRELDEPARSELLG
FT                   ALAPPLRATLLSILGYPEGSAASIMTTEFVSVPSDWTVGRTLDYIRKVERTRETVYAIY
FT                   IVDPQTHLLVRSTGLRRLITGEPDDPVLSVAPDRVPVTVTPLTDRETLAQTISKYDLLA
FT                   VPVVDHGKILGIVTIDDIIDTMIEETTEDVHRFGGMEALDEPYMKMSFLAMIQKRAGWL
FT                   CALFLSEMLTANAMQSYESELERAIVLTLFIPLIMSSGGNSGSQATSLVIRAMALREIG
FT                   LGDWWRVALRELPTGLVLGSILGVVGVCRITLWQYFGFYDYGPHWPLIAATVGAALVGI
FT                   VTFGSLSGSMLPFALKRVGFDPASASAPFVATLVDVTGLVIYFSVAQVILRGTLL"
FT   CDS_pept        complement(386976..388367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0523"
FT                   /product="glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48092"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48092"
FT                   /db_xref="GOA:Q98MM1"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006324"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MM1"
FT                   /protein_id="BAB48092.1"
FT                   /translation="MAGYDYDLFVIGGGSGGVRAARVAATLGKRVGIAEEYRFGGTCVI
FT                   RGCVPKKLYVYASQFPEHFADAAGYGWTVPEASFNWQTLVANKDREISRLEAIYKKNVE
FT                   GAGGETFPSRAMIVDPHVVHLLDDDRTVTADQILIATGGRPAAHPALPGHEHCIFSNEA
FT                   FDLKELPKAIMIEGGGYIAVEFANIFHGLGVDTTLVYRGKEILSRFDMDLRRTLHETME
FT                   KKGIKILCHAVSERVHKRPDGRLDALLTSGQTLTVDQVMLAIGRIPNTENMGLEGIGLE
FT                   MTQAGAIKVDEYSRTNIDNIWAIGDVTNRVQLTPVAIHEAMCFVETAFKGNPTAPDHDT
FT                   IATAVFSQPEIGTVGLSEDEAVKRFADVEIYRASFRPMRHTLSGRDEKMLIKLVVDGAS
FT                   RKVLGAHILGPDAGEMAQLLGIPLKAGLSKDDFDRTMAVHPTAAEELVTMYKPTYRVKD
FT                   GQRVQ"
FT   CDS_pept        complement(388489..389160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0525"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48093"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48093"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MM0"
FT                   /protein_id="BAB48093.1"
FT                   /translation="MPPENQGVLPTMMLHNRVRGLCVVLAASAVFAFSSPAFSQDVTES
FT                   HLKAARAAVAAIHATDPFDNILPQAAAALESQLIQKNPDMQELIGKTINEKALALASRR
FT                   ADLEKEAALAYAKVFSEKELNEIAAFYSSDSGKKLLDSGPTVTRDLVKAADIWQNGLAR
FT                   DLAQQVGETLAAAAKAKAPAAPAPADGAAPADNAAPADGAAPADGSAPADGSAPADGTQ
FT                   N"
FT   CDS_pept        complement(389114..389845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0526"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48094"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48094"
FT                   /db_xref="GOA:Q98ML9"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98ML9"
FT                   /protein_id="BAB48094.1"
FT                   /translation="MDARQLKVEAARAALAHVSDGMRLGIGTGTTAEEFVRLLADKVAT
FT                   GMTVIGVPTSERTAALCRELGVPLSTLEETPELDLTVDGADEVDPELTLIKGGGGALLR
FT                   EKIVAAASQRMIVIADRSKMVETLGRFPLPIEVNQFGLRATEIAIAKTAADLGLSGPIT
FT                   LRMTGGQAFVTDGGHFILDASFGRIPDTRALSNALHAIPGVVEHGLFIGLASTAIIAGG
FT                   DGIQTVHAARKPGSSTNHDVA"
FT   CDS_pept        390028..390711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0528"
FT                   /product="probable phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48095"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48095"
FT                   /db_xref="GOA:Q98ML8"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98ML8"
FT                   /protein_id="BAB48095.1"
FT                   /translation="MSRPIIVFDLDGTLIDTAPDLLDSLNHSLAASELTAVDEAGFRRF
FT                   VGHGGRVMIERAHAAQQRSLDVAEHDRLLKLFLDHYTDNIPGKSRPYPGVIEAIARFEK
FT                   AGYLLAICTNKYEANSLALIEALGLTRHFAAIAGQDTFAFRKPDPRHLTETIRLAGGDA
FT                   HRALMVGDSQTDIDTAKAAGIPVVAVDFGYTDRHVREFEPSAVISHFDALTVELAERLI
FT                   RAAGH"
FT   tRNA            390847..390918
FT                   /product="trnV-CAC"
FT   CDS_pept        391082..391339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0529"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48096"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48096"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ML7"
FT                   /protein_id="BAB48096.1"
FT                   /translation="MSRFLVATSVAVFLAAGPALAADDKPLPPPNAKKLSEILAKVEQR
FT                   DGFRYVKEVDWDNGAYTVTYYTSDKAKVEITYDPVTAEPK"
FT   CDS_pept        391439..392227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0530"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48097"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48097"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ML6"
FT                   /protein_id="BAB48097.1"
FT                   /translation="MICTPGVGSAVGLGAVMRFSVRTDVILVLAVILAGGMLATPSARA
FT                   DGPSFDCAKASLPAEKAICADPQLSAIDLLVAKAYKGFEPAFGGDKRKIARGLIADRNA
FT                   CKSDTACIVSALNNALQTYGNAPSWVQDYNIALIGKKALDTAARNPGNNDQPLPSAVGQ
FT                   CASTHIKTLTARLGDAPLETASPDAGSAATFTNGGGAVSYDREPGLAASKVGEPVVMCL
FT                   IAVPRDCPKGDDRGRVYYSIDLVAKGSWALPDSEHLCGGA"
FT   CDS_pept        392340..392822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0532"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48098"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48098"
FT                   /db_xref="GOA:Q98ML5"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ML5"
FT                   /protein_id="BAB48098.1"
FT                   /translation="MGMATAKYVMKRILMMLAGYLVAVLVGLVAVAAIYAALSSLPNAP
FT                   AYFDVMGVSPIAVLVVPPLGMFVYFLTIVVTGLQTLIFALIAEFFSLRNALMHMVFGAA
FT                   AAAGGFFLIWPVPAEDMDPERWADIGIIAAAGLVAGLIYWLIAGREAGFRRPLSQI"
FT   CDS_pept        complement(392827..394707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0533"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48099"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48099"
FT                   /db_xref="GOA:Q98ML4"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ML4"
FT                   /protein_id="BAB48099.1"
FT                   /translation="MKFLGKKATAMPLVAIAATLALGAPQAGAQGLFDMLFGGGVRHEP
FT                   QGEFPPPPKHKPKVPAGGGGGAKISGPSYYTYKADKLIRVDFSTLSAAPQPATPQDAAF
FT                   VPSATGAAFHDAIAGLSDYELYAEPDIAKALIAYYSANPDFIWVNGTSPNNRAQDAVRV
FT                   LGEAASYGLTPADYTVDVPATTSASTDDAAKLRELVRFEMALSARVLRYAHDAQNGRVE
FT                   PNRMTGYYDFPAKPLDMVGVLKTLAHTQEVRTYLESRHPQNAEYQALRVELEALQASAE
FT                   NEIVVDPKLLLKPGETSPELPKLLSLIARNLDDNMGGTYGELLSRLASSEVYVPELVPL
FT                   IKAVQVKEGMKGDGVIGPRTVALLAGTSKADRLLKVQVALEELRWLPSDLGSPRVFINQ
FT                   PAFTASYIDNGEEKLKTRVVVGRVTNQTAFFYDQIKQVDFHPYWGVPQSIIVNEMLPRL
FT                   RSDPGYLDRAGYEVTDSRGKRIPSSAVNWGAYGANIPYSVRQQPSEANALGELKILFPN
FT                   KHAIYMHDTPQKSFFKQDMRALSHGCVRLQDPRGMAAAVLGTSVDYVAEKLKHGHSTED
FT                   VTRKIPVYVAYFTAWPDMSGKVEYFSDVYDRDSRLKQALDATEAVRSPSS"
FT   CDS_pept        complement(394918..395664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0534"
FT                   /product="probable short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48100"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48100"
FT                   /db_xref="GOA:Q98ML3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ML3"
FT                   /protein_id="BAB48100.1"
FT                   /translation="MSSSNLNGKAALVTGGSRGIGAAIARRLAADGADVALTYVHGEEQ
FT                   ARSVVAEIEAKGGRAIAIRADNRDAEAIDRAVDETAAAFGRLDILVNSAGIWRAAPIDT
FT                   LSLADFDETMSVNLRAPFIASKAAAAHMGEGGRIISIGSNLAERVTDTNLGAYSASKAA
FT                   LVGLTKALARDLGSRGITANVVHPGSTDTDMNPADGPHAEHQRQKMATPRFGKADDIAG
FT                   MVAWLAGPEGRFVTGAALTIDGGANA"
FT   CDS_pept        395765..396379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0535"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48101"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48101"
FT                   /db_xref="GOA:Q98ML2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ML2"
FT                   /protein_id="BAB48101.1"
FT                   /translation="MSDRGRPRTFDRTAALRRAMELFWAKGYGGTSIAELTTAMGINSP
FT                   SLYAAFGSKEALFLEATEYYTQAEGTEIWAALDEAPTACQAIENFLRRTAKAYSQTDRP
FT                   QGCLIALGALHEDSSSGAICTDLRRRRAENLTTLRKRLERGVAEGELPADFDCDAVATF
FT                   YATVQHGMSIQARDGASCLALMATVAGAMAAWQVLAGPDRA"
FT   CDS_pept        396438..396833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0536"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48102"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48102"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ML1"
FT                   /protein_id="BAB48102.1"
FT                   /translation="MKKGYRELLDEANAEIEVVSPEEAAGLLEDEGTIFVDLRDPREVE
FT                   RDGGIPGAKHVTRGMLEFWIDPESPYHKPFFASGKSFVFFCAGGWRSALATKTAQDMGL
FT                   VPVKHILGGYTAWKAAGLPVEPGEKKK"
FT   CDS_pept        complement(396903..397649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0537"
FT                   /product="probable hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48103"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48103"
FT                   /db_xref="GOA:Q98ML0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ML0"
FT                   /protein_id="BAB48103.1"
FT                   /translation="MTEARHHRLKTATGCVMVHEFRPEPGRAALGTVLVVHGWRSRTEY
FT                   MRALIEGYRAAGYRVVSLDLPGHGHSQGRHLNMANAVDAVRVAGEWFGPFVAAVGHSFG
FT                   GAVAANAIAGSIKNIPPLAAGRLVLIAAPSSLPVIFADFSRMLNVGPRSQVAMADCVQH
FT                   LSGRPLHEFTGDRQLAQAPVPTLVIHAQDDREVPAEHAKRYAGAGGHVRLHWADGLGHR
FT                   RILADKGVVERAVAFVAEHREPSRLH"
FT   CDS_pept        397862..398314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0538"
FT                   /product="probable transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48104"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48104"
FT                   /db_xref="GOA:Q98MK9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MK9"
FT                   /protein_id="BAB48104.1"
FT                   /translation="MNNKQELPWDNPRFRNWVAVARASHVLERTLAVKLAPLDLKPAQL
FT                   DVLMNLYRHPGMSQHDLARKLLVGRSNITMLLPQLETRGLLRREGDEKDKRILRLALTE
FT                   AGEALLMQALKVHMALIEKAMSQSTPEQCDMIGEQMRKIYEVLKEA"
FT   CDS_pept        complement(398331..398942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0539"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48105"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48105"
FT                   /db_xref="GOA:Q98MK8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024029"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MK8"
FT                   /protein_id="BAB48105.1"
FT                   /translation="MPVITTVEQLEALYGVPGEASLVKELDHVIPEYAAFIAASPFVAL
FT                   ATSGPEGLDCSPRGDLAGFVRIVDPKTVMMPDRRGNNRADSLRNIIRDPRLGLLFLVPG
FT                   SGTTLRINGRAHITTDAELCASFMVDGKAARSVTVIDVDSVYFQCARAIVRSELWNPAK
FT                   HVDPKSLPTPGKILEITSRKNIDGETYDREWPERAKKTMW"
FT   CDS_pept        complement(399006..399359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0540"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48106"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48106"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MK7"
FT                   /protein_id="BAB48106.1"
FT                   /translation="MTAPKELRVSKDRKLLSVTFPNHQPFELPAELLRVASPSAEVQGH
FT                   SPDQRVTVPGKRNVAILKIEPVGNYAVRITFDDFHDTGIFTWNYLHTLGHEKDERWNAY
FT                   LAELAEKGLSRDR"
FT   CDS_pept        399557..400552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0541"
FT                   /product="molybdopterin biosynthetic protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48107"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48107"
FT                   /db_xref="GOA:Q98MK6"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MK6"
FT                   /protein_id="BAB48107.1"
FT                   /translation="MNMIDPFGRTISYLRVSVTDRCDFRCTYCMAEDMAFLPKKDLLSL
FT                   EELDRLCSVFIEKGVRRLRLTGGEPLVRKNIMHLVRQLSRHLDSGALEELTLTTNGSQL
FT                   SRFAAELADCGVKRINVSLDTLDADKFHQITRWGHLDKVMQGIDAAQAAGLKVKLNAVA
FT                   LKDFNDAELPDMMRWAHGRGMDLTVIETMPMGEIDADRTDQYLPLSLLRASLERQFTLT
FT                   DIPFKTGGPARYVHVAETGGKLGFITPMTHNFCESCNRVRLTCTGTLYMCLGQEDAADL
FT                   RAPLRASEGNELVADAIDEAIGRKPKGHDFIIDRRTSRPSVSRHMSVTGG"
FT   CDS_pept        400609..401103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0542"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48108"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48108"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MK5"
FT                   /protein_id="BAB48108.1"
FT                   /translation="MLRLYRIGLSALTTVLSLATPVTTTANAKPFTYVNARFGTVCTFP
FT                   DEIFTDRQPEPENGDGQVWLSADGASLTCSGILNVDDDTPKSFVADEKASKEPGYTVTY
FT                   SKTGKNWAVLSGMKDGNIFYERRLFGRDGVIRTVWIDYPPALKAKYDPLVGAIAASLKG
FT                   Q"
FT   CDS_pept        401224..401583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0543"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48109"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48109"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MK4"
FT                   /protein_id="BAB48109.1"
FT                   /translation="MRKLVLSLALLGLTALPAAAQSIGGTYTVAGTNFDGSKYDGEATI
FT                   TLTSGTTCAIHWETGGSSSDGICMRNDDAFSAGYVMGKDIGLVVYKVEDDGSLHGLWTI
FT                   AGKEGNGTEVLTPKK"
FT   CDS_pept        401671..402684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0545"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48110"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48110"
FT                   /db_xref="GOA:Q98MK3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MK3"
FT                   /protein_id="BAB48110.1"
FT                   /translation="MTNAPVLAQPFAIAVSWRAVTGLLPKQPVDALPLSPNLRGALFMM
FT                   VAMVGFTLNDAITKYSSQSMNMAQVMLIRGAFASLFVGLLAWQRGALLRPGLMLQPLVA
FT                   MRVLGEAGATVSFLVALAHLPIGSVSAVLQALPLAVTMGAALFFGEAVGWRRWLAIAAG
FT                   FAGVMVIVRPGFDGFTIYSLWALASVACCTVRDLATRRIPQTTPTMLVSTATALAMTVV
FT                   GAVLLVPMGGWTPMTGKSTALLALAAVLVLIGYQFIIMAMRSGEISFIAPFRYTALLWS
FT                   ILLGLIVFGDIPDMPMVVGATIVVGSGLYALYRERVVGRRRIVAETTGPAMAPDGI"
FT   CDS_pept        402728..403354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0547"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48111"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48111"
FT                   /db_xref="GOA:Q98MK2"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MK2"
FT                   /protein_id="BAB48111.1"
FT                   /translation="MRRDIAGIVLAGGQSRRMGGGDKSLLPLGSGSVLDQILSRFGPQI
FT                   EILALSANGDPERFSRFGLPVLADTVEGFAGPLAGILTGLEWAIAGTPCKAVVTAAGDT
FT                   PFLPLDLVDRLAAAARDHPGSIAVASSAGRRHPTFALWPTECRDALRHFLVDEDNRRVS
FT                   DFIERHGHVEVEFRFVQSAGLDPFFNINVPDDLAQAARLLQSMTS"
FT   CDS_pept        403351..403854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0548"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48112"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48112"
FT                   /db_xref="GOA:Q98MK1"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MK1"
FT                   /protein_id="BAB48112.1"
FT                   /translation="MNIFGITGWKNSGKTTLTEKLVAELVRRGWKVSTVKHAHHDFDID
FT                   KPGADSFRHRQAGATEVAIVSGNRWALMHELRGEDEPPLESILSRLAPCDIVLVEGYKR
FT                   ESHRKIETRRLEAKDRTPLSAGDPNIVAIAADFAVTDKSLPAFDLDDVKSIVDFIERTT
FT                   GLVA"
FT   CDS_pept        404013..404798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0549"
FT                   /product="probable amino acid binding protein of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48113"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48113"
FT                   /db_xref="GOA:Q98MK0"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MK0"
FT                   /protein_id="BAB48113.1"
FT                   /translation="MRIALRIALAASAALLTLGVAQAQEKTLRIGTEGAYPPFNNLTSD
FT                   GKLVGFDIDIAQALCDQMKVKCTFVAQDWDGIIPALQAGKFDAIVASMSITPERKEKVD
FT                   FTHKYYNTPSALAVPKDSTLKGVTKADLAGKTIGVATTTTHFNYASKTYTDSTVKGYPS
FT                   SPEEQADLANGRLDAIEDDIVVLQQWLDSPDGACCKILGQPSPQPVEIFGPGAGIAVRK
FT                   GETDLVNKLNEAIDAIRANGKYKEINDKYFKFDVFGAES"
FT   CDS_pept        404877..405596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0550"
FT                   /product="probable permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48114"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48114"
FT                   /db_xref="GOA:Q98MJ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MJ9"
FT                   /protein_id="BAB48114.1"
FT                   /translation="MPAQSIWTLLSWGPDGWSDDIAYGVIVTVLLALATLPIGLTIGFF
FT                   IALGKQSEEPSLRLAANIYTTVFRGLPELVTLFLFFFGMPILLQHLIRYFRPEATIDVN
FT                   SFVAGMIVLSLIFSSYASEVFLSAFRAIPKGQYEGGYSIGLSKWQTMRLVILPQLLRIA
FT                   FPGLENCWLSLLKDTSLVSVVGLAETLRNAGVAARVTKHSFLFYSIAALVFLGLAVVSS
FT                   FATGAILRSLGKREAQR"
FT   CDS_pept        405593..406414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0551"
FT                   /product="probable permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48115"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48115"
FT                   /db_xref="GOA:Q98MJ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MJ8"
FT                   /protein_id="BAB48115.1"
FT                   /translation="MSATAAMVERPPPRTRGWPRPRIVGYALVCLWIAFGLGIVGYLVF
FT                   AWNPVFFAKYAPAYLSGLGVTLSLVAISMVLGAVLSMPVAYGRMSRNRILSGLAYCYVY
FT                   FFRGTPLLVQTFLIYYGLGSFRPELQMIGLWDFFKDAFNCGVFAFALNTAAYQAEILRG
FT                   AIESVHRGQWEGAASLGLHKLQTLRKIILPQALIVALRPYGNELILMVKASAIVAIITV
FT                   YDLMGNAKLAFANSFDIQAYIWVALVYLVMVELLRHAIEWIERRITIHLKR"
FT   CDS_pept        406521..407390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0552"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48116"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48116"
FT                   /db_xref="GOA:Q98MJ7"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MJ7"
FT                   /protein_id="BAB48116.1"
FT                   /translation="MASVAFLGLGVMGYPMAAHLRNKGDHDVTVYNRTKTKAEQWVDQH
FT                   GGSLAVTPADAAKDKDFVFSCVGNDDDLRSVTTGPEGAFKSMKKGSVFIDNTTASAEVA
FT                   RELAAAAEAGGFSFLDAPVSGGQAGAENGVLTVMVGGDQAAYDRARPVIDAYARMVGLM
FT                   GSAGAGQLTKMINQICIAGLVQGLSEGIHFGKKAGLDIEKVIEVISKGAAGSWQMENRH
FT                   KTMNAGKYDFGFAVDWMRKDLGICLAEADRNGAKLPVTALVDQFYKDVQAMGGKRWDTS
FT                   SLLARLEK"
FT   CDS_pept        407397..408101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0554"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48117"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48117"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MJ6"
FT                   /protein_id="BAB48117.1"
FT                   /translation="MSLPAPDWTAHDIIAHLRSIGTDENRAGMARFGINIATALGVGNT
FT                   DLRPLARKLKRNHERSLALWASGIREARLVAAFTGESKRITIEECRRWAGDFNSWEVVD
FT                   TVSDLFVDTPFWRALIEEFAGDEREFVRRTAFAMLAWAAVHLKKEPDATFLSYLPLIEV
FT                   HAGDERNFVRKAVNWALRQIGKRSMSLHTPALALAQKLADSPDKTARWIGKDAVKELSD
FT                   AKTLERLASRKI"
FT   CDS_pept        408061..408639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0555"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48118"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48118"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MJ5"
FT                   /protein_id="BAB48118.1"
FT                   /translation="MPKRSNASPAEKFDLANIRFIEVTPATRGSFETLFEQPGAPKYCW
FT                   CMAWRHSGREHIQNDEKKRQMMARIDAGAPVGIVAEIDGKSIAWCSVAPRDTYRRLSKR
FT                   QDDSETGVWSIVCFYVPRALRGGGLASALLDAAIDHAFAKGARIIEAYPVAEASPSYRF
FT                   MGFRDMFASRGFREVGMAGSRRHVMRLEH"
FT   CDS_pept        408685..409152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0556"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48119"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48119"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MJ4"
FT                   /protein_id="BAB48119.1"
FT                   /translation="MNHFTSITGLAAALSLCAAGASAETMHIFWKDLRPATQLAGYALP
FT                   VDRDGDLVYQFLLVPWTGACSHMPTPPPNQIVLVTPAHPYKMSQAYQSVAVTGALKPDI
FT                   EKSQLFILDGVSVIQSGYSVRKADVIGVDTVPDTVTLPVNSPWSFLNKKKN"
FT   CDS_pept        complement(409167..409658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0557"
FT                   /product="transcriptional regulator, probable glutamate
FT                   uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48120"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48120"
FT                   /db_xref="GOA:Q98MJ3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MJ3"
FT                   /protein_id="BAB48120.1"
FT                   /translation="MDRLDRKILRLLQEDATLAVADVAKKVGLSTTPCWRRIQKLEEEG
FT                   VIKRRVAILDHEKVNVRVTVFVSIRTNSHSHEWLRRFSEVIQEFPEVVEFYRMSGDVDY
FT                   LLRVVVPDIAAYDAFYKRLIAKIEIRDVSSSFAMEQIKYTTEIPLDYMVLDKESGANAA
FT                   "
FT   CDS_pept        complement(409766..410440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0558"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48121"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48121"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MJ2"
FT                   /protein_id="BAB48121.1"
FT                   /translation="MHQRAALASGDLQPAECGRLSVELDSLAATVRACRICVENPVGKP
FT                   LPHEPRPVLRPSSSARILIASQAPGTKVHLSGMPFTDASGDRLRSWLGVTSDEFYDIEK
FT                   FAIVPMGFCFPGQDAKGGDLPPRRECAPAWRAPLMALMPRIDLVLTIGIYAQSWHMAAA
FT                   RRPSLTETVMDWRAIWENSVGAKVLPLPHPSWRNSGWLKQNPWFEMDLLPFLRSEIRYR
FT                   LG"
FT   CDS_pept        complement(410380..411024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0559"
FT                   /product="glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48122"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48122"
FT                   /db_xref="GOA:Q98MJ1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034345"
FT                   /db_xref="InterPro:IPR034346"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MJ1"
FT                   /protein_id="BAB48122.1"
FT                   /translation="MYRLGRKGRIDMKLFDGGRAPNPRRVRVFLAEKGIAVPLVSVDMG
FT                   ALEHKGQTVSSRNPLQRLPVLELDDGTVITESVAICRYFEELHPEPALFGRGALGKAQV
FT                   EMWQRRMEFKLLSCVAQAFRHIHPAMKEWEIPQIPEWGEANKPKAIEFLKLLDGELANR
FT                   EFAAGDSYSIADITGLIAIDFMKPARIKVPEECTNVLRWHQAISSRPSAAA"
FT   CDS_pept        complement(411026..411577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0560"
FT                   /product="succinoglycan biotynthesis protein; ExoI"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48123"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48123"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MJ0"
FT                   /protein_id="BAB48123.1"
FT                   /translation="MLDYGLTIIILGLLILLAARLDRVETRQTQGAAIINDGDSITLGT
FT                   ERIRMRGIDAPEYTQTCRRNGVDYACGTLARQSLVRLIAGRPVTCSGWQRDRYGRLLGD
FT                   CKAGGTDLNRAQVEAGWAVAFGDFESEEATARAAKVGIWAGTFDQPQDWRDSHHGEVVE
FT                   RKHGTLASIGDAVREIFRFW"
FT   CDS_pept        411726..413246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0562"
FT                   /product="histidine kinase sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48124"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48124"
FT                   /db_xref="GOA:Q98MI9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MI9"
FT                   /protein_id="BAB48124.1"
FT                   /translation="MPLQRSNTADKFIVDRRKPHRNSDVARAVRKTRDRLSQQAGNPDF
FT                   DRELLKLHAGAMTSGAVVIPLLVLAIAAAGWLAGVGNEIGLWALFTLTCYTIVAFMARR
FT                   IERTEASELNPLQTRREFLVGHFLCGLGWGWFVVLGCGACAVDQFPVVKAVVLLLAMAG
FT                   TALMASSLSGALLATFAVPVALYAYVGTRLWMPVEAMMAGLLVLSLPFFVYVARQLNRA
FT                   SLMLLSFRSEKDALIAELETAKSMSDEARRRAEDANLAKSRFLASMSHELRTPLNAILG
FT                   FSEVMANEVLGPMSNPTYRDYAHDVHDSGQHLLDLINEILDLSRIEAGRYQLNEEPVML
FT                   LNIVEDCCHMMELKARNKDIRVVQDFEQTLPRLFADERAVRQITLNLLSNAIKFTATGG
FT                   EIRVRVGWTAGGGQYISVKDNGPGIPEDEIPVVLSAFGQGSIAIKSAEQGTGLGLPIVQ
FT                   GLLAMHGGEFELHSKLREGTEAIAIFPLSRVMEELPALPTAAVAARRR"
FT   CDS_pept        complement(413279..414277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0563"
FT                   /product="nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48125"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48125"
FT                   /db_xref="GOA:Q98MI8"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MI8"
FT                   /protein_id="BAB48125.1"
FT                   /translation="MTSALPFDDFRNLLDNMPAADLKAEARVRALFAKADKPAHSLGRI
FT                   EDIAAWLAAWSGRSPPAVTRPLMAVFAGNHGVTRHGISPRPVAATANAVELCAAGGAAI
FT                   NQICIAYDLGLKVFDLALHIPTGDIAEDAALDERGCAATMAFGMEAIAGGTDLLCLGDL
FT                   GVGNSTVAAALFAALFGGRGADWVGPGSGADAAMQARKADVVDAALAFHHGHLDDPLEV
FT                   LRRVGGREFAAIAGAILAARMQKIPVLLDGFATTAAAAVLYAANPGALDHCLLASLSPE
FT                   PAHTRAAELLGFRPLLDLGIGHGEGAGAALGAGLVKAAALTSSGMAAAVRI"
FT   CDS_pept        414475..414705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0564"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48126"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48126"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MI7"
FT                   /protein_id="BAB48126.1"
FT                   /translation="MTAIESPCILVCSIDMKTGFCFGCGRTREEIGAWMGMTPETRRNV
FT                   MAELPARLETVERRPRRETRRTRMARERDAL"
FT   CDS_pept        414817..415524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0565"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48127"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48127"
FT                   /db_xref="GOA:Q98MI6"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MI6"
FT                   /protein_id="BAB48127.1"
FT                   /translation="MSSRLFWILMAVIGVGAALLVLNDSAGSTLGVENYDFGRLIWLGA
FT                   FGALIGAGLLRSGRPLGDMARNFGAWAAIVLALIAGYQYRYELQDIASRVTAGLVPGSP
FT                   LALGVEDGHATVTLDKADNGHFEARILVNGKPVRAVVDTGATSTVLTSEDAQAAGFNPA
FT                   ALNYTIPVSTANGMARAAAVKTDAVAIGGIVRKDMPVMVAAPGMLSQSLLGMNFIGSLS
FT                   GFDVRGDRMILRD"
FT   CDS_pept        complement(415527..416525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0566"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48128"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48128"
FT                   /db_xref="GOA:Q98MI5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MI5"
FT                   /protein_id="BAB48128.1"
FT                   /translation="MLKYQDHRLAIAPMMDWTDRHCRFFHRQLTSRALLYTEMVVADAV
FT                   IHGARERLLGFDDAEHPVALQLGGSDPAKLAEAARIGEAFGYDEVNLNVGCPSDRVQSG
FT                   TFGACLMKVPDLVAGCVTAMKAAVAIPVTVKCRIGVDEQNPEPALDALADGVFNAGADA
FT                   LWVHARKAWLEGLSPKENRDIPPLDYNRVYRLKAKKPNEFIGINGGIQSLEEARAHLDH
FT                   VDGAMLGRAAYHTPGILAGVDAGFYGAKPEAFDFAALIDAMADYAARHIEQGGRLGHVT
FT                   RHMVGLFHGLPGARRYRQILSTDANRPGAGPDVLKTAFAAVEFSGAAAEAA"
FT   CDS_pept        complement(416696..416872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0567"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48129"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48129"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MI4"
FT                   /protein_id="BAB48129.1"
FT                   /translation="MPWGTVMVAPFANCGGLAYVAHVVDMRVDEFAERFQARYRFWVAQ
FT                   RRASSRRRKVPLT"
FT   CDS_pept        417086..417424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0568"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48130"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48130"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MI3"
FT                   /protein_id="BAB48130.1"
FT                   /translation="MATLHYASGGSATDVATTGFNLVDVSSVDELNALPAGTKGLVWLD
FT                   EANGATSSFIQKVTPFIGNPNVFGFFLVDEPDPTGKWGTYATADNLKADQPARRQDLHH
FT                   HDEHGVFG"
FT   CDS_pept        417399..418376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0569"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48131"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48131"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MI2"
FT                   /protein_id="BAB48131.1"
FT                   /translation="MMNMGSSADPDFSNTFNPANTHIDYYGVDPYPVRTGTSTVDYNMI
FT                   DRTVAAAVASGVPLSQIVPVYQTFGGGNYTTDTGGQYVLPSVAQEQTMLDHWAKVAPSP
FT                   AFDYAYAWGSQQGDTALGNSPALQALFQQHNLSSAASGPATPPPSTSGASSTPSTPSTP
FT                   NTPDTHVSLGTASTPSTPVVANPSDGSHHHTNGADLIDRTDGVHHVPNANHWVTESAGG
FT                   PGRRGLASLADVGSDAFAFNTALTAGRADRATDFSQQKIHHDHALGLHTGAPPNGALFA
FT                   GMGTHDGSDHIIYNSSTGALSFDDHGTGGAHHIEFAHFPGASMI"
FT   CDS_pept        418464..419033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0571"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48132"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48132"
FT                   /db_xref="GOA:Q98MI1"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MI1"
FT                   /protein_id="BAB48132.1"
FT                   /translation="MVGRLCMEPFAGEGAGQPGRRLRFAARPGLGPFRDRSLAFRRASP
FT                   DALPCKSPPGDCPFDNFERIVDNRHSRLDLDDNPASRTGLADHNSRSAVRALVLSVAKS
FT                   SPAVPHHHPGSIHRGRALTRHIGFENDLLDEPLVRFEFNALVELVDNPKHVSIRHTRLI
FT                   IFLVIAAIVGWNFLRKGGDQHDFWFW"
FT   CDS_pept        complement(419519..420736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0572"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48133"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48133"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MI0"
FT                   /protein_id="BAB48133.1"
FT                   /translation="MLVSQTMRGAAQLNALDVAGRAGMSAGTRFLLYPQAPYVSGYEKP
FT                   EVVWISTSPGLIHPGPEDHRIYVRDPVLAKQPYEYPYLPPFVGAYFPPAEPGFDGHFDN
FT                   LSLHSRQFLAAHAFAAASRVLDIWESYLGKPIVWYFAETYERLEIIPWIDWENAQSGYG
FT                   YLELGRERGADGRGHPYALNFDVIAHEMGHSILFSLFGVPTKGLQDGDFGPFHEANADL
FT                   ISLLSFLHFDSGMDRLLRHSQANLLVLNELNRIGELTGDRQIRLASNSRKMTEVTEEIH
FT                   DRSRPFTGAIFDTLVDLYHAGLVRQGLADERLLRFDIRQVSEADMRRISNFTGDAFRAR
FT                   PFLFKTELIKARDDVALSLARAWTRLDADHLTFAIAASTIIEVSDRIRPAVAASFEENF
FT                   RWREIL"
FT   CDS_pept        complement(420786..421511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0573"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48134"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48134"
FT                   /db_xref="InterPro:IPR012924"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MH9"
FT                   /protein_id="BAB48134.1"
FT                   /translation="MRPRLVFTGPTLSHAEAQQVADVICLAPAVQGSIVAAVQRYDPAA
FT                   IVIIDGAFQAEPAVRHKEILWAISQGIPVIGAGSMGALRAAELYPYMHGVGLIYRWYRR
FT                   FAVLPDDAVAVLYGPKAVNFSPLTHALVDLRMTVRVAWRRNLISTDLSGKLESAARNLN
FT                   FRERTLSRMVREALPEAGDHDLQTCRQILAGAFVQQKKRDALSALQFMHENALVPAELK
FT                   NFRMTVGFVQDLEDAGLAI"
FT   CDS_pept        complement(421516..422664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0574"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48135"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48135"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MH8"
FT                   /protein_id="BAB48135.1"
FT                   /translation="MEHYERVGPPADEALTYLMSMRQALGITRIADITGLDRVGIPVVQ
FT                   ATRPFSLSNAVAQGKGVSLARAAISAILESAEGFFAERIEYFDVIHGSAKSLEIPSGRY
FT                   ETWLREPTFADWRDKDTAWVSAENLLGGKCDFVPLELVHTAYLVPPSPCDGIFTPTTTG
FT                   LAAALDETDAITHGILECVERDAIARALQTHGFLQHQRIDPATIDDARVLALLGELARK
FT                   DMIVGLWLAPSPVGLPVIWCHLMESNPRETALLHLPADGSAAAFDPAAAAVQAIREAAQ
FT                   ARLAAISGARDDMTRASYPRYPDWQLIEAHRQLITGGRKDVSFARQRAYRAAGGQTLRG
FT                   SLLARLEESGINAVYLIRLNTSPWNRLSVVRMVIPQLYPLVE"
FT   CDS_pept        complement(422664..425831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0576"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48136"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48136"
FT                   /db_xref="GOA:Q98MH7"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MH7"
FT                   /protein_id="BAB48136.1"
FT                   /translation="MSHKSRVDVPSAGTGSHLPIGRGLMDDAVGARHERRVLTALCYDL
FT                   VASTELLGLLGIEDFEELILAFQMAAKEAIVSCSGTVRVEVGDGGVAVFPVDLGAKDAA
FT                   SLTISAGLEIVRACKLLAAEKGRSDLHVRVGVATSMTLILKGDTGVAQDTVTGPAFALA
FT                   TRLQAIARPDTVVVCNETRNLTRRSHVFSFCGSHVIKGFAQPEQVWQALSHKRGVDRFF
FT                   AFGRLTSPLIDRTDEAKLIRECWNEAVSGRGQVIVIEGEAGIGKSRILHEVRRRTRFQR
FT                   NRLLLFQCMPGDSRSTLHPLRQAMLGNFDDGERALTPALVAEVFAAHGVHDPEVVDIFS
FT                   FLLGVEGVRSSFHEMDPEMIREKAEWAARHALQATCASGAVILIVEDIHWIDLTSKQLL
FT                   GELAKLVPSCPVLLIATTRPESGVWLDEKSKHVLLAPLEHADTLRAIATMWPQGKPAPA
FT                   PELKELVERVTGGVPLFIEEVCQWMAENAASGTEQLPQGVSLGRAAVLETVLDARLEPL
FT                   GRAREVARAAAVAGNRFSLDLLSALLPEFDPGTISAALDALVEAGFVRARHAAATVYAF
FT                   RHALIQETIYNATLRKRRQTLHRRLYAVASRNRSLVGWLTTAALADHAERAGLLDEAIG
FT                   EFVNAGMESSSRSAMAEARQLLEHAIALCGQVSDHDKRDALRLSAMVALGPILTAVEGP
FT                   NSEHARMLYDEGVKIARRRPIAERAKWFPIYWGWWFTGSVVDGERAQAVVSDLKEVNDP
FT                   EIQLQARHCLWAVDFNRGDHGGCIAAIDSGLPLYDVGQGHANATRFGGHDARVCGLAHR
FT                   ALSLWFSGRATSALRSMSEARRWAQRTGHVSSIAHACINDAMLSCYRRDFASLRNVIED
FT                   LRQLTALHHLPSLVVSAQIFEGWCDGNAGQLERGKDKMREGLGLHGQVQTPEDEPVYCG
FT                   MLAELLARSGAISHALALLHSAVAQAEAGGSRYWLAELHRRIAQLLVLDRAPAGRVAAA
FT                   LEQSLNTAAEQNAVPILIAAYETLSASNLSPGLLRSYNDRVEAARKSVEPGEPLIVNPE
FT                   PELRAGR"
FT   CDS_pept        complement(426961..427152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0577"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48137"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48137"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MH6"
FT                   /protein_id="BAB48137.1"
FT                   /translation="MERRHAIRRVSDGLWEVYDIDNNKVVRVGGVPLTNLLDEDALDAL
FT                   DLIRDGFLTLGQPKRTKA"
FT   CDS_pept        complement(427400..428512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0578"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48138"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48138"
FT                   /db_xref="GOA:Q98MH5"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MH5"
FT                   /protein_id="BAB48138.1"
FT                   /translation="MSVGHGANRCMTSAITDSNARRRCKGNLANYIPPYALFNGCGVAV
FT                   SLAIARSAPHLDGYVWTKEHKLTNRRKFSILAAVSLATSLAPAALLSRSRKAYAAMRPK
FT                   TPSARPQPTLLTAPIELAGDWGRMLEGAADQVVERMRHACLDGVRLVSDRQPTRLRVDE
FT                   HTSGTPAIWLHPDGTSMAWIIVDIGERDWSKLAYQFGHELGHVLCNSWQPDARPAPPCQ
FT                   WLEEAMVEAHSLRGLGRLARSWKEAPPFAGDNAFGDAIARYRQDIIDRYTALADSQGLT
FT                   RDAAAWFTDHRGEIEMPALNPFAQAMSLTILAEYDRAPDCIEALGALNRWPGRSGLAIG
FT                   EYLRQWEASCAELQASPRLPVRLRELLRIV"
FT   CDS_pept        complement(428479..429099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0579"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48139"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48139"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MH4"
FT                   /protein_id="BAB48139.1"
FT                   /translation="MHSMTQGTPDDSREAFARIYQSNEWGSAESRSGLGSAYATTHRVR
FT                   TVLPMLLRALDVKSMLDAPCGDFNWMRFVDLGKMHYIGCDIVPEVIETNRVRYADREFH
FT                   VLDLAVEPLPNVDLIFSRDCLQHLTEPDIWRALRNFKKCGARWLFTSSHSTSAQDIARE
FT                   TGGFGFLNLQQPPFSLPLPLLIMPEEHYASKAMCLWDMAQIGA"
FT   CDS_pept        complement(429196..429351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl8590"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48140"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48140"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MH3"
FT                   /protein_id="BAB48140.1"
FT                   /translation="MMVSEFGHFAKRVEMDAGGIGLVRRLENEFHADDAGPQQRAPTSN
FT                   SLKFVA"
FT   CDS_pept        429384..430484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0581"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48141"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48141"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MH2"
FT                   /protein_id="BAB48141.1"
FT                   /translation="MGASFNQAGFVKRIFTSHGTTLFVDTSSGELRHGLMEYSPNNVLL
FT                   TKDGKSAHIRFVDGPTDIVYFTEYSAISGSKRIDGIDALNLMPDNTLTIVDLPRNKFGL
FT                   VQNGTFLSARSDGRITLSAPLCRGWENFHFRKDASEVSGVIVSHRIDGKIITFFIQDRT
FT                   DIIQSILFGGDFYERDTLDLIRDRSTPGKVFVDIGANIGNHSIFMSKFCSPSEVIVFEP
FT                   NPKAIEILKLNVLLNACANINTSYLGLALGSKAAQMRVFSPDPNNMGRAQMLDDDDGNV
FT                   KCVAGDLLLQQKPVGLLKIDVEGSEFEVLRGMQGTIETWRPNILIEVWPQSQQDLFSWC
FT                   DSFRYVVQETFPTDNNYFLAPIERQS"
FT   CDS_pept        complement(430530..433325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0582"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48142"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48142"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MH1"
FT                   /protein_id="BAB48142.1"
FT                   /translation="MSTIGLCMIVKNETKVILQCLASVLPLVDYVLIVDTGSEDGTQDL
FT                   IRGFLADNGVQGAVIDEPWRDFAYNRTFALERLRKVETVDYAMIIDADDVLIRDADFDP
FT                   IRFKSQMEHDLYDVEVLHGGISFYRPQICRNRLPFAFKGVLHEYLEAPPGHLTRETAKG
FT                   FRVATGRGGARSQNPRKYQDDSAVLENALATETDPFLVSRYTFYLAQSYRDSGEREKSL
FT                   ANYLKRADLGFWDEEVYVSLLEAGNLMAALGRPFDEVVAAFERAAQVVPARAEALHAAS
FT                   LYCRNQGRNAEGTEFARRGLDLVQPAGLFIQPWVYDYGLLDEFAVNAYWAGAYRESLDA
FT                   CLKLLASDKLPAEMAKRVVANARFATGKLPVNEPPKLGAFGTESLIDQHRLVRQRSLRS
FT                   RIEGTPRILVTILAKQKEPALPLYLECIEALDYPKASIVLYIRTNNNTDRTEHILREWV
FT                   ERVGHLYAAVEFDASNVADRVEQFGEHEWNETRFRVLGRIRNISLRKTLEHSCDFYFVA
FT                   DVDNFVRPATLRELVALDVPIVAPLLRSISPGQYYSNYHAEIDANGYYMQCDQYGWVLN
FT                   RHVRGIIEMPLVHCTYLVRADVLPELTYEDATSRYEYVIFADSARKAGIVQYMDNRQVY
FT                   GYITFGDGQYYVSDGIERARALLHGAGDTPVFTAATPPGAVPMPDRHVEPPQIHLINLD
FT                   SSVERWRKYQDRNPHLAANTIRVSAVDGASLDRSTLQALVDDGVIAEDCGYLPGALGCA
FT                   LSHINLWKLAVSEKRPITIFEDDVYSSFNFLEESTRILSMAPENWDMVKWGFNFDPLFL
FT                   WLNFDFSKAKLEFYNRQHKQIPAQFQSETYPRSLIRLVHSFGAMAYSVTPRGAQVLLEK
FT                   CLPLRKRLIPFPGTGVVLEDEGIDCAMSAVYDSMHAFVCMPPLVIHDDEQASDREVANR
FT                   Q"
FT   CDS_pept        complement(433322..433714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0583"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48143"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48143"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MH0"
FT                   /protein_id="BAB48143.1"
FT                   /translation="MNDMRAEGMGDRDLASASTQSAPKARQSRTESSVRSPLPSIADNS
FT                   KVTHGKRLCLNMIVKNEMANLQRCLGAVVDHIDCCVIGDTGSTDGTQDFIKSFFAARSL
FT                   PGELHEFPFHNFEQARNDRCSAEGIA"
FT   CDS_pept        433823..433996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0584"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48144"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48144"
FT                   /db_xref="GOA:Q98MG9"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG9"
FT                   /protein_id="BAB48144.1"
FT                   /translation="MVTPSHFSGGLQGPWEAIAGMVRSNLFKRRNLAAICALSAFPPFI
FT                   NFQLINYKFLKF"
FT   CDS_pept        434831..441274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0585"
FT                   /product="hypothetical glycine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48145"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48145"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG8"
FT                   /protein_id="BAB48145.1"
FT                   /translation="MLFSRGHAGRACVPLNLKLNSSPQEPVMARASEILFLDPSIPDLE
FT                   TALRNVRPEVDAIVLDKRQPAARQMAEALEGRNGLDAVHILAHGAPGRLGFGSGEWSSD
FT                   TLVRDAANLAAIGRALADCGGLRLWSCETGYGAAGEAFVKALSEATGAGVSAAVGLVGA
FT                   EALGGRWDLPISPMSRVAPPLTNTGTASYAGVLSLEVTLTGSLDTAGSISQKAVQYYIT
FT                   NSSNVIVASFTLPSKSSAQFSSVAMIVDVPVSGTYTITALVQDDTDDNNQWSVVSAGTF
FT                   NLSNNSVTSGPSSNSDGVFTLTGVSSTSNSGSTGPTGATGATGATGATGRTGSTGATGS
FT                   TGATGATGATGHTGSTGATGSTGATGSTGATGSTGATGSTGATGATGSTGATGATGATG
FT                   STGATGPTGATGATGATGSTGATGSTGATGATGSTGATGATGATGSTGATGPTGATGAT
FT                   GATGSTGATGSTGATGDTGATGSTGATGSTGATGSTGATGDTGATGSTGATGSTGSTGA
FT                   TGATGDTGATGSTGATGATGATGDTGATGSTGATGSTGDTGATGATGSTGSTGATGSTG
FT                   ATGATGDTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGAT
FT                   GSTGATGATGDTGATGSTGATGSTGSTGATGATGDTGATGSTGATGATGATGDTGATGS
FT                   TGATGSTGATGSTGATGSTGATGATGSTGATGATGSTGATGSTGATGSTGATGSTGATG
FT                   ATGSTGATGSTGATGATGATGSTGATGSTGATGSTGATGSTGATGSTGATGATGDTGAT
FT                   GSTGATGSTGSTGATGDTGATGSTGSTGATGATGSTGATGSTGATGATGSTGDTGATGA
FT                   TGSTGATGSTGATGSTGATGSTGATGSTGDTGATGATGSTGATGSTGATGATGATGSTG
FT                   ATGSTGATGSTGATGSTGATGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGDT
FT                   GATGATGSTGATGSTGATGATGATGSTGATGSTGATGSTGATGSTGATGATGSTGATGS
FT                   TGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATG
FT                   STGATGSTGATGSTGATGSTGATGSTGATGSTGSTGATGATGATGSTGATGSTGATGST
FT                   GATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGS
FT                   TGATGATGSTGATGSTGATGSTGATGATGSTGATGSTGATGSTGATGSTGASGSTGATG
FT                   STGATGSTGATGSTGATGSTGATGSTGATGATGSTGATGATGSTGATGSTGATGSTGAT
FT                   GSTGATGSTGATGSTGATGATGATGSTGATGSTGATGSTGATGSTGATGATGSTGSTGA
FT                   TGATGSTGATGSTGATGSTGATGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTG
FT                   ATGATGSTGATGSTGATGSTGATGATGSTGATGSTGATGSTGATGSTGATGATGSTGAT
FT                   GSTGATGSTGATGSTGASGSTGATGSTGATGSTGATGSTGATGSTGATGATGSTGSTGA
FT                   TGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGASGSTG
FT                   ATGSTGATGSTGATGSTGATGSTGATGATGSTGSTGATGSTGATGSTGATGSTGATGST
FT                   GATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGS
FT                   TGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATGSTGATG
FT                   STGATGSTGATGSTGATGATGSTGATGSTGATGSTGATGSTGATGSTGATGATGSTGAT
FT                   GSTGATGSTGATGATGATGSTGATGSTGATGSTGATGATGSTGATGATGSTGATGSTGS
FT                   TGATGATGSTGATGSTGATGSTGATGSTGATGSTGSTGSTGATGSTGATGSTGAPGPTG
FT                   ATGATGSADDDDKHHHHHHHHGNNGNGDDDRSNRGNRRDQDDDDGKSGNGNNAKVTAST
FT                   LGLKDTTQFLQSGAPDGNSGPGKHASFGQLVGLAATSVTTDLLNVLKTVSGSGNNQNKP
FT                   SGASTDLTSDQTKPGAGYASNEHTVKTSLKDLLKPHE"
FT   CDS_pept        441759..451196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0587"
FT                   /product="hypothetical glycine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48146"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48146"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG7"
FT                   /protein_id="BAB48146.1"
FT                   /translation="MRRRVYVCPRRKADVPIPEFTREFAVEASAARVMGVGTVNQALSR
FT                   APQGVVPRFDGRQIHPLPATATGRPNARTDAPLPRASEILFVDPSVSDLGTILANLRPE
FT                   VEAILLDAKRPAARQMALALEGRDGLDAVHVIAHGAPGRVSFAAGEWSARTLDDDGVDL
FT                   AAIGRALGDDGGLRLWSCYAAAGDEGDEFVDGLARATGTNVAAATGLIGAAARGGGWQL
FT                   ARRVRGAVVAQPPLTAGGIGAYAGVLVARTWVGGVDTNFLNVNNWSVTTGSIGADVLTI
FT                   SGSPTRQPTLSTAGTTTITSLNISGSNTLTINGAAVILAATSGITMASPAIITGTGTIA
FT                   AGTNITGAGTVGIPISTTGTITASGGTLNLTGTVSNRTLAIANVAGSILKLDGTVSSGV
FT                   TFNGTTGTLDLTNLAGFTGTISGLNIGASTTTATNQIDFGNASIVSGSLNGSVLTVVDG
FT                   AGQSYALTLGGAPAAGTVVDLKFDGASGTDVFFSTPAATNTFTMAQGGADAWGDTARWS
FT                   GGLPLTQPAAGPNLTFVSNHNAQGSLSGNINSLYMPPTLRQATGTGSSIWTVSDTGSSA
FT                   NQFTTSLTLINHGQIFVNGTANLTSGTAATTNWVMTGTGVGAGGLGNQYFENDGSLNVV
FT                   GTTAAALANGFSTSATFTGNIYVTGSGYMNIYGNASLVFGTGVGVSASQTINFVTDGGN
FT                   NTDGTVTEISSQFVNAAYAGFLPGDTLVLENLGATPLSEVVIDGNGQATVYIYSGANGT
FT                   GTLLDEETFLGNFTNGNSDFTFVNSSANGGQVTIGATGSAGHAVGPTGPTGPTGATGST
FT                   GATGSTGATGSTGATGSTGATGSTGATGATGATGSTGATGATGSTGATGSTGATGSTGA
FT                   TGATGATGSTGATGATGSTGATGATGSTGATGSTGVTGATGSTGATGATGATGSTGATG
FT                   STGNTGATGSTGATGATGATGDTGATGSTGATGSTGATGATGDTGATGSTGATGSTGAT
FT                   GATGDTGATGSTGATGATGATGDTGATGSTGATGSTGATGDTGATGSTGATGATGATGD
FT                   TGATGSTGATGATGATGATGATGDTGATGSTGATGATGDTGATGSTGATGSTGATGDTG
FT                   TTGSTGATGATGATGDTGATGATGATGSTGATGATGATGDTGATGSTGATGATGATGDT
FT                   GATGDTGVTGSTGATGATGATGATGDTGATGSTGATGATGSTGTTGATGATGDTGATGD
FT                   TGATGSTGATGATGATGDTGATGSTGATGSTGATGATGDTGATGSTGDTGATGATGATG
FT                   ATGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGATGDTGATGATGATGAT
FT                   GATGDTGATGSTGATGSTGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGD
FT                   TGATGSTGATGATGATGDTGATGSTGATGSTGATGDTGATGSTGATGATGDTGATGSTG
FT                   ATGATGATGSTGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGDTGSTGAT
FT                   GATGATGDTGATGSTGATGATGATGATGATGDTGATGSTGATGATGATGDTGATGSTGA
FT                   TGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATG
FT                   ATGATGDTGATGSTGATGSTGATGDTGATGATGATGDTGATGATGATGATGATGDTGAT
FT                   GATGSTGATGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGATGDTGATGS
FT                   TGATGATGATGDTGATGSTGATGATGATGDTGATGSTGATGATGDTGATGSTGATGATG
FT                   ATGATGATGDTGATGSTGATGSTGATGDTGATGSTGATGATGATGDTGATGSTGATGAT
FT                   GATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGD
FT                   TGATGSTGATGATGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGDTGATG
FT                   STGATGATGSTGDTGATGSTGATGVTGATGDTGATGATGATGATGATGSTGATGATGST
FT                   GDTGATGATGDTGATGSTGATGSTGATGATGATGATGATGDTGATGSTGDTGATGSTGA
FT                   TGATGATGATGATGATGATGATGATGDTGATGSTGATGATGATGDTGATGSTGATGATG
FT                   ATGDTGATGSTGATGSTGATGDTGATGSTGATGATGDTGATGSTGATGATGSTGATGAT
FT                   GDTGATGSTGATGDTGATGSTGATGATGDTGATGSTGATGATGATGATGATGDTGATGS
FT                   TGATGSTGATGDTGATGSTGATGATGATGDTGATGSTGATGATGATGDTGATGSTGATG
FT                   STGATGDTGATGSTGATGSTGDTGATGSTGATGATGATGVTGDRGATGSTGATGSTGAT
FT                   GATGATGASGATGDTGATGSTGATGATGDTGATGSTGATGDTGATGSTGATGDTGATGS
FT                   TGATGATGSAGATGATGATGDTGATGSTGATGATGATGDTGATGATGDTGATGSTGATG
FT                   STGATGDTGATGSTGATGSTGATGATGATGASGPTGDTGATGSTGATGATGDTGSTGAT
FT                   GSTGATGDTGATGSTGATGATGAPGATGATGDTGATGSTGDTGATGSTGATGATGDTGA
FT                   TGSTGATGATGSAGATGSTGATGATGATGNTGATGSTGATGSTGATGATGSTGPKGDTG
FT                   STGSTGPKGDTGPKGATGATGATGSTGATGPKGDTGPKGDTGPKGATGATGATGSTGST
FT                   GPTGSTGPKGDTGPKGATGATGATGSTGSTGPKGDTGPKGATGATGATGSTGSTGPTGS
FT                   TGPKGDTGPKGATGATGATGSTGSTGPTGSTGPKGDTGPKGATGATGATGSTGSTGPTG
FT                   STGPKGDTGPKGATGATGATGSTGSTGPTGSTGPKGDTGPKGATGATGATGSTGSTGPT
FT                   GSTGPKGDTGPKGATGATGATGSTGSTGPTGSTGPKGDTGPKGATGATGATGSTGATGP
FT                   KGDTGPKGDTGPKGATGATGATGPTGPSSGHHDSIVPSTSTLVTTTQKTANVTSDSLGL
FT                   KDSGQFLQPGSTGNGSGGQPSLHHLIGLAAGSVTTDLLNILNTIKGFGHQQNQPSRATT
FT                   DQTLDATKHGTGYASTDHTAKTTLKDLLKPHE"
FT   CDS_pept        451554..453698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0588"
FT                   /product="probable secretion ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48147"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48147"
FT                   /db_xref="GOA:Q98MG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG6"
FT                   /protein_id="BAB48147.1"
FT                   /translation="MLRAARYHGVELDPNEFRAASAVPAAADLSQWAQDAGMWSRAVRI
FT                   RWSHLLRFQDAGPVVLLFNDGGAALLTGASAERNVVFLKSADAPEDGEAVAIDELRLSQ
FT                   VWTGEALLLRATRSYVAADAPFTLRWLAELVRLESHALRDITIASFTLSVLTILPPLIV
FT                   MTVVNKVLQFNSISTLVLLSAVIAVVFAYETLLGHARRLIINVVGARLDTKLQLHVFSR
FT                   LLRLPLDYFERHPAGETMYHLAQVYRIREFLTGKLLSTFLDMITLCVLVPVMFYINTAL
FT                   AWIVLACAVVIMLIILAFLMPLRRRYQRVVDAETWKSAALGETVVGIKTVKALGLEPQR
FT                   KALWDERVAEAGKARLAFGQLASWPQTLVTPIERVMVLGTMLIGAYLAMNDRTGYMVGG
FT                   LFAFMMIAQRVAQPLVGLARLVEDYEEVGAAIGEAASVLNRPLESSSNSTGLRPRLVGE
FT                   VVFSDLTFSYIATKIPALDRVSFHIPAGSMFGIVGRSGSGKSTVARLLQGINRDYSGFL
FT                   KLDGVDLKEINLRHLRQGLGVVLQDNFLFRGSIRDNIIAGRPGLTLSDAMRAAHLAGAQ
FT                   EFIERMPNGYDTYIEEGSPNLSGGQKQRLAIARALIHDPTILILDEATSALDPESEAVV
FT                   SANLMRIASGRTMIIVSHRLASLTECDNILVMDQGKVLDVAPHATLLERCALYRQLWSQ
FT                   QNRHLDGRHGRPVAVPPRLV"
FT   CDS_pept        453740..455146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0589"
FT                   /product="probable secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48148"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48148"
FT                   /db_xref="GOA:Q98MG5"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG5"
FT                   /protein_id="BAB48148.1"
FT                   /translation="MSSTSLTALPARWHRMETRDPTAPAILEFQWPSTAVANAPIPRSA
FT                   RGIVWIVSSLVIALIALAGLIPVDQVVTARGLVVSQSPNIVVQPLETAIVRSIEVREGQ
FT                   RVQAGQLLARLDATFTSADKAALAMQVSTLEAEVARLKAEANGQAFTYDGLDPSWTLQV
FT                   SIFEQRKAVYDAKVENFERQRDELSSVISRSQSDAEGYRQRLTVADSIEQMRRQLEARQ
FT                   VGSRLNTLLAEDNRAEMSRALGNAEQTAEAAKRQQAAVAAERDGYIQGWRAEVSQSLSE
FT                   ASSRISDARELLNKAKLRNQLVELKSQSDAIVQSVAKVSVGSVMQSGERFITLVPADAP
FT                   LEIETNIVGRSSGFVHVGDPVVIKFDTFPYSQYGLAHGTVRALSPDSFSAQEQARDPNS
FT                   SLAMLPSDAEPFYRTRISIDQVALHGVPAGFAVSPGMPVTADVKVGRRTILKYILGVML
FT                   PIGQEAMREP"
FT   CDS_pept        455176..456909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0590"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48149"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48149"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG4"
FT                   /protein_id="BAB48149.1"
FT                   /translation="MTILDRLTGLAFPAAVLRRAIKLADSGKAAEAFPLMAKAARAGIV
FT                   DAEYRVARCYLEGAGVPPSRMEGARWLLRAADHGSADAQALLAALYVTGLVTSEADGKG
FT                   PSEHLFKPDSAGKPDFTAAFDFATKAAEAGSATGQAILGYILTSGPASMRDADAAHRWY
FT                   EKSASAGCAEGCLGFALSLARRGKRENRVRIAEEVRRAADAGLPTATYLLAVLTEHGLG
FT                   VARDMAAAAQLYQAAAEKGLPSAQFRLGLALIDGALVGQDVAAGEAWMRRAALAGNIEA
FT                   AYLLGDRHAKTQRPDFAEAANWYRRAAEAGHQAAARALASLYLTGNGVAEDVEEGARWL
FT                   RSSASAGNQQAQTDLANLILGGAGEPDDGASVAGWFEAAASSGDLIAAFNLGLCFAKGV
FT                   GVRQDEGQAAHWLRRAAEGVAEAQYMYARLLQDGRGVAADPTQARVWFARAADAGVLDA
FT                   RVALAEMLLNGRGGMPEPEAAMQLFEQAAADGHAGAMFAIGALYGAGHGLPLDQTTAQK
FT                   WYAAAAGRGHSQAQFMLGRYLLKGLAGERDPVAARLWLERAAAHGISEAADELGAAGGS
FT                   D"
FT   CDS_pept        complement(457837..459882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0592"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48150"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48150"
FT                   /db_xref="GOA:Q98MG3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR017037"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG3"
FT                   /protein_id="BAB48150.1"
FT                   /translation="MEALQYLGPTGWMAIEVAVLVIVLAILLWWSGVVRYIPNDRLGIL
FT                   EKLWSFRGSVSNGFIALNREAGYQPEVVRGGLHFFMPFQYSMHRANLVTIPQGQIGYVF
FT                   ARDGKPLPPTQTLASNTDADDFQDVRGFLEKGGQKGPQRKILREGTYAINLAQFIVLTA
FT                   QSIYAVNLSSSEQNLFTNMSTMISERGGFEPVVIHNAEDMIGIVTVHDGPALPDGEIIA
FT                   PTVANDPNDPNFHNNFQDPEKFLNARGYRGRQLQVLADGSYFLNRIFATVELVKKTIID
FT                   VGTVGVVVSYNGRHGTDISGQAYRHGELVEIGSRGVWSTPLLPGKYAFNTYAGNIITVP
FT                   TTNFVLKWTKEQFGEHRLDENLSEVSLITKDAFEPVLPLSVVVHIDYMKAPLVVQRFGD
FT                   IKRLVEQTLDPMVSAYFKNIAQTKTLIQLLQERSDIQRKSGEEMREKFNSYSLELQEVL
FT                   IGTPRAANGQNSIEQILIQLRERQIAVEKVETYKLQERAAIQERTLREKEALAEQQAKI
FT                   TTSALTIEISENEGKAQLARTRQQAETIQVTAKAEAEKVRLGGQGEADMIKAIALADAE
FT                   RIKATGFADAEKVRAIGLAEAEATEKKVAAFGGPDYQLNSQVLMRFAEAIENGRLPLVP
FT                   QIQIGATGGEKGAANGLVEMMLSMLVADRVGRQTVPDEIPAPVEED"
FT   CDS_pept        460191..460742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0593"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48151"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48151"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG2"
FT                   /protein_id="BAB48151.1"
FT                   /translation="MVVGFLQIGKSATRQSWTDPRTSMSLVPERACYLTGQGLYQVGTA
FT                   WFGSRWKRALSIYGAATMNDPSAGKPAYDPQQLEPMLIARQHAGDVDGMVALFEADAVI
FT                   DCGDGRFLRGREAIRDYYAEIVTSGRKFAVGEQRPALVCGDLALTSTRLPDGDVTSEVA
FT                   RRQADGSWLWVIDRYSVAWD"
FT   CDS_pept        complement(460866..461168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0594"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48152"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48152"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG1"
FT                   /protein_id="BAB48152.1"
FT                   /translation="MDYLHFFAPVRISRGQGHPVEEVDSVAEAMVFLRKWPTGRRGPVY
FT                   QCALNCCSAALSGQMSAEEARKAFTGFARITRLLDDDMALPVPGETMADVYALRR"
FT   CDS_pept        complement(461288..462268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0595"
FT                   /product="ATP-binding protein of oligopeptide ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48153"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48153"
FT                   /db_xref="GOA:Q98MG0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG0"
FT                   /protein_id="BAB48153.1"
FT                   /translation="MTDSPILETRSLGKRFSIGTRFSAEGKRTVHAVDNVSLTVRRGDT
FT                   VGLVGESGCGKSTLARCLVRLYDISVGELLFEGEDITSKSLSELRPLRRRLQMVFQDPS
FT                   ASLNPRRRVGDLVAEPLRIHGKLSSREITARVAELFELVGLLPDHVMRYPHEFSGGQRQ
FT                   RVGIARAIALNPDLVVLDEPVSALDVSVQAQIVNLLADLQEKLNLTYIFIAHDLSVVRQ
FT                   VSTRIAVMYLGSIVEEGPAEQVFATPAHPYSQALISAVPVVETTPSGTRKRIILTGDVP
FT                   SPLKPPFGCRFHPRCPIAVERCRTERPELREYRPGCKVACHFPTV"
FT   CDS_pept        complement(462277..463236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0596"
FT                   /product="ATP-binding protein of oligopeptide ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48154"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48154"
FT                   /db_xref="GOA:Q98MF9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MF9"
FT                   /protein_id="BAB48154.1"
FT                   /translation="MILSVRDLKVSFRTNDGLVRAIDGVSFDLEESEILGVVGESGSGK
FT                   TVSLLAVMGLITDPNARIEGSIRYKGRELVGLPARELRRLRGNEIAMIFQDPMTALTPV
FT                   YTIGWQIAEQIRAHQNISKAKAMVRVEELLAEVNFPNPHEAMSRYPHQLSGGMRQRAVI
FT                   AMALSCNPALLVADEPTTALDVTVQAGILDLVRKLRATHKSAVVFITHDMGVVSELADR
FT                   VMVMYAGRVVERGSRMELFSDPRHPYTRALLGSIPPLTGEKPRRLPAIPGSPPSLLRLP
FT                   QGCAFGPRCPVHYEPCVTGKPDLGVGTHAAACFRVTQA"
FT   CDS_pept        complement(463233..464204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0597"
FT                   /product="permease of oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48155"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48155"
FT                   /db_xref="GOA:Q98MF8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MF8"
FT                   /protein_id="BAB48155.1"
FT                   /translation="MFYAILRRFGQMLFVMFGISVIVFLIFFATPGADPAARIAGRNAS
FT                   PEVLEAVRHSFGFDRPLYVQYVKMMEKIFVTGDLTSFVNRGWKVVPAVMDSIPVTLSLV
FT                   FGAAILWVVVSIIIGIVAAATRDSWLDKLLMALGLLGISMPVYWLGEVMNLITQSRYHD
FT                   SWAFSWVPPLGYKNFSDDPKGWFLTLVIPWITLAILYIGIYGRVLRAAIIESLQEDFIR
FT                   TARAKGLSETRILLRHALRTSLIAFVTLFGLDFGALVGGSALLTEVVFGLHGIGKLTYD
FT                   ALQNLDLPMIMATVMYASMFVVIANAVVDFVYILLDPRLRTS"
FT   CDS_pept        complement(464204..465220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0598"
FT                   /product="permease of oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48156"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48156"
FT                   /db_xref="GOA:Q98MF7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MF7"
FT                   /protein_id="BAB48156.1"
FT                   /translation="MSNQAVAMSRKTRGPWAVAFAKLARDRAAMASLAVFLLIVLACLS
FT                   APLYAKWAGTDPFASTLDAVIQIDGADVPVMEQSTEGLGLGYTPLGPTWRLGNYFLGAD
FT                   SQGRDVMARMLYGGLSSLLISGAATIFTLIIGTAAGLIAGYFGGITDTVLSRLLDVLWA
FT                   FPIYLLAISLSIVTIAQGIRIGPIDIESGSLWLPVIIIGIVYVPYVARPIRGQVLSLRH
FT                   SEFVLAAINLGVPGWRILWRDILPNITTTLIVFVPLMMALNMLTESALSFLSIGVQPPA
FT                   ASWGTIIQDGQALLYTRPLVALVPGLAIAVSVMALNVFGDGLRDALDPRSKVRLGRD"
FT   CDS_pept        complement(465243..466904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0599"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48157"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48157"
FT                   /db_xref="GOA:Q98MF6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MF6"
FT                   /protein_id="BAB48157.1"
FT                   /translation="MKKLLLAASAAALLAGTWLAPAQAEYLKEHRGGTIRLLARSAAGT
FT                   LDPHINYTDQGWQMYQPIYDGLVAFRKAEGMDGFTIVPDLAEALPQVSNDGKTFTFKLR
FT                   KGIKFSSGQDMGVKDVVASFQRIFKVSGPTSGTFYAGIVGADKCLADTKNCTLEGGVVG
FT                   DEAAGTITLNLTKPDAEILYKLALPHAVVLPADTPAEDMGSKPIPSTGAYMISAFDPNK
FT                   GMTVSRNPNFKQWSEEAQPDGYPDVVQYDFGLSEEAAVTAIQNGEADWMFDALPSDRLG
FT                   ELGSKSMDQLHISPLSAWWYAPLNNRLAPFDNEKARQAVAYAIDRNTLVKLFGGKVLAS
FT                   PVCQVLPPDFPGHEDYCPFTKNPGAKWSAPDLDKAKQLVEESGTKGQKVTIIAEDTAIS
FT                   RSIGVYLQSVLTSIGYVADVKPISPNIQFTYIQNTNNKVQMSITQWYKDYPAASDFLNI
FT                   LFSCSSFREGSDASINIAGFCDKDIDAKMQKALDLGVTDQKAADKMWAEIDKQVTDKAP
FT                   AVGLFTPKRLDFVSKRVGNFKFNRQFNWMITQSWVQ"
FT   CDS_pept        complement(466923..467828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0601"
FT                   /product="proline iminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48158"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48158"
FT                   /db_xref="GOA:Q98MF5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005945"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MF5"
FT                   /protein_id="BAB48158.1"
FT                   /translation="MSSEVASKEGRAPFGSYETWYRISGDLDADKAPVVVLHGGPGAAH
FT                   NYVDAYKLLARRDRAVIHYDQLGCGNSTLLPQKGADFWTPRLFIDELENLVDHLGIRAG
FT                   FHVLGQSWGGMLGAEYGVTRPKGLKSLTIANSPASMKLWVEEANRLRAELPGDVQETLT
FT                   RHEQAGTTDDPAYQAATMAFYERHVCRVVPFPPEVTEIFDQIARNPTVYHLMNGPNEFH
FT                   VIGTLKNWSVIERLPAVDVPTLIISGRYDEATPATVQPYKDGIKGSRWEIFEHSSHMPH
FT                   VEEQDACMRVVGDFLDDNDN"
FT   CDS_pept        complement(467883..469391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0602"
FT                   /product="leucine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48159"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48159"
FT                   /db_xref="GOA:Q98MF4"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MF4"
FT                   /protein_id="BAB48159.1"
FT                   /translation="MPQSPVPVFETVDGISAETSVVVILQTAQAGFGPRATVLDAEMGG
FT                   ILSRACSDPATLADSGTCIDLIAPQGVSARRVIVLALGKAEAVSALSLARAGGLLAAHL
FT                   EGKCECAATLVLDPIDDIGRPAAEILARVALGMRLRRYRFDMRNRRQGAGADRTLRIQL
FT                   VGASSAELTPALARVNAIADGVEYARTLVNLPPNHLHPDNFHDHLEPLREAGIDVDILD
FT                   TARLKELGMNAILAVGSGSVRPPRVAVLRYRGKGAPSQPMAFVGKGVCFDAGGLCIKRG
FT                   EQMFDMKADMGGAAAVVGLLIALARQGSPVHAVGVLGIAENMPSGTALKSRDIITTASG
FT                   QTVEVFDTDAEGRLILADCLHYAASRFNPSVIVDLATLTYSVMRGLGSVFAGLFSTDDA
FT                   IASQMIAAGETVGERFWQLPLDKAYDEGLQSPFADLRHHAKDMEDGDAPYAAAFLRHFT
FT                   EDRPWVHLDIAGKEMADADRPLGREGATAFGVQMLEEWVQTRLN"
FT   CDS_pept        469654..470556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0603"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48160"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48160"
FT                   /db_xref="GOA:Q98MF3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MF3"
FT                   /protein_id="BAB48160.1"
FT                   /translation="MALPSLNGMRAFEAAARLGSIKDAAEELHLTPSAISRHIRALERN
FT                   LGQDLFERGFRQITPTIRGSYYARSLSEAFEAIWRATDDVSLADGPSHGRTQRVRVLCV
FT                   PAVLNLWLADRLPNFRRLHPAVELEISTSGKRANFDLAIVDEFVYKAGPALTLLIPLVL
FT                   TPVCAPSLLDGPVPLRSPADLVNHHLIHECESMRWKRWLEQEGVLDTTPKSSTTLDDCT
FT                   LIMREAINGAGIALADTMMAQDFLQQGKLVAPFPARHTYPAGIYLHQRRSIGNKPGTGL
FT                   FQDWLLSEVEDHKRVMAIA"
FT   CDS_pept        470766..472223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0604"
FT                   /product="probable permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48161"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48161"
FT                   /db_xref="GOA:Q98MF2"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MF2"
FT                   /protein_id="BAB48161.1"
FT                   /translation="MTIQGASPDLYNEDLAPAKVRNWGAFSIFNVWTSDVHSLWGYYLA
FT                   ASLFLFCGGFVNFIIAIGIGSLIIYALMNMVGNAGVKTGVPYPVLARASFGIWGANIPA
FT                   LVRAIVACFWYGAQTAAASGAIVALLTRLQWFDEFNKTSHLLGHSTLEVICFVVIWALQ
FT                   LLIIQKGMETVRRFQDWAGPAVWVMMLLLAIYLCVKSGTFAFTSDIPMDVLREKTADAG
FT                   IPGDPGSWTALFGVAAIWVTYFSALYLNFCDFARYAPDKAALRKGNIWGLPVNLILFSL
FT                   VAGVTTIAAYDVYHEVLLHPDQISAKFDSWFLAALAALTFAVATLGINVVANFVSPAFD
FT                   FSNVFPRQIDFKKGGYIAALIALVLYPFAPWEGSAAHFVGIIGATMGPIFGVMMVDYYL
FT                   IRKGEVDVEALYREDGEFRFQGGWHVNAFIAAGIGAVFSSILPNFTNWLPSWWGVYGWF
FT                   FGVAIAGTIYYVLRTVAVGAGAKTAKA"
FT   CDS_pept        complement(472275..472820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0605"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48162"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48162"
FT                   /db_xref="InterPro:IPR012545"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MF1"
FT                   /protein_id="BAB48162.1"
FT                   /translation="MQTYVALLYSIILGEGRRVVMADLKAMAEGLGLKNVRTLVATGNL
FT                   VFEARATDIGKLEQRLETAFEKTFGRHVDIIVRTAEEWLKLAAGNPFPADSAEAGDQVA
FT                   VRVMRKPAPVEDVAALQAYAAEDEKVLPCAGDIWVVFSRERPTSRLLATMNHKRLGIGT
FT                   SRNWNTVRKLAEMVGSRQ"
FT   CDS_pept        complement(472844..474472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0606"
FT                   /product="CTP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48163"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48163"
FT                   /db_xref="GOA:Q98MF0"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MF0"
FT                   /protein_id="BAB48163.1"
FT                   /translation="MARYVFITGGVVSSLGKGIAAAALGALLQARGYRARIKKLDPYLN
FT                   VDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFTGRSANQQDNITTGRIYKNIIERERR
FT                   GDYLGATVQVIPHVTDEIKNFVLNGNDDYDFVLCEIGGTVGDIEAMPFLEAIRQLGNDL
FT                   PRNNAVYVHLTLMPYIPTAGELKTKPTQHSVKELRGIGIAPDILLVRADRAIPKEERRK
FT                   LSLFCNVRESAVIQALDVPHIYDVPMAYHKEGLDSEVLAAFGIDPAPKPRMEPWQKVSD
FT                   RIHSPEGEVTIAIVGKYTGLKDAYKSLIEALSHGGLANHVKVKLDWIESEIFEKEDPTP
FT                   WLEKVHGILVPGGFGERGSEGKILAAKFARERKVPYFGICFGMQMACIEAARSLAGVEH
FT                   ASSTEFGPTEEPVVGLMTEWLKGNMLEKRRETGDLGGTMRLGAYQADLAKGSKIAEIYG
FT                   DTQISERHRHRYEVNIDYKERLEDCGLVFAGMSPDGVLPETVEYPDHPWFIGVQYHPEL
FT                   KSRPLDPHPLFASFIEAAVEQSRLV"
FT   CDS_pept        complement(474699..475979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0608"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48164"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48164"
FT                   /db_xref="GOA:Q98ME9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ME9"
FT                   /protein_id="BAB48164.1"
FT                   /translation="MLRDHEDSTCSSAVSRLRHPRLFDYRLRAAFSVSLGDAGRRRGQQ
FT                   ALNDRIFAMQLRSFIFLGLCAVLGLGSPAFAGVPANLAANQSVDKTDAINVAVKSDAAQ
FT                   LRLLKKKKNPTPDDLAQIKKIEAKIVADKEDAKAKALEARKLAMREAAKAKADAERQAF
FT                   LAKREKSASATAEVADAKPAKKTTKVIEPIEQITPIQSAEPLPAEAMNVALTGNNGELR
FT                   SEVIGQKQPTGGLFAGLFGGTSGSSISYLPETRALDQALAKKDAKKPFKVKPEFVPQDV
FT                   EFTGYEPGTIVIDTSARRLYLVESFSTARRYAIAVGREGLQFKGTVAVGDKQEWPRWIP
FT                   TLDMQKREPKHYGQYKDGMPGGGQNPLGARAIYLYDGKKDTHLRIHGTIAPQSIGTSAS
FT                   NGCFRMINEHVMDLYSRVRVGTKVVII"
FT   CDS_pept        complement(476033..476497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0609"
FT                   /product="protein-export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48165"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48165"
FT                   /db_xref="GOA:Q98ME8"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ME8"
FT                   /protein_id="BAB48165.1"
FT                   /translation="MQTVLIVIHLMVVLALVGVVLLQRSEGGGLGIGGGSGFMTARGAA
FT                   NALTRATAILAAAFFVTSLTLSIIARYGEKPIDILDRVPATGKGVLNQLPGTTTPAPAG
FT                   STAPTPPSGNGAATTPAPATPATAPASGATPPANNGTTNTAPAAPQVPNQ"
FT   CDS_pept        complement(476665..477435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0610"
FT                   /product="triose-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48166"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48166"
FT                   /db_xref="GOA:Q98ME7"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98ME7"
FT                   /protein_id="BAB48166.1"
FT                   /translation="MTPGIRPLVAGNWKMNGTSASLNELRMIGNGFMSGLDAETEALVC
FT                   VPATLLSHAAEILSRTPVHAGGEDCHTKESGAYTGCISAEMLKDAGASHVIVGHSECRE
FT                   QRGEDDATVQAKAAAAWRAGLVAIICIGETQQQREAGATLEVLSRQVAGSVPPSATPSN
FT                   TVIAYEPVWAIGTGLTPTAADVAEAHAHIRERLSEKLGASAAKTRILYGGSVKPSNAVE
FT                   LLGVRNVDGALVGGASLKAADFLGIAEAYRSISG"
FT   CDS_pept        477338..477508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0611"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48167"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48167"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ME6"
FT                   /protein_id="BAB48167.1"
FT                   /translation="MNPLPIILSSFSEALVPFIFQLPATSGRIPGVMVCFSGRYQALAL
FT                   TTKIRPQSNRQ"
FT   CDS_pept        477579..479471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0613"
FT                   /product="peptidyl-prolyl cis-trans isomerse D"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48168"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48168"
FT                   /db_xref="GOA:Q98ME5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ME5"
FT                   /protein_id="BAB48168.1"
FT                   /translation="MLGILRSAAGTWVAKTLLSLLVVSFAAWGISGRLMGGFAGHDSVI
FT                   IAGGTKVSINEYRLAYDRQLAVMSQQFGQRLTHEQAKALGIDNQVLAQLVSGAVLDEQA
FT                   RKLGLGLSKDRLAELTREDPAFKGPGGEFDRRTFEYMLRQVGMRPEDYLKNRAQVAVRQ
FT                   QIVEAVSDGLKAPDAFFKAVALYRGEDRTVDYLLLPKKLVEPIEAPSDSVLQAYFEANK
FT                   KTYAAPEYRKFSYVRLEPVDIMDPTAVTEQQVSDDYNKNKTRYTTPEMRTIEQLVFKTP
FT                   DAAKAALDSLKAGATFEKLVTAEGKTPADTLLGTLAKDKIADKAVADAAFALNANEVSQ
FT                   VVQGAFGPVLLRVTEIKPEVVKPLAEVSDQIRKDLALGEASRILLDVHDNYEDTRASGS
FT                   SLADAAAKLKLKDVTIDAIDRSGLRPDGSIVKDLPESPALIKAVFDAEPKTENEALTTA
FT                   DNGFIFYEVASITPARDRTLDEVRQKVVADWTAAETTKRLAAKASELDKRLKAGATLDV
FT                   IAGDLKLEKQTKRGLKREADDADFGKEGAAVMFGVGEGGTGLIPSPTGDGQILFKVAEV
FT                   FEPAGADASSVPEDAQKSFTSGMSDDLLDQLVAQLQTQYDVRIDQAAVAQAATR"
FT   CDS_pept        479468..480478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0614"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48169"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48169"
FT                   /db_xref="GOA:Q98ME4"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98ME4"
FT                   /protein_id="BAB48169.1"
FT                   /translation="MSALKTHIAKVAAGTALSFEEAREAFDIIMSGDATPGQIGGFLMA
FT                   LRVRGETVSEISGAVATMRAKMLRVEAPAGAIDIVGTGGDNSHSVNISTGSAFVIAAAG
FT                   VPVAKHGNRGLSSLTGAADVLIALGVKIDIPPDAIGRCIHEAGVGFMFAPAHHPAMKHV
FT                   GPTRVELGTRTIFNLLGPLSNPAGVVRQMVGVFLPEWILPVAETLKALGTEHAWVVHGD
FT                   GYDEITTTGETQVAELIGGEIRSFTLTPEEVGLKRHTKDELRGGDAAYNANALRDMLDG
FT                   AAGAYRDTVLMNAGAGLVIAGKATTLGDGIALAAQAIDSGRALQVLDRLVEISNG"
FT   CDS_pept        480482..481294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0615"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48170"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48170"
FT                   /db_xref="GOA:Q98ME3"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98ME3"
FT                   /protein_id="BAB48170.1"
FT                   /translation="MSDILRKIEAYKRDEIAAAKAHVPLAEIKARAKDADAPRGFLAAL
FT                   EAKRRSGRFALIAEIKKASPSKGLIRADFDPPALAQAYEKGGAACLSVLTDAPSFQGAP
FT                   EFLTKARAAVALPALRKDFLFDPYQVYEARAWGADAILIIMASVDDALASALEATAFEL
FT                   GMDALIEVHDEAETQRALKLSSRLIGINNRNLRTFETSLETSERLATMVPADRLLVSES
FT                   GIFTHDDCLRLQKKDIGTFLVGESLMRQEDVTAATRILLTGKALAEVV"
FT   CDS_pept        481297..481779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0616"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48171"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48171"
FT                   /db_xref="GOA:Q98ME2"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98ME2"
FT                   /protein_id="BAB48171.1"
FT                   /translation="MTSALTHLGAQGEANMVDVGDKEETTRTAIAEGFVSMQPETLKTI
FT                   LAGNAKKGDVLGTARIAGIMAAKKTHELIPLCHPLLLTKISVDIEPDHALPGLKVTALA
FT                   RVTGKTGVEMEALTAASVACLTIYDMAKAVDRAMLISGIRLVEKTGGKSGDYKVGA"
FT   CDS_pept        481779..482984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0617"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48172"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48172"
FT                   /db_xref="GOA:Q98ME1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ME1"
FT                   /protein_id="BAB48172.1"
FT                   /translation="MALVPVAEALERLLDGAAPLAGESVPLFEAVDRVLAEPLAALRTQ
FT                   PPFNASAMDGYAVRAADVASVPSKLTVIGMAPAGRGFDGSLGERQAVRIFTGAPLPEGA
FT                   DTIVIQENVRDLGGGHIEVIEPTAEWRNIRRVGLDFSKGDFLLEKGRLLDPAALSLTAS
FT                   ANHPVVTVVKRPLVAIIATGDELLPPGSELGPDQIISSNAYGVAAVAQSVGARALDLGI
FT                   AADRKDAIAALVKKAVAAGADVIVTLGGASVGDHDLIHDVLTGEGMTLGFWKIAMRPGK
FT                   PLMFGRLGDIRCIGLPGNPVASLVCSQLFLKPLLARLGGRDHRQDIRPARLGAAMPAND
FT                   LRQDYVRAVVREDGGELVATPFSIQDSSMLRMLADANGLIVRAPFAPASAVGDSCSVLM
FT                   LR"
FT   CDS_pept        complement(483031..483885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0618"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48173"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48173"
FT                   /db_xref="GOA:Q98ME0"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ME0"
FT                   /protein_id="BAB48173.1"
FT                   /translation="MRFWGRVRMLEHRIADWNNAYANGANIAGSDRWPAAWAVPAQAFR
FT                   DALTAEGRARIDIAYGERPRNRFDLFLPKAAPQGLVVFIHGGYWLESDKSDWSHLAKGA
FT                   VDSGYAVAMPSYTQCPEIRIAGIVREIGAAIEKVAAMVDGPLMLTGHSAGGHLASRMVT
FT                   TSTPLAADVGKRIRHVVSISGLHDLRPLMRTAMNAALAIDETEAQAESPALLRPLDGAR
FT                   ITCWAGGGERSEFLRQNALLANIWTGLGAATSCVVEPDRHHYDIVDGLADPAHALTRTL
FT                   ISE"
FT   CDS_pept        484176..485801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0619"
FT                   /product="probable acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48174"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48174"
FT                   /db_xref="GOA:Q98MD9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MD9"
FT                   /protein_id="BAB48174.1"
FT                   /translation="MLGPSAHIDTFTRDHLPPPDQWPDFLLDGFDYPEHLNVGVELTDR
FT                   LVEKGLGDHTALIGNGRRRTYKELSDWTNRLAHALVENYDVKPGNRVLIRSANNPAMVA
FT                   CWLAATKVGAVVVNTMPMLRTGELTKIVDKAEITIALCDTRLMDEMTACAKDSTFLKQV
FT                   IGFDGTANHDAELDRAALDKPVTFTAVNTGRDDVALLGFTSGTTGVPKATMHFHRDLLI
FT                   IADAYAREILQVTPDDIFVGSPPLAFTFGLGGLAIFPLRFGAAATLLEQATPPNMIHII
FT                   ETYKATISFTAPTAYRAMLKAMDEGADLSSLRVAVSAGETLPAPVFEEWTEKTGKPILD
FT                   GIGATEMLHIFISNRFDDRKPASTGKPVGGYEARIVDDAMREVPRGETGRLAVRGPTGC
FT                   RYMADDRQKEYVRDGWNLTGDTFTQDEDGFFHFAARSDDMIVSAGYNIAGPEVEAALLS
FT                   HPDVAECAVIGAEDGERGQIVEAHVVLVQGVAPDALTVKRLQDHVKAMIAPYKYPRSIK
FT                   FIAALPKTQTGKIQRFRLRTEKIN"
FT   CDS_pept        485837..486634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0620"
FT                   /product="probable tryptophan 2,3-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48175"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48175"
FT                   /db_xref="GOA:Q98MD8"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR017485"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MD8"
FT                   /protein_id="BAB48175.1"
FT                   /translation="MSFNERMSYSDYLHLEKVLEAQTPLSSAHDEMLFIIQHQTSELWM
FT                   KLALHEIGAAIRSIRADRLEPSFKMLSRVARIFEQLNNAWDVLRTMTPSEYTEFRDALG
FT                   QSSGFQSWQYRAIEFMAGNRNLAMLGPHKHRPDLSGKLEAILAEPSLYDEALLLLARNG
FT                   FDIGADARRTDWRETRTENEEVLVAWQTVYRDPQRYWMFYELAEKLVDFEDYFRRWRFN
FT                   HVTTVERIIGLKRGTGGTSGASYLKKMLEVVLFPELWTVRTRL"
FT   CDS_pept        complement(486639..487886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0621"
FT                   /product="probable kynureninase (kyurenine hydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48176"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48176"
FT                   /db_xref="GOA:Q98MD7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MD7"
FT                   /protein_id="BAB48176.1"
FT                   /translation="MRAPLDLAAVEALDAADPLRAMRDRFILPEGVIYLDGNSLGAAAP
FT                   AVFNELQKAATQEWAQDLIRAWNTASWFDMPVALGDQLGRLIGAVSGQTVVCDTTSINI
FT                   YKVLHAALGMRPNRSVIVAEGDSFPTDLYMAEGVASTRPGTVLRLEGVDAPTIEELIDE
FT                   RVAVILVNHVNYKTGQLRDMAALTCKAHQVGALIVWDLCHTAGALPVELDAANADFAIG
FT                   CTYKYLNGGPGAPAFIYAAKRHHEDVHQPLSGWWGHARPFAFEQSYTAGSGIRRFLCGT
FT                   QPVLSMRALKGALDIWDDVDMAAVRKKSIGLTDLFIQLVEARCGAYGLELEGPRDGNAR
FT                   GSQVSFLHPHGYQVMRALIERGVIGDFRAPSTIRFGFTPLYVGYKDVWQAVEVLEDILR
FT                   TGAWQEARFAVKTAVT"
FT   CDS_pept        complement(487921..488844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0622"
FT                   /product="probable permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48177"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48177"
FT                   /db_xref="GOA:Q98MD6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MD6"
FT                   /protein_id="BAB48177.1"
FT                   /translation="MGFIQDVLSSFVAIMPVTLAQSLILAFVVLGIMIPFRMLNFPDLT
FT                   SEGAFPLGGCACGVLLAAGVSPLTCIVVAFGAGFAAGCCTAFIHLRFRIHTLLAGILMM
FT                   TMLYSINLRIMGKSNLSVFGSPTVFDWVPFARPGFPASKIVVAGLLALVVFAALYMFFR
FT                   TEKGTAVRAVGANPDMAEAQGINVWAATIGGVGLASAFSASSGALMVQSQGFADVNMGL
FT                   GILINGLAALMIGEAVVGKQTVWRQLLAPFAGAIIYYQLVSFCLAAGMPPPDLKLATGL
FT                   FVLAMLALPSLKRSRGPTPAREAIRE"
FT   CDS_pept        complement(488850..489629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0623"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48178"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48178"
FT                   /db_xref="GOA:Q98MD5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MD5"
FT                   /protein_id="BAB48178.1"
FT                   /translation="MLDIRSARKVFYKGQADEKVALDGLSLSLATGEFGIVIGSNGAGK
FT                   SSMLNAISGALVLDTGKILINGADVTAMPVYKRATRLARVFQDPMRGTAASMTVAENML
FT                   LADLRSQKRTLRQGLNATRLASYKERLSILGLGLENRLDTRVDLLSGGQRQSLSLIMAV
FT                   GGSPDLLLLDEHTAALDPRTAEIVMQATVRAVNALKLTTLMVTHNMQHAVDYGSRVIML
FT                   DAGRVLLEVTGEEKARVTVIDLIGHFSIKTDRMLLAS"
FT   CDS_pept        complement(489689..490678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0624"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48179"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48179"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MD4"
FT                   /protein_id="BAB48179.1"
FT                   /translation="MMLKSKSAWLSGLALAGALMVSVGSAAADQIRIGIANFGEHPQLN
FT                   AAIAGFKKALTDKGFVEGKDVVYTESHTNFDASLVPQMIAKLQAEQPKLIYTITTPVSQ
FT                   IAKKALAGSGIPIVFAAVTDPVAAKLVPSWDAGDEGMTGASDLQDVAAVMAFTKKLLPN
FT                   AKRFGVPYNPGEANDVALIEKIKAAAPAAGFEVVEVGVDNVNDIQQRIASLAGKVDVIY
FT                   GPASNLIQPAIAAVSAAARQAGIPVVNSDDSAVRNDTVPASFAVNYTQVGMNAGNIAAE
FT                   ILKGKDPKTIAPSRPAYKDHMATISRKAMAAFGIEIPASMADCGCIVD"
FT   CDS_pept        490823..491602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0625"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48180"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48180"
FT                   /db_xref="GOA:Q98MD3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MD3"
FT                   /protein_id="BAB48180.1"
FT                   /translation="MAMQDQNNSTKTEAAYQLLRRDILTTRLMPGAPLKLSALRGTYGV
FT                   GWTPLREALSRLEAERLVTAISNRGFAVAPVSRAELEDLARARMVVEMPLFLESIANGG
FT                   REWEDAVVTAHYRLSRCKTAVEDPSDAAVDKWDESHEAFHAALLSAATSNWLLRFRSTI
FT                   ADQLRRHHRFLGLAPTLRAAAGLKDGYGEAMDALREAIAIEHHTEIMEAALDRDVERAK
FT                   ALMTAHIGYTLHVYVHSEDNCANPYTARAGSLKAVSG"
FT   CDS_pept        491979..492716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0626"
FT                   /product="SOS response regulator; LexA"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48181"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48181"
FT                   /db_xref="GOA:Q98MD2"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MD2"
FT                   /protein_id="BAB48181.1"
FT                   /translation="MLTRKQHELLMFIHERLKESGIPPSFDEMKEALDLASKSGIHRLI
FT                   TALEERGFIRRLPNRARALEVLRLPDSIAPGLNAAKKFSPSVIQGSLGQGGLGRQIKPA
FT                   PSRLPAAGNDDDAVSAVSIPVMGRIAAGVPIDAIQHQTHSISVPPDMIMGGEHYALEVK
FT                   GDSMIDAGIFDGDTVIIRNADTASPGEIVVALVDEEEATLKRFRRKGASIALEAANPAY
FT                   ETRIFGPDRVKVQGKLVGLIRRY"
FT   CDS_pept        complement(492710..494971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0627"
FT                   /product="DNA uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48182"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48182"
FT                   /db_xref="GOA:Q98MD1"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MD1"
FT                   /protein_id="BAB48182.1"
FT                   /translation="MRRQLGRVSWPRLRYNAATAAELELDRGIAFLLVPVCLAAGAIGY
FT                   YSLAVEPDFAKPVAVVVLMVVCALVSRSWQKTHLGFMAALLCALGLLAAKVETWRAGTQ
FT                   MLGSEISTQVTGRVVSLDRMETGRIRLTIDVTSTARPKLRYAPERVRLSARDIPADMTA
FT                   GSLVTGYAKLLPPTGPVRPDSYDFSFDSYFAGIGGSGFFLGNPKLVSATDDEVPLTARL
FT                   FSGIENAREAIADHIRATVGGAEGEIAAALIVGVRAGIPDEINEAMRRTGIYHIISISG
FT                   LHMALVAGTIMGLLRGAFALFPDFSARRPVKKYAAAAALFSIAAYLVISGVVVAAERSF
FT                   IMLAVMLIAVLFDRAALTMRNLATSAIAVIVVSPHEVVGPSFQMSFAATAALVGAYAGW
FT                   ADHHAGKARPPPPKRSLPGFLTRKFLLATGGLAMTSIIAGCATALFAIWHFQRVSPLSL
FT                   FANLAVMPIVSVVMFLAVASALLMPFGLDAPTLYLMGKGLTAMIAISAWISERSPVDAV
FT                   GLISLQSVLLVTIALVIATMATTWLRLAAVPFALAGLLTVSDTRTPDVLISEDARLVAL
FT                   PIGGGELAVSRARPNEFTVDNWKRALVSETIVVPEMFDKADGQFDIADAVNLPPGAPFY
FT                   CTDGVCLARHPSGAIIAHVEDRKDTWKACGFADLIVVNDATGYDACHNPLVLVVTKRQL
FT                   ARKGSAAVFFDRQSATGPLTVSFAVDGPYRPWHEQRKFSREARGLPPYQKAEKPAAPAQ
FT                   "
FT   CDS_pept        495266..496690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0628"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48183"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48183"
FT                   /db_xref="GOA:Q98MD0"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MD0"
FT                   /protein_id="BAB48183.1"
FT                   /translation="MSDKVVTRFAPSPTGYLHIGGARTALFNWLYAKHTGGTMLLRIED
FT                   TDRERSTAAATAAILDGLSWLGLGWDGDAVSQFERAPRHREVAEELVRMGKAYYSYETP
FT                   AELEAMREAARAKGLPPRYNGQWRDRTPSEAPAGVKGAIRIKAPTEGETIVHDRVQGEV
FT                   RFPNKDLDDFIILRSDGNPTYMHAVVVDDHDMGVTHIIRGDDHLTNAARQTVIYNAMGW
FT                   DVPSMSHIPLIHGADGAKLSKRHGALGVEAYRAMGYLPEALLNYLARLGWSHGDDEIMS
FT                   IKDMISWFDIGDVNKGAARFDFAKLEAINGAHMRRMADAQLLDIFIATLPYLEGGPAMA
FT                   ARLNEHNKAQLLAALPGLKERAKTLVELVDGAAFLFATRPLPVDEKAALLLNDGARKIL
FT                   RGAHEALNALSGDWTAAAAEAAVRDYALAGGHKLGAVAQPLRAALTGKSTSPGVFDVLA
FT                   VLGREESLARIADQID"
FT   CDS_pept        496901..498202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0629"
FT                   /product="citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48184"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48184"
FT                   /db_xref="GOA:Q98MC9"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MC9"
FT                   /protein_id="BAB48184.1"
FT                   /translation="MGGANQEATATLQFAGKTHEFKVRSGSVGPDVIDIASLYSTTGAF
FT                   TYDPGFTSTASCESEITFIDGDAGILLHRGYPIDQLAEHGDFLEVCYLLLYGELPTKAQ
FT                   KDDFDYRVTRHTMVHEQMSRFFTGFRRDAHPMAVMCGVVGALSAFYHDSTDISDPYQRM
FT                   VASMRLIAKMPTIAAMAYKYHIGQPFIYPKNDLGFAANFLHMCFAVPCEEYKINPVLAR
FT                   AMERIFILHADHEQNASTSTVRLAGSSGANPFACIAAGIACLWGPAHGGANEAALNMLG
FT                   EIGHVDHIPEFIARAKDKNDPFRLMGFGHRVYKNYDPRAKIMQKTAHEVLGELGIKDDP
FT                   LLDIAMELEKIALTDPYFIEKKLYPNVDFYSGITLKALGFPTTMFTVLFAVARTVGWIA
FT                   QWKEMIEDPRQKIGRPRQLYTGAPERDYVPIAKR"
FT   CDS_pept        complement(498236..499408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0630"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48185"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48185"
FT                   /db_xref="GOA:Q98MC8"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MC8"
FT                   /protein_id="BAB48185.1"
FT                   /translation="MADRVLKIAIVAGEESGDLLGADIVRSLRQITGREVRLVGLGGRH
FT                   LGELGLVSPFDAGEIALMGFSAVLRDLPRLIRRIGQLAKTIAEEKPDCLVTIDSPDFSL
FT                   RVARKVRAANPSIPIIHYVCPSVWAWRPGRAVAMKPYVDHILCILPFEVKELDRLGGPP
FT                   GTYVGHRLTHDVGVLAAQKAQALPRDLAQDRIKTLLVLPGSRRGEVRRLIEPFGETVSM
FT                   LRARGHRLRLQLPTVPHVADLVKSSVNRWDEKPEIIVDPQRKWQAFGKADAALIASGTV
FT                   SLELALAGVPMVSSYRLDPIARAVAPYLVSVWSALLPNLISDRALIPEFYNEYVKANNL
FT                   ARQLEALFADSGMRAWQKDGFAEIARRMATDKPSGEIAAGVVLRHIKKAP"
FT   CDS_pept        complement(499401..500315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0631"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48186"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48186"
FT                   /db_xref="InterPro:IPR010415"
FT                   /db_xref="InterPro:IPR041255"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MC7"
FT                   /protein_id="BAB48186.1"
FT                   /translation="MATIPTMKTETASAGLDLPPDARVGIIAGGGSLPVEVAAGSAGQG
FT                   YPPFIVLMEGEADRLTELCQYEHETLALEAIGSLVPLLKRHRITHLVLAGEIKRRPRLT
FT                   HLRPSLSLLAVIPIVVMALARGDDGLLKVVARGLEARGIKIMGAHEIVPNLVAAEGVLT
FT                   KAVPQKSDWRDIEAGFAAAKAIGALDIGQAAIAVGGRAIALEGIEGTAGLLDRAKLLRG
FT                   HGRIAGKTRGVLVKCAKPGQELRADLPSMGPQTVEAAHAAGLAGIAVEAGRSLILEGPA
FT                   TLSRANELGLFIVGLAAAEPAYG"
FT   CDS_pept        complement(500287..501126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0633"
FT                   /product="acyl-(acyl-carrier-protein)-UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48187"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48187"
FT                   /db_xref="GOA:Q98MC6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MC6"
FT                   /protein_id="BAB48187.1"
FT                   /translation="MLMKIKTSIHPSSVVEEGAQIGEGVRIGPFCHISADAVIGDGVEL
FT                   VSHVSVMGATTIGASTKVYPMATLGAPPQNTKHKGGRTTLVIGANCTIREGVTMHVGTD
FT                   TSRGETTVGDNGNFLAYAHIAHDCVVGKNATFANGATLGGHCEIGDNVYIGGLSAVHQF
FT                   VRVGDNAFLGGCSAFVGDVIPYAIAVGNRASLRGLNIIGLKRAGLPRSEIYLLRKAYRT
FT                   IFDRSRTVGENIEFAKAEFASSPTAMKIIDFISSRGKRHYAVPSLKGGDGDDTDDED"
FT   CDS_pept        complement(501134..501592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0634"
FT                   /product="(3R)-hydroxymyristoyl-[acyl carrier protein]
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48188"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48188"
FT                   /db_xref="GOA:Q98MC5"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MC5"
FT                   /protein_id="BAB48188.1"
FT                   /translation="MVAATTLEAVDIMGLMKLLPHRYPFLMIDRIIDIDGDDSAIGIKN
FT                   VTINEPHFQGHFPEQPVMPGVLIVEAMAQTAGAICIRSLGASKPSLVYFLTIDNAKFRK
FT                   PVVPGDQLKIHVKKIKKRGNLLKFACEALVDGTKAAEAEISAMMVTGD"
FT   CDS_pept        complement(501594..502649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0635"
FT                   /product="UDP-3-o-[3-hydroxymyristoyl] glucosamine
FT                   n-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48189"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48189"
FT                   /db_xref="GOA:Q98MC4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MC4"
FT                   /protein_id="BAB48189.1"
FT                   /translation="MTDPVFFAPSRRYTAAEVANLTGSVLVDSGQSDVSIEALAPASEG
FT                   GANALVFVDGRRNSALMPSLRAAAVLCPAEFANKAPSSVAVLIHPRPQQAFALVGRLLF
FT                   PTAATPGPMTSETGVSAHAHIDPTAHVEAGAIIEAGVVIGPGVSIGSGTVIAPNAVIGQ
FT                   SCQIGRDGYVGPGASIQYALIGNRVIIHGGARIGQDGFGFVGGAKGPERVPQIGRVVIQ
FT                   DDVEIGSNSTVDRGAMSDTIIGQGTKIDNLVQIAHNVRIGRNCIVAGLSGISGSVVVGD
FT                   NVTMGGGVGLADHLTIGSGAKLAARSGFMSNVPAGEIWGGYPAQPMAEAMREIAMLRTM
FT                   ARARKQGKDNG"
FT   CDS_pept        complement(502725..505109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0636"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48190"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48190"
FT                   /db_xref="GOA:Q98MC3"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MC3"
FT                   /protein_id="BAB48190.1"
FT                   /translation="MKAASKFLSAASAAALSAALVVPGALAVQFVATSAAEAAVVSRVE
FT                   VSGNQRVDADTIRNYITIKPGKAFSSSDVDAAVKALFGTGLFSDVQINQVGSTLVVKVA
FT                   EYKVVNQVLFQGNKKLKDNALAAAVQLKPRGTFSQATLDSDVEAVKAAYRRIGRDDAGV
FT                   TTQVMELGDNRVNVVFHITEGDRTQIAAINFVGNSAYSSRRLSDVINTKRSSWVSFILR
FT                   DDVYDEDKLRADQELLRRFYYNHGYADFQVVSAVGELDNATNKYTVTITVQEGERYNFG
FT                   DISVESTIPEVDSKSLESVVETHKGDVYNAKDVEDSIIALTEKVAGSGYAFAQVTPRGD
FT                   RNFENHTISVVYTVDQGTKAYIERIEIRGNDRTRDYVIRREFDVSEGDAFNQVLIQRAK
FT                   KRLEDLNYFDKVEISTVPGSQPDQVVLVVDVVEKSTGEFSVGAGYSTGGDSAGPSVEGS
FT                   ITERNFLGRGQFIKLSAGGGKNSRDYSVSFTEPYFLGRRIAAGFDIYKSTREYNNNYDS
FT                   DTVGATVRFGLPITNSITTQLAYNISQEKYKVDNSCGPTDPPNPPGGTCNISQAILDGI
FT                   AESPWIKSSVSLGLVYNTIDDMKNPHEGIYANTTVEVAGVGGDAKFVKITGRGSIYQTL
FT                   SEQLDLVGLISGGAGHVEGYGNDGDLRIFDHFQSTDRMIRGFAYGGIGPVASGTSGDHL
FT                   GGTTYFNASAEAQFPLPVIPESFGLRGAVFADAATLYGNKIADQTLVDQDSTGMKLRAS
FT                   VGVGLMWASPFGPIRIDYAIPVRKEASDDVQEFNFGISTRF"
FT   CDS_pept        complement(505230..505322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0637"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48191"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48191"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MC2"
FT                   /protein_id="BAB48191.1"
FT                   /translation="MKKFGFGMVDVETPFTMHGDMSDAKATHQG"
FT   CDS_pept        complement(505327..506367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0638"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48192"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48192"
FT                   /db_xref="GOA:Q98MC1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MC1"
FT                   /protein_id="BAB48192.1"
FT                   /translation="MGHYLVGRWCGIGVRAFSIGFGPELIGFNDRHGTRWKLCAIPLGG
FT                   YVKFVGDMNATSSQPTSEELETLTDEERKVAFHTQAIWKRAATVVAGPLFNFLLTIVVF
FT                   SVLFASYGRYVAEPMVAEVTADSPAAKAGIQPGDRFVSVDGSKVETFGDVQRLVSGRAG
FT                   DTITFVMLRDGKEVTVTATPQLMEQQDALGNKVKVAVIGVVNNKELGQPRLITYTPVGA
FT                   VAAAVEETGHVIQRTGQFLQRFAVGREDKCQLGGPVKIADMAGKAAKLGFEWLVQLVAL
FT                   LSVGIGFLNLLPIPPLDGGHLLFYGVEAVIRRPVSERMMEMAYRAGLLLVLCFMGFVFW
FT                   NDLFGC"
FT   CDS_pept        complement(506565..507380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0639"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48193"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48193"
FT                   /db_xref="GOA:Q98MC0"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MC0"
FT                   /protein_id="BAB48193.1"
FT                   /translation="MSNLQLRVISAVVLAVIALGLTWLGGLPFRLLCAAMSAMIFYEWT
FT                   RMSRPAAANGLSFLPEALVVVFIGALIAGLAASWLLLLVVVLIAVTAIAALVRKAGQWE
FT                   VSGLAYASVSGLSLALLRDGDHSGLVAILFLFAVVWATDIFAYFVGRAVGGPKLAPSIS
FT                   PGKTRSGALGGAFGGVVAGVMLAAGAGAGNLALLGLVALALSIVAQAGDLFESWVKRRH
FT                   GRKDSGVLIPGHGGVMDRVDGLVAAALALYVIGWISAGADHPAQGLFPI"
FT   CDS_pept        complement(507377..508111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0640"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48194"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48194"
FT                   /db_xref="GOA:Q98MB9"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MB9"
FT                   /protein_id="BAB48194.1"
FT                   /translation="MTTPAHVAIIMDGNGRWAKARGMPRLAGHRAGVEALRKTVRAAPD
FT                   LGISFLTVYAFSSENWSRPKAEVSDLMGLLKLFIRRDLAELHQSGVRVRIIGDRAGLQA
FT                   DIRGLLEEAESLTARNESLTLVIAFNYGGRDEIVRTARKLASAAARGEIDAESITADSF
FT                   AGGLDTQGIPDPELVIRTSGELRLSNFLLWQAAYSELVFLPCYWPDFSREHLAEALREF
FT                   AGRERRFGGLGQQDVASRPAAG"
FT   CDS_pept        complement(508144..508698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0642"
FT                   /product="ribosome releasing factor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48195"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48195"
FT                   /db_xref="GOA:Q98MB8"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MB8"
FT                   /protein_id="BAB48195.1"
FT                   /translation="MSGEYDDLKRRMDGAIAAFKHDLASLRTGRASSNLLDAIQVQAYG
FT                   TTMPINQVANVTVPEPRMISVSIWDKSMVGAVDRAIRESNLGFNPIVDGTNLRIPLPEL
FT                   NEQRRKELVKISHGYAENARVAARHVRRDGMDFLKKAEKDGVISEDDQRKRSDQVQKLT
FT                   DETISTIDHLLSDKEAEIMQV"
FT   CDS_pept        complement(508808..509551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0643"
FT                   /product="uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48196"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48196"
FT                   /db_xref="GOA:Q98MB7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MB7"
FT                   /protein_id="BAB48196.1"
FT                   /translation="MQNDEDQMTVKPLYRRVLLKASGEALMGEQHFGIDVSVVDRIAAD
FT                   IAEARGLGIEVGVVIGGGNIFRGVAVASKGGDRVTGDHMGMLATVINSLALRTSLHKIG
FT                   VDAVVLSAIAMPELCESFSQRQADAYMNQGRVVIFAGGTGNPFFTTDSAAALRAAEIGA
FT                   DALFKGTQVDGVYSADPKKDPNATRFERISHAEVINRGLSIMDTAAIALARENNIPIIV
FT                   YSIHEKGGFGDILRGGGRCTVVADD"
FT   CDS_pept        complement(509691..510800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0645"
FT                   /product="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48197"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48197"
FT                   /db_xref="GOA:Q98MB6"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MB6"
FT                   /protein_id="BAB48197.1"
FT                   /translation="MTMTYYTLGNSGLRVSRLALGTMTFGKEWGWGADRDTARAMFDAY
FT                   VEAGGNFFDTADLYTGGTAEAWLGEFIAERGLRDTAVIASKFTMNMQPGNPNAGGNGRK
FT                   NILRAVDASLKRLGTDYIDLYLMHVWDRLTPAEEVMRTLDDLVRMGKVRHVGLSDVPAW
FT                   YAGRAQAIAELRGYEPVSALQLEYSLAERAIENEFVPFGTRHGAGIMVWSPLASGLLSG
FT                   KYRPAQAGNAGRLDGFRNSTHPGFQKFTERNWAIVAELEKVASELGRGMPQVAINWVAT
FT                   QPGIATVILGATTLAQIQDNLGALDFEIPATLRDRLDSVSRTPAPFPYSYFGPQIQARV
FT                   TGGAATGDKPSGYASPVLVEGEPASVSTD"
FT   CDS_pept        complement(510838..511434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0646"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48198"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48198"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MB5"
FT                   /protein_id="BAB48198.1"
FT                   /translation="MVHIVPNSDWLMAPRRRDMNALKHVTFAAGMALAPIDAGGAEPAG
FT                   WQALADERAVIRIADAIDRAVDAQDWTLARSYFADRVTADFSSLSGQPAANIASDDLIG
FT                   AWAGNLKGSKTSLHLRTNHQVVLEADTATVRSNGYAWNRMEGNGDPLWEVWGTYEHHLT
FT                   RSAAGWKVDGFAFHMTHERGNPWVKATPGNDTAGQ"
FT   CDS_pept        511492..512427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0648"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48199"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48199"
FT                   /db_xref="GOA:Q98MB4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MB4"
FT                   /protein_id="BAB48199.1"
FT                   /translation="MDRDLLTHLPVIVAVARRGGFALAAAELGMSPSAVSHAVRLVEER
FT                   IGQPLFARTTRSVSLTEAGKALVETAAPALQDIGERIDQIRSVKGRPSGLLRINASTIA
FT                   IPLAVTPVVAAMAERYPDVTVEIFADQGLVDIVGEGFDAGIRLGEMIAQDMVAVRLTPP
FT                   FRTIIVASPAYIGRHGRPRSVADLANHNCIGYRLIRSGALYRWDLAEDGKDVIMETGGT
FT                   AIVTDSLAAIDLALAGVGLAYMFEPLARADLAAGRLVQVLPQSAIEEPGLFLYFPRRAA
FT                   MAPKLRAFIDTAQEIGRTSLRTSGRKTLSE"
FT   CDS_pept        complement(512441..513361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0650"
FT                   /product="elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48200"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48200"
FT                   /db_xref="GOA:Q98MB3"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MB3"
FT                   /protein_id="BAB48200.1"
FT                   /translation="MSISAAQVKELRDLTGAGMMDCKAALNETNGNMEEAVDWLRKKGI
FT                   SKADKKAGRTAAEGLIGVDAGVREAAVVEVNSETDFVARNAAFQEIVANVAKVALAYGT
FT                   TEAVAAAKYPGSDKSVTDTIKDAVGTIGENLGFRRSAKLTVPHGAVATYVHNAVADGLG
FT                   KLGVLVAIETTGNEHAANAFGRQVAMHVAATNPMALTAEQIDPAAVEREKAIFSDQARQ
FT                   SGKPEAIIEKMVEGRMRKFYEEVVLLKQAFVLNPDITVEKALKDAEKEIGAPAKITAYL
FT                   RFALGEGIEKEETDFAAEVAAAVKK"
FT   CDS_pept        complement(513472..514254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0651"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48201"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48201"
FT                   /db_xref="GOA:Q98MB2"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MB2"
FT                   /protein_id="BAB48201.1"
FT                   /translation="MALPDFSMRQLLEAGIHFGHQTHRWNPKMAPYIYGARNNIHIIDL
FT                   SQTVPLLHQALKQVSDTVAKGGRVLFVGTKRQASDIVADAAQRSAQYYVNSRWLGGMLT
FT                   NWKTISNSIQRLRKLDEMLAGEAQGLTKKERLNLDREREKLDKALGGIKDMGSTPDLMF
FT                   VIDTNKEAIAILEAKRLGIPVVAIIDSNCDPDKIDFPIPGNDDAARAIQLYCDLIAKAA
FT                   IDGIARQQGALGVDIGASVEAPVEPALDPAPSTEAPQA"
FT   CDS_pept        complement(514433..515044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0653"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48202"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48202"
FT                   /db_xref="GOA:Q98MB1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MB1"
FT                   /protein_id="BAB48202.1"
FT                   /translation="MTPTAFLAYCAAVTLAAATPGPAMFTVITNGVSRGFLRAFMAGVG
FT                   VAAGDAVLVTLALLGLVALAQTFEWIFLLLKYAGAAYLIFLGIRMWRASATQSNEPRTG
FT                   EARLSRSFFLGASIALGNPKAILFHASIMPLILNLDTLTFVDGLLVVATVISVNILTMG
FT                   VYAALAGRASGWFRTPKRMRLMNRFAGSAMIGTGALIAAR"
FT   CDS_pept        complement(515041..515319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0655"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48203"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48203"
FT                   /db_xref="InterPro:IPR025109"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MB0"
FT                   /protein_id="BAB48203.1"
FT                   /translation="MAVYVDAAIWRWAGHRWCHLMADDTDELHRFAAALGVKRSSYQGP
FT                   PKTSAPHYDITGFERDRAVRLGAIECSREEIVAIFRRVRVPNGKAKR"
FT   CDS_pept        complement(515354..516184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0656"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48204"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48204"
FT                   /db_xref="InterPro:IPR015000"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MA9"
FT                   /protein_id="BAB48204.1"
FT                   /translation="MRAARLAFHAVLLSAVFPIVPAFAVPALQAHRAVYDLTLKKADDR
FT                   SGITGISGRMVYEFNGSACEGYTVKFRFVTQIVTAEGTKLTDQQTTTFEDAEGKTFSFV
FT                   TKSFVDQNLDKEVKGIATKDAKGLKVDIDKPEKNSLELAATQFPTQHLVELIGKAEKGE
FT                   NFYQTNLFDGSEDANKVMTTTVVVGKKTEADKVDPEAPALAKLATDKYWPVDIAYFDDK
FT                   AQNGEEVPEYRISFKLHENGITRDLTMDYGDFSMTGKLVNLSLFDQTKPCPASK"
FT   CDS_pept        516323..516787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0658"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48205"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48205"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MA8"
FT                   /protein_id="BAB48205.1"
FT                   /translation="MSETIEKRLSDLGVTLPVAAAPAANYVPYCRSGNLLFTAGQLPLK
FT                   DGKLQASGLLGRDVDTASGKEAAKYCAINILAQARAALGDLEKISRLVKITVFVASAPD
FT                   FVEQHLVANGASDFLVAALGERGKHARSAVGTTSLPLNAAVEIEAIFEVE"
FT   CDS_pept        516801..517529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0660"
FT                   /product="probable phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48206"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48206"
FT                   /db_xref="GOA:Q98MA7"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MA7"
FT                   /protein_id="BAB48206.1"
FT                   /translation="MTDLSWLTARPVAHRGFHDMNKTRWENTLSAFTAAAERDYAIECD
FT                   VHLSSDGVPIIIHDDDLKRLTGQDGFVWQRSAAELTALKVGGTSDRVPTLQEALDLVDG
FT                   RVPMVVELKGIPGRDEGLVARVGNMLKRYKGKAAIMSFDHWLIREFPKHAPGIPAGLTA
FT                   YGKDLKLIEAHFSMLAHELSFTSYAAGDLPNPFVSFVREKLKMPVITWTVHDQPAIDLT
FT                   FKYADQMTFEGFEPELVKVA"
FT   CDS_pept        517585..518799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0661"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48207"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48207"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MA6"
FT                   /protein_id="BAB48207.1"
FT                   /translation="MDQGDDGDGQTANADYSIRIAAGIGAFTCDEWNGFAGTTRSDAEN
FT                   GYNPLVSFAFLSALEDSGCAVRRTGWQGHHVRLETAQGRLLGAVPCYLKSHSQGEYVFD
FT                   HGWSDAFERAGGRYYPKLQCAVPFTPVTGPRLLVNRGEDPDAVKAGLAAGLKMVTDKLG
FT                   VSSAHVTFAQESDVATLEAAGFLHRTDQQFHFFNEGFSTYDDFLATLASRKRKAMKKER
FT                   REALADGITIDWLTGKDLTEKAWDDFFAFYMDTGSRKWGRPYLNRQFFSLIGERMADDI
FT                   LLVMARRNGRYVAGAINFIGSDALYGRNWGCIEDHPFLHFEVCYHQAIDFAIERKLKVV
FT                   EAGAQGEHKLARGYRPVTMHSAHYISHPGLRNAVADYLQRERREVERMGEYLEEHTPFR
FT                   KDLEE"
FT   CDS_pept        518908..519339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0662"
FT                   /product="probable Hit-like protein involved in cell-cycle
FT                   regulation"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48208"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48208"
FT                   /db_xref="GOA:Q98MA5"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MA5"
FT                   /protein_id="BAB48208.1"
FT                   /translation="MAETAYETDNIFAKILRGEIPSHRVYEDDAVVAFMDVMPQGPGHT
FT                   LVVPKAPSRNLLDANPSTFGPLFNVVQKVAQAVKKALNADGVTILQFNEPASGQTVYHL
FT                   HVHVIPRFDGIPLKPHTGTMEKPEVLVEHAEKIRAALGS"
FT   CDS_pept        complement(519507..521975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0663"
FT                   /product="endopeptidase Clp ATP-binding chain A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48209"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48209"
FT                   /db_xref="GOA:Q98MA4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MA4"
FT                   /protein_id="BAB48209.1"
FT                   /translation="MPAFSQGLEKALHQALTLANERHHEYATLEHLLLALIDDTEAAAV
FT                   MRACNVDLDELKHTVLTYIDTELDNLVTGYDEDSKPTAGFQRVIQRAVIHVQSSGREEV
FT                   SGANVLVAIFAERESHAAYFLQEQQMTRYDAVNYISHGIAKRPGASETRSPRGADDEQG
FT                   GQNGAEPQEEGGKKKQQQDALTAYCVNLNNKAKAGKIDPLIGRESEINRTIQVLCRRSK
FT                   NNPLYVGDPGVGKTAIAEGLAKRIVEGDVPEVLHNATIFALDMGTLLAGTRYRGDFEER
FT                   LKQVVKELEDYPGAVLFIDEIHTVIGAGATSGGAMDASNLLKPALSSGAIRCIGSTTYK
FT                   EFRQFFEKDRALVRRFQKIDVNEPTIEDAIEIMKGLKPYFEEFHKVRYTSEAIKASVEL
FT                   SARYINDRKLPDKAIDVIDETGASQMLVPEAKRKKTIGIKEIEATIATMARIPPKTVSA
FT                   DDEKVLQGLDIELKRVVYGQDTAITALTSAIKLARAGLREPEKPIGSYLFSGPTGVGKT
FT                   EVAKQLAASLGVELIRFDMSEYMERHTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVL
FT                   LLDEVEKAHPDLFNILLQVMDHGKLTDHNGKQIDFRNVILIMTTNAGASDAQRAAIGFG
FT                   STKREGDDVEAINRLFTPEFRNRLDAIIPFGSLPVPVIHQVVQKFVMQLEAQLSERGVT
FT                   FDLSPDAIAWLADKGYDERMGARPLGRVIQEHIKKPLADEVLFGKLKKGGTVRVTVEKK
FT                   ETGETGLKLESLADEAPVKPKKEEPEDAPKPPKAVAKKPAAKKVVAQKPEPKGKDGGKR
FT                   SLVPQLPRKG"
FT   CDS_pept        complement(521982..522311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0664"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48210"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48210"
FT                   /db_xref="GOA:Q98MA3"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MA3"
FT                   /protein_id="BAB48210.1"
FT                   /translation="MQNGGGDGNEAGRGTAVITRTKTKTKKPSLYRVLILNDDYTPMEF
FT                   VVHVLERFFQKDREAATRIMLHVHNHGVGECGVYTFEVAETKVSQVMDFARQNQHPLQC
FT                   VMEKK"
FT   CDS_pept        complement(522590..522919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0665"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48211"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48211"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MA2"
FT                   /protein_id="BAB48211.1"
FT                   /translation="MTQTYEDFSKYGKEFADTGLKSFASLSKGAQAIATEAGEYTKKSF
FT                   EAGSAAVEKLFSAKSLDKAIEIQTDYAKQSYEAFVAEATKIGDLYAELAKEAYKPFESI
FT                   VAKAK"
FT   CDS_pept        523205..524662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0666"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48212"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48212"
FT                   /db_xref="GOA:Q98MA1"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MA1"
FT                   /protein_id="BAB48212.1"
FT                   /translation="MRKALLGIVSKSTSPLKAMMVFALAMTFVCADVASSLAARPAAIV
FT                   VDAKTGKVLYSADANGRRYPASLTKMMTLYLTFEAMAKGKISRNTPVVFSAKASAEAPT
FT                   KLGVKPGGSVSVETAILSIVTKSANDSATALGEMLGGDETTFARMMTAKARALGMNGTV
FT                   FRNANGLPDPGQFTTARDMATLGIALREHFPQYYGYFSQRSFLYGRQRINGHNRLLGRI
FT                   KGVDGIKTGYTRASGFNLVSSVSDGNRRLVAVVMGGTSGGSRDNQMASLINTYMPRAST
FT                   RGGGDLVAKADSSNPVKALAKVLLPKHDAPTPDDKPVAVANADDAVADDATAANDATVA
FT                   EDDNADNDAQAEAPTLVAPAKKVKTVIVSAPKVATAQVVAAYAEPAPAAAPTPTVDPVN
FT                   TASVPSGWAIQVASSEKQSEAQAVLDKTSKQAPKVLADAAGFTVAFDKDGVTYYRARFG
FT                   GFGSKDAAWKACTALKKKKIECYAVQQ"
FT   CDS_pept        complement(524708..525409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0667"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48213"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48213"
FT                   /db_xref="GOA:Q98MA0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MA0"
FT                   /protein_id="BAB48213.1"
FT                   /translation="MLGAIIGLVALLLVLLGVASAFLRADPARLATGMRTLGPILLALV
FT                   GAAVLLVGRSGIGGVMLFVAIGWYAATRANRPDVKPVPGKRSTVRTAALEMELDHDTGG
FT                   LEGLVLAGRHDGKMLGAMGLAELQHLYRELSGDAESRQLLETYLDGRFPVWRKNTETNG
FT                   GEGLGVAPGPGAMTKEEAYKVLGLEAGAAAADVRKAHRRLMQRLHPDVGGTSFLAARIN
FT                   EAKDVLLSNHN"
FT   CDS_pept        complement(525686..526123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0669"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48214"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48214"
FT                   /db_xref="InterPro:IPR008320"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M99"
FT                   /protein_id="BAB48214.1"
FT                   /translation="MALNLLKLCVGCDSVEDLEEWIEFRLDERRRAGEPAEHWHTTRMV
FT                   PTRGAEITDGGSLYWVIKGNVQCRQLITEIRPFTDDEGIGRCHLMLDPHVVRTDWQPRR
FT                   AFQGWRYLKPSDAPPDLGKGKAGMVEMPPKLRRELADLGLL"
FT   CDS_pept        complement(526193..527596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0670"
FT                   /product="L-serine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48215"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48215"
FT                   /db_xref="GOA:Q98M98"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M98"
FT                   /protein_id="BAB48215.1"
FT                   /translation="MFLSVFDLFKIGIGPSSSHTMGPMTAARRFLDEVAGDDWPRPTGA
FT                   KVARIGASLHGSLAYTGIGHGSDRAVILGLAGQTPQTVDPDQADGIIGRITADRMISPP
FT                   GHPSYHFDPATDLVLDRKTPLTGHANGMAFYAYDASGRLLLKRIYYSIGGGFVVSEEEL
FT                   QRMKAKGSVTSEGKKVPYPFKNAVEMLKMAAKSGLSIAEMKRVNEETQMSREDLDAGLD
FT                   AIWGAMKSCIDRGLSQDGIMPGGLKVRRRARQLHDKLQEQWQQNRPNPLLANDWLSIYA
FT                   MAVNEENAAGGRVVTAPTNGAAGTLPAVLRYWLHFHPEADQPSIRDFLLTAAAVGGIIK
FT                   TNASISGAEVGCQGEVGSASAMAAAGLCAVMGGTPEQVENAAEIALEHHLGMTCDPVGG
FT                   LVQVPCIERNALGAVKAVTAASLAIKGDGIHFVPLDAAIETMRQTGLDMNEKYKETSLG
FT                   GLAVNVVEC"
FT   CDS_pept        527770..528489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0671"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48216"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48216"
FT                   /db_xref="GOA:Q98M97"
FT                   /db_xref="InterPro:IPR006747"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M97"
FT                   /protein_id="BAB48216.1"
FT                   /translation="MGDSFYLSMADLGALAFFLIVWLLHTLASDGKLVSRMSLTTAMNA
FT                   QREAWMRTMAEREIRIVDTAIMSGLQQGTAFFASSSLIALGGCFALLGASDRVLEVLSN
FT                   LPLGGAPSRPAFQIKVLGLVLILAFSFFKFGWAYRLFNYCSILIGAVPIPHGEASRNPV
FT                   TQTAVWRAAQMNMLAGKHFNSGLRGVFFSIGYLGWFVDPVVFVLSTLLLLAVLVRRQFF
FT                   SAARRAVIGQPPGPGKG"
FT   CDS_pept        complement(528462..529259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0674"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48217"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48217"
FT                   /db_xref="GOA:Q98M96"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M96"
FT                   /protein_id="BAB48217.1"
FT                   /translation="MFFLLSKVFWFFVQPLNLTIFLLLAGLIAGMIGRRRLAVTGSVLA
FT                   FLILALSTWTSLGAMMLNPLEERFPRPPLPQKVDGIVVLGGGFEGAINLARGGYELSSS
FT                   GDRMVETAILARRFPLAKVVVSGGHGAFFIDAEGDADSASRMLVPLGVSADRLVLEDKS
FT                   RNTYENAIFSRKLVEPKPGETWLLVTSAFHMPRAKALFDKAGFPTVPWPVDYHTSGKEG
FT                   VGLFRDNAIDSVQNTTIALREWIGLFAYWLSGRIDQPFPGPGG"
FT   CDS_pept        complement(529288..530853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0675"
FT                   /product="Glu-tRNA(Gln) amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48218"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48218"
FT                   /db_xref="GOA:Q98M95"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M95"
FT                   /protein_id="BAB48218.1"
FT                   /translation="MSDLTRLTISQARAKLRGKEITATEITEAYLSAIDRANPALNAYV
FT                   AVTGDRARDMAKASDARLVKGEGGALEGIPLGIKDLFGTEGVHTQACSHVLDGFKPLYE
FT                   STVTANLWADGAVMLGKLNMDEFAMGSSNETSYYGPVINPWRRSRLDTVVMPTTHQGDG
FT                   GFVSAGGTKTQRSLDNAQLVPGGSSGGSATAVSAFLCAGATATDTGGSIRQPAAFTGTV
FT                   GIKPTYGRCSRWGIVAFASSLDQAGPIARDVRDAAILLKSMASVDPKDTTSVDRPVPDY
FT                   EAAIGKPIKGMKVGIPKEYRVDGMPEEIEALWQKGIAWLRDAGAEIVDISLPHTKYALP
FT                   AYYIVAPAEASSNLARYDGVRYGLRVPGKDIVEMYEKTRAAGFGREVKRRIMIGTYVLS
FT                   AGYYDAYYLQAQKVRNLIKRDFENVFAAGVDVILTPATPSAAFGIADEDMAADPVKMYL
FT                   NDIFTVTVNMAGLPGIAVPAGLDPKGLPLGLQLIGRPFEEETLFQTAAVIEQAAGTFQP
FT                   EKWW"
FT   CDS_pept        complement(530853..531308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0676"
FT                   /product="acetyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48219"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48219"
FT                   /db_xref="GOA:Q98M94"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M94"
FT                   /protein_id="BAB48219.1"
FT                   /translation="MAIEIAIETPLQDDVRGLVKELNETLLELTPPEHCYHLTVEQMAG
FT                   QDTTVFIARDNGIAVGCGALKRHGGAIGEVKRMYTRPSHRGQKIGASIVERVEALARQE
FT                   GLKRLVLETGDRHPAAWTVYERAGFSRCGPVLDYPDSKWSVFYEKSL"
FT   CDS_pept        complement(531316..531603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0677"
FT                   /product="Glu-tRNA(Gln) amidotransferase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48220"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48220"
FT                   /db_xref="GOA:Q98M93"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M93"
FT                   /protein_id="BAB48220.1"
FT                   /translation="MSVDLQTVKRVARLARIAVSEEDAERMTGELNAILGFVEQLNEVD
FT                   VSGVEPMTSVTPMEMKKRQDVVTDGNKAADIVANAPATEENFFLVPKVVE"
FT   CDS_pept        complement(531729..532121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0679"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48221"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48221"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M92"
FT                   /protein_id="BAB48221.1"
FT                   /translation="MSMFVAASPALAADDFIEGVYLQSEELCTQARKDTLQTLIDAGNI
FT                   VLSVHGLQGVEYNCEFVQVSKATRSPSWAVTAICQEPGYVFPDVLSMTRISPTQLDLVS
FT                   VRPIDDESEASGNSGSYYLCEGVALP"
FT   CDS_pept        complement(532170..532877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0680"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48222"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48222"
FT                   /db_xref="GOA:Q98M91"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M91"
FT                   /protein_id="BAB48222.1"
FT                   /translation="MKLTWYGHSAFRIETGDAKILIDPYLIGNPSWTGGWEGPAEGITH
FT                   VLLTHGHSDHISGALEVLGKSGAQLVANFEICMYLVGKGADGSKINPGNIGGTVDCGGF
FT                   TTTFVQALHSSSFGEDGGKNVYLGNPGGLVLHFPEDRTLYHMGDTDIFSDMALINELHE
FT                   PKIGIVPIGDRFTMGGAVAALACRRFFKFDTVVPCHFGTFPMIDPTPEKFEAGLEGSGV
FT                   KVALPKIGETITI"
FT   CDS_pept        533027..533527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0681"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48223"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48223"
FT                   /db_xref="GOA:Q98M90"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M90"
FT                   /protein_id="BAB48223.1"
FT                   /translation="MPAWLADGRTLAGLDLGDKTIGVAVSDRGFAFAHPRPVIMRRKFS
FT                   LDAAVLLALLKKENVGAVAIGLPINMDGSEGPRAQKSRAFVRNMAQLSDLPFVFWDERL
FT                   STVAAERTLIEMDFSRAKRAGKIDSAAAAFILQGVLDRLQSLDSAARTELGGRTEPGPT
FT                   DAA"
FT   CDS_pept        533394..533942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0682"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48224"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48224"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M89"
FT                   /protein_id="BAB48224.1"
FT                   /translation="MPARSIRRPRPLFCRESWTGFSRSIQPLERNWAVERSRARPTPLD
FT                   PVQNFAAAAKSPYRHQQKPVEDTGLSHHPRDDGRIDAEHLAVKLEHEIVQLPGQHHIAE
FT                   IHVVERQVEPAPEQRHRGRPQCEDIAHQRPPLPFGPARPDIRESSELWAAAFAMLCAVA
FT                   RKSASSDAAAERRSASIAT"
FT   CDS_pept        complement(533786..534334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0683"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48225"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48225"
FT                   /db_xref="GOA:Q98M88"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M88"
FT                   /protein_id="BAB48225.1"
FT                   /translation="MRHVLTSFLSVHWAIVFALLALICIDGDRGVTAALGVLGVTVESA
FT                   RFVDLQNVVVVAPLAIALLVVAVLFFWAFVDTLINDAASPGADSVVRIAFISASGVLSM
FT                   ILIGGAAQGINGLFMVVAVQLAALLASYVAMLAERRSAAASDDADFRATAHSMAKAAAH
FT                   NSLLSLISGRAGPNGRGGR"
FT   CDS_pept        complement(534491..536137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0685"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48226"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48226"
FT                   /db_xref="GOA:Q98M87"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR034184"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M87"
FT                   /protein_id="BAB48226.1"
FT                   /translation="MRQGQSVTDDVTNQPPPLTGGNAWRGDPLLIQLAERFSDPVRKDL
FT                   DGLGRFVLTQEAQELARLANVETPKLRTHDRQGRRIDLVEFHPAYHALMRRSVANGLHS
FT                   SVWENGDAEIGRRHQVRAARFYLTAELETGHLCPITMTSASLAALMASPKLFREWAPRV
FT                   TTRKYDQSQKPPVEKTGLTLGMGMTEKQGGTDVRANVTRAERAGSGFYRLTGHKWFMSA
FT                   PMSDAFLVLAQAPEGLSCFLVPRVLGDGSGNGFRFQRLKDKLGNRSNASSEVEFVNAIG
FT                   EMIGEPGAGVKTIMDMVTLTRLDCAVASSAIMRAGLAEAVHHARHRQVFGSTLIEQPLM
FT                   QRVLADMALDVAAATALSFRLARSFDEAASDRGEAAFARAMTPVVKYWVCKIAPPLLYE
FT                   AMECLGGNGYVEEAPLARYYREAPVNAIWEGSGNVMALDVLRVLGRAPGLFEEVLAGID
FT                   RDLGAGGRGTIGVLKAAMQVALTDEGSARLLTEQLALSAAAAELRRLGAGRIADAFVET
FT                   RLAGQWRNTYGMIDSRHDARMIIDTLYPPVN"
FT   CDS_pept        536277..537257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0686"
FT                   /product="aspartate carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48227"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48227"
FT                   /db_xref="GOA:Q98M86"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M86"
FT                   /protein_id="BAB48227.1"
FT                   /translation="MTDASSLPLYPHRHLLGISDLSPADIELLLDRADRAVAISRQSEK
FT                   KTSTLRGRTQINLFYEASTRTQSSFELAGKRLGADVMNMSVASSSVKKGETLIDTAMTL
FT                   NAMRPDILIIRHQSAGAAALLAQKVGCSVVNAGDGAHEHPTQALLDALTIRRAKGPLSK
FT                   LIVAICGDILHSRVARSNIMLLNALGAQVRVVAPSTLLPSGIEKMGVIVTRSMAEGLKD
FT                   ADVVMMLRLQRERMEGAFVPSVREYFRYFGLDAEKLKAAKGDALVMHPGPMNRGVEIAS
FT                   EIADGPQSVIQEQVEMGVAVRMAVMEALLDPRRNQEGRKQEGRGA"
FT   CDS_pept        537254..538540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0687"
FT                   /product="probable noncatalytic chain of dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48228"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48228"
FT                   /db_xref="GOA:Q98M85"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M85"
FT                   /protein_id="BAB48228.1"
FT                   /translation="MSTTVFERARIVDPSRGIDEVGSVIVEGRKIVAAGKATLNQGAPE
FT                   GAIIVDCAGKAIIPGLIDGRVFIGEPGGEHRETIASASVAAAAGGVTSVVMMPDTDPVI
FT                   DNVALVEFVLRTAKDTAIVNIFPAAAITKGLDGREMTEFGLLREAGAVAFTDGRHTIAS
FT                   SLVMRRALTYARDFGATIVHETQDADLGSSGVMNEGLYASWLGLSGIPREAESIPLERD
FT                   LALARLTRGSYHAAKISTAMAANAVTRAKADGAAVTSGVSIHNLSLNENDVGEYRTFFR
FT                   LTPPLRAEEDRLAMIEAVRDGTVDIIVSSHDPQDVDTKRLPFADAAAGAIGLETLLGAA
FT                   LRLYHNGDVPLLRLVETLSTAPARLFGLPGGTLTPGSVADLALVDLDEPWIVSESGIRS
FT                   RSKNTCFEGARLQGKVLQTLVAGRTVFSA"
FT   CDS_pept        538597..539184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0688"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48229"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48229"
FT                   /db_xref="GOA:Q98M84"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M84"
FT                   /protein_id="BAB48229.1"
FT                   /translation="MTYGLILALVFGYLLGSIPFGLLLTRAAGLGDVRKIGSGNIGATN
FT                   VLRTGNKGLAAATLLLDALKGTAAVLIAGHFAPETAVWAGLGAFLGHLFPVWLGFKGGK
FT                   GVATYLGVLIGLAWQVALIFAVIWLAMAFLFRYSSLAALTAAVIVPIALYFLSAPQIAV
FT                   LFVVMSIIVFIKHRANISRLLAGTEGKIGAKG"
FT   CDS_pept        539202..540335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0689"
FT                   /product="DNA processing chain A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48230"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48230"
FT                   /db_xref="GOA:Q98M83"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M83"
FT                   /protein_id="BAB48230.1"
FT                   /translation="MSEPAAGPRLSDRQRLNWLRLIRTQNVGPASFRDLINRFGSAEVA
FT                   LEILPELMVSGGASRIARIPSIAEAEAELEAARRAGARFVGIGEPDYPPLLRSMDNPPP
FT                   LLAVKGNAAVFRLPGVAIVGARNASLAGIKMARMLAATLGGDGYGIVSGLARGIDTAAH
FT                   QGSLQTGTIGVLAGGLDLPYPPENAGLCAEIAERGAVISEMPFGWQPRAQDFPRRNRLV
FT                   AGAALGLVVVEAAQRSGSLISARLAGEMGRLVFAVPGSPLDPRAAGTNGLLKDGATLVT
FT                   EASDISRAIAPLTGMRAPAVPPFEDPPDFSATPPPGESDRAKVIEALGPTPVPVDEIIR
FT                   HTGLHPAQVFMVLLELDLAGRLERHAGGNVSLIFGEG"
FT   CDS_pept        complement(540603..541394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0690"
FT                   /product="trehalose-6-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48231"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48231"
FT                   /db_xref="GOA:Q98M82"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M82"
FT                   /protein_id="BAB48231.1"
FT                   /translation="MISLSPNLAVPVVPQGPCSLFLDIDGTLLEHAAHPDAVVVGDELR
FT                   TLLVRLEAQLDGALAFITGRSIAAVDHLFRPLRLRAAGLYGLEHRLARDGPVEAASEPA
FT                   DIAALANEIATELDNADVYIERKGPILAIHTRAAPHLLQRATELVEQALDRLPAGYRVL
FT                   AGNAGVELMPLEAAKGAAIRRFMQIPAFRGRRPVFLGDDTSDENGFETVNELDGISVRI
FT                   KPQGSTAAPFALAGVDAALAWLDEMSRSETAKAATLAAMPK"
FT   CDS_pept        complement(541391..542953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0691"
FT                   /product="trehalose-6-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48232"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48232"
FT                   /db_xref="GOA:Q98M81"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M81"
FT                   /protein_id="BAB48232.1"
FT                   /translation="MQWSPETLRHILATELPDAQVIVVSNREPYIHNREGDDIQLVVPA
FT                   SGLVSALEPITRACAGTWIAYGGGSADKLVVDKNDRIEVPPDNPSYTLRRVWLSEEEQQ
FT                   GYYLGFANEGLWPLCHIAFTRPIFRASDWEAYEAVNRKFADTVVAEARNERPIVLVQDY
FT                   HFALLPRMIRERLPEAIIITFWHIPWPNSEVFSICPWREKILDGLLGSSIVGFHTQFHC
FT                   NNFIDSVDRFLESRIEREDSAISYGGQISLVHAYPISIEWPPAQLGKLPDVAQCRRQVR
FT                   EKFGLAENVKLCVGVERLDYTKGILDRFNALDELLTLHPEWIGKVAFLQIAAPSRGTLP
FT                   AYQQLYEECLRHAEDLNQRYGREGYTPVLMITEHHSQQQVYEIYRAADVCMVTSLHDGM
FT                   NLVAKEFVAAREDEQGVLLLSMFAGASKELLDALIVNPYDAAMMGDALLQALTMSQEEQ
FT                   SQRMRRMREIVRDNNVYRWAGSMLLDAARLRKRDAVDRAVSAAPAAPANVISLLDRRRV
FT                   AAL"
FT   CDS_pept        complement(543270..545252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0692"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48233"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48233"
FT                   /db_xref="GOA:Q98M80"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032856"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M80"
FT                   /protein_id="BAB48233.1"
FT                   /translation="MLSEFRLTVGGRSTSLLGASLSQDNVLFTTNLTNLPIESAAGRQI
FT                   PQGAMHIERVRLLWEERLYERITLSNYSREHSTILLSLRFAADFRDMFEVRGSTRLKRG
FT                   TADTAEIAGNAVVLRYEGLDKVVRTSAISFSQTPDQLTSERADFVIAVTKRSSQTLYVE
FT                   VGNATDDRPESRRFRAAAARARFGMRAKRRHGATLHSSGRVFNDWMERARADVALLTTE
FT                   LATGPYPYAGIPWFSTAFGRDGVISALQMLWLNPGLARGVLAFLAQHQATETSPFSDSE
FT                   PGKIMHETRKGEMVALSELPFGRYYGGVDTTPLYIHLACAYADRTGDTAFIDTLWPSLC
FT                   AAAEWIETASRSTGFLTYQRAAESGLANQGWKDSFDSVFHADGRIPKGPIALVEVQGYV
FT                   FAAFQGLAKLARLRGEAERAESWEIRADAIRQKVERHFWMEDLGYYALALDGDGLPCKV
FT                   RTSNAGHLLYVGLPGPDRARMVADQLLSASFHSGWGLRTLADDAIFFNPMSYHNGSIWP
FT                   HDTAICAAGLARYGSRDSVVRLMSGTFESAVHFNMRLPELFCGFTRAAGEAPIAYPVAC
FT                   LPQAWSAGSAFMLMQSCLGLQIDGWTGEIHVTRPRLPIGIDNLVIRHLSVGQAAVDLTF
FT                   QRVGDRVGAFLAEPHEGLVPLVVRS"
FT   CDS_pept        complement(545478..546539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0693"
FT                   /product="probable sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48234"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48234"
FT                   /db_xref="GOA:Q98M79"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M79"
FT                   /protein_id="BAB48234.1"
FT                   /translation="MKIAHVAPLYESVPPRLYGGTERIISYLTEALVDLGHDVTLFASG
FT                   DTKTSAKLVPCRERALRLDPRPLKSEIAAHLSMLDEVRKRADDFDVIHFHLSHFLHFPF
FT                   FRDMPQRTVTTPHGRLDYADLAQAYDRFPRFPMVSISRSQRARFASANWLATIHHGLPV
FT                   DLYEPDFEAGSDGGYLAFLGRMSRDKRPDRAIEIARRTGLKLKLAAKIGDGDRAYFEEV
FT                   VQPMIDGDRVEYVGEIGEDQKSRFLGNAAALLFPIDWPEPFGLAVIEAMACGTPVMAWS
FT                   CGAMPEIVDYGVTGFVVETIEDAVATMPALLQLDRRRIRAVFERRFSADRMARDYVEAY
FT                   SRLRNGHEQSRAS"
FT   CDS_pept        546615..547244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0694"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48235"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48235"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M78"
FT                   /protein_id="BAB48235.1"
FT                   /translation="MRRNDRRTFDVRSSRPISFWPPNLHARQPREASVEPKDVQEPRDI
FT                   AARRLSMVIEQYVEARKRRYDFVSTDQAARVIRKILKPADPALSDRKLDDMVTAVAVKN
FT                   GLAVAFDRGVRAPTDGTEADLSRKEPTMRAPRETPDVAGAVDAILATQAAPLSQNTPLS
FT                   QLTPLSMRAVISLLRERTGTKRSDADLEGLIAKKAAVLDVHLSRNG"
FT   CDS_pept        547504..549570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0695"
FT                   /product="O-antigen acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48236"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48236"
FT                   /db_xref="GOA:Q98M77"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M77"
FT                   /protein_id="BAB48236.1"
FT                   /translation="MADKFGSTSKRSSKDYLAFLDGLRAIAILSVVFYHLYGDRLPNGF
FT                   LGVDVFFVISGFVVSYTVSRRYRGQSAFHFVLEFYARRFTRIMPALLLCLLVSALATFL
FT                   FVPDAWLSTSISQTASSAFVGLSNIFLARGTDYFSPVTEFNPFTHTWSLGVEEQFYIIF
FT                   PLLFFPWVIGPRGKRFSALVYGALAIASVAIWFHLLAANPLHAFYMPYARFWQLACGIL
FT                   CFQLVSRIGELTGFERHCNLAATIALIGLLATFALDFGKDSHGLENLAAVVCTTVLIGC
FT                   LYYLGSDRAPHFAVLEIKPVRFVGWISYSLYLWHWPVFVMARWTIGIETTATKLAALLV
FT                   AVAFSLGSYFWIETPTRRLRLLRTAPDIAVVALFLAVIAAAFFGFKLMGDNRYEIALST
FT                   VMRNRGEWYGTSPDTSPQFPGCVVVTETAEEAQFFTKGGCPGDGHNETLFVLGDSHAGA
FT                   YIPLLKRFTLETGIRTVVVSTAGCPFLSLNLRRDTEPTCAHATTAGAAYIARIAKPRDV
FT                   LFLPSLRLTRLSLQWAAGSDSNTENSEQERQQAVKNAIDQLTHLSKAGLSIVFEGPKPI
FT                   FRASAFRCSDWFNSMNPSCTNGFDIDRKLIENLRSPILKGYAEISAALPNIHVWDPLPT
FT                   LCPQVTCSAFRNGHPLFFDGDHVTAYANSLLLENFVSEIESTISKDQAARFGM"
FT   CDS_pept        complement(549706..551079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0696"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48237"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48237"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M76"
FT                   /protein_id="BAB48237.1"
FT                   /translation="MVGCETDRRRHLRVLITNLFVSHNSGTEVVVELLADGLRGAGHQT
FT                   MVLAPTLGDMADRMRRRGHHVVDRIAEIVEKPDIIHGQHLTPCLTALARFPDVPAVFSC
FT                   HSAFFEIEAPMLHPQIRRWIAVDEACKAKCLSRGVPADRLDLIYNAVDLHRFKPRLPLP
FT                   SRPARALLLTKNFEHQQAVREACSKSNIALDEVGPATERFSHQLEKDLPEYDIVFATAR
FT                   MALEAAAVGCSVVVCDARGFAGLLDTANMEAWRRMNLGVGLLTRPTTVENLMEAISRFD
FT                   AGDAAKVCAYFREVADVSHFVQEHLKAYNQAIQAQTNTTADERSLATARWIEEIGVSVA
FT                   PRRWAHIVKEVHGWQVSPDQTALVELLQSNTKTLESNVASLVELGEQVKAIGPEIAKPI
FT                   LDASASLDRVAQDSQARLHRIDDELSRLSNFVNEIKGLYNGMIPLFIRRMFLRVRRRG"
FT   CDS_pept        551210..552037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0698"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48238"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48238"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M75"
FT                   /protein_id="BAB48238.1"
FT                   /translation="MQLKNTDICQSLDWSRCLPEKLQHVLILAHPGHELRIHHWIELSK
FT                   PRIYLLTDGSGGRHSARTQYSRDLVEAAGATAGAVFGDMPDAVWYKALLAGDSGFFADV
FT                   LARIHADLSDMQDVQIVSDAVDGYNPMHDLAYAFGDAINRLLQRPARKQLCSAAVPNVP
FT                   GAVEVEIQLDSAARARKMAAVKAYTPLADEARQILDRDPQCFDRELLISQHFDWDAPWT
FT                   PDWERIGKERVANKVYDRCITYKENVQPVAQRLMSEGDRTHAPRKVQRLPSRA"
FT   tRNA            complement(552076..552148)
FT                   /product="trnK-TTT"
FT   CDS_pept        552198..552944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0699"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48239"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48239"
FT                   /db_xref="GOA:Q98M74"
FT                   /db_xref="InterPro:IPR012413"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M74"
FT                   /protein_id="BAB48239.1"
FT                   /translation="MPRPVNRKKSIRKPDFSSISTEAPCPLRSTAQRPWQSDGITSFQL
FT                   SWQARETLQISNLGFSEEPYTLPLVVSPQGTSITLSKEKTMNKIVSGILAATLSVSFVA
FT                   AAIPANAAQMFVPQAPEASSNTLNVEARNGDRNFQWRHNRYGNRDFGVRRNFARNNDGG
FT                   AYWNGHRGYREYHRGYRRHGDNWFPLAAFATGALITGAIVNSENNRFHEGNAHVQWCYD
FT                   RYRSYRASDNTFQPNYGPRQECRSPY"
FT   CDS_pept        complement(553001..554491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0700"
FT                   /product="glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48240"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48240"
FT                   /db_xref="GOA:Q98M73"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M73"
FT                   /protein_id="BAB48240.1"
FT                   /translation="MSGFVLAIDQGTTSTRAILFDGQMKVAGSGQKEFAQHYPASGWVE
FT                   HDPEEIWASVVTTVKAALKNAGKAASDVAAIGITNQRETVVVWDRATGKPIHNAIVWQD
FT                   RRTAPLCQKLKKQGLEKKFTRKTGLLLDPYFSGTKIAWILDKVKGGRKRAEKGELLAGT
FT                   IDSFLIWRLTGGKVHATDATNASRTLVYNIAENAWDDELLAILNIPAKLLPQVKDCADD
FT                   YGVTERDLFGAEIRILGVAGDQHAATIGQACFEPGMMKSTYGTGCFALLNTGSDLVRSK
FT                   NRLLTTIAYRLNGKTTYALEGSIFIAGAAVQWLRDGIKVIGKAEQSGKLADEADPTQNV
FT                   YLVPAFVGLGAPHWDAEARGAIFGLTRNSGPAEFARAALEAVAYQTRDLLDAMRKDWKG
FT                   TSAKTVLRVDGGMVASDWTMQRLADILDAPVDRPTILETTALGAAWLAGSKAGVWPKAK
FT                   EFAKSWALERRFKPEMDIATRSAKLAGWRDAVRRTLSA"
FT   CDS_pept        complement(554582..556306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0702"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48241"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48241"
FT                   /db_xref="InterPro:IPR014597"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M72"
FT                   /protein_id="BAB48241.1"
FT                   /translation="MRRQFLTSTTALVLLLGVGNAYAGMDEAKAFLDKEIGGVSTLSRA
FT                   DQEKQMQWFIDAAKPFAGMDIKVVSETLTTHQYESQVLAPAFTAITGIKVTHDVIQEGD
FT                   VVEKIQTQMQTGQNIYDGWVNDSDLIGTHWRYQQVRNLTDWMAGEGKDVTDPMLDVDDF
FT                   IGTKFTTAPDKKLYQLPDQQFANLYWFRYDWFNDEKNKADFKAKYGYDLGVPVNWSAYE
FT                   DIAEFFTGRDVNGKKVYGHMDYGKKDPSLGWRFTDAWLSMAGNGDKGLPNGVPVDEWGI
FT                   KVDAKSRPVGSCTARGGDTNGPASVYAIQKYLDWLKAYAPPEAQGMTFSESGPVPSQGN
FT                   VAQQIFWYTAFTADMVKPGLPVMNDDGTPKWRMAPSPHGSYWKDGMKLGYQDVGSWTLM
FT                   KSTPTDRAKAAWLYAQFVTSKTVDVKKSQVGLTFIRDSTIHDKSFTERAPKLGGLIEFY
FT                   RSPARVQWTPTGTNVPDYPKLAQLWWQNIGDASSGAKTPQEAMDSLCADQEKVMARIEK
FT                   SGVQGDIGPKMAEEHDLAYWNADAVKGGNLAPQLKLEQEKDKPITINYDELVKSWQK"
FT   CDS_pept        complement(556386..556679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0703"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48242"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48242"
FT                   /db_xref="GOA:Q98M71"
FT                   /db_xref="InterPro:IPR018678"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M71"
FT                   /protein_id="BAB48242.1"
FT                   /translation="MIMNFDLSWMAWTWPTAAFFATILLLLCGMAAWEYASPGGNPRVG
FT                   ILRFETTRGDRLFLSLLGSAYIHLAWLGLVGSNLWWALALSVVYAIGVFRYV"
FT   CDS_pept        complement(556676..557593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0704"
FT                   /product="permease protein of sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48243"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48243"
FT                   /db_xref="GOA:Q98M70"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M70"
FT                   /protein_id="BAB48243.1"
FT                   /translation="MAGANERTERNAINGTASEGLASALSQSDLDRRMRRRGEESRWWW
FT                   IVPTLYIIVLLLPIYWLINMSFKTNAEIVNSLTLYPHAPTIANYVTIFTEKAWYSGYIN
FT                   SITYVVMNMVISVSVALPAAYAFSRYRFLGDKHLFFWLLTNRMAPPAVFALPFFQLYSA
FT                   FGLIDTHIAVALAHCLFNVPLAVWILEGFMSGVPKEIDETAYIDGYSFPRFFVKIFMPL
FT                   IASGIGVACFFCFMFSWVELLIARTLTTTDAKPIAATMTRTVSAAGMDWGLLAAAGVLT
FT                   LIPGALVIWFVRNYIAKGFALGRV"
FT   CDS_pept        complement(557595..558461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0705"
FT                   /product="permease protein of sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48244"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48244"
FT                   /db_xref="GOA:Q98M69"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M69"
FT                   /protein_id="BAB48244.1"
FT                   /translation="MDKTWNNKAWFLVLPVLVLVAFTAVIPLMTVVNYSVQDTFGNNVF
FT                   TWAGTEWFEDLLSSSRFWEAMVRNLIFSFIILAIQVPLGIFIALNMPKKGWGVPVCLVL
FT                   MSLPLLIPWNVVGTIWQVFGRNDIGLLGYYVNALGIDFNYVQHAFDAWVIIIVMDVWHW
FT                   TSLVVLLCYAGLVSIPDAFYQAAKIDGASRWAVFRYIQLPKMQRVLLIAVLLRFMDSFM
FT                   IYTEPFVVTGGGPGNSTTFLSIDLVKTALGQFDLGPAAAMSLVYFLIILLLSWVFYTVM
FT                   TNYDAER"
FT   CDS_pept        complement(558462..559529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0706"
FT                   /product="ATP-binding protein of sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48245"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48245"
FT                   /db_xref="GOA:Q98M68"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M68"
FT                   /protein_id="BAB48245.1"
FT                   /translation="MARIDVNHVRHSYLPNPQKDADFALREVHHTFEDGGAYALLGPSG
FT                   CGKTTLLNIISGLLHPSHGQLLFNGRDVTKLSTQERNIAQVFQFPVIYDTMTVYDNLAF
FT                   PLRNRGVPEADVDRKVRETLEMIDLASWAKRKARGLTADQKQKISLGRGLVRSDVNAIL
FT                   FDEPLTVIDPHMKWVLRSQLKQLHRRFGYTMVYVTHDQTEALTFADQVVVMYDGGIVQI
FT                   GTPTELFERPRHTFVGYFIGSPGMNVMPVAIDGKTATLGSQRIELPGAPKASGGAVELG
FT                   IRPEYVRLGRDGMAVSISKVEDLGRHKVVRARLEGRDIAAVIGEDETVPAEPKVRFDPA
FT                   GINIYADSWRVEMGA"
FT   CDS_pept        complement(559540..560619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0708"
FT                   /product="ATP-binding protein of sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48246"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48246"
FT                   /db_xref="GOA:Q98M67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M67"
FT                   /protein_id="BAB48246.1"
FT                   /translation="MLELRNVTKTVGAVEHIRDVSLTLQHGSLNVLLGPTLSGKTSLMR
FT                   LMAGLDVPTSGSVWFDGHDVTGMPVQKRKIAMVYQQFINYPAMTVYENIASPLRVAGAE
FT                   QGKIDSQVREAAALLKLTPYLDRTPLSLSGGQQQRTALARAIVKNASLVLLDEPLANLD
FT                   YKLREELRAELPRIFAAAGTIFVYATTEPHEALLLGGNTATLSEGRITQFGPTIDVFRK
FT                   PVDLVTARTFADPPLNTIVLAKKGADFLLEGGVKLPVPPELVGIADGNYTIGFQPHHLS
FT                   LERPNAGAVPVRAKVTITEITGSESFIHLDFADVRWVMLTHGIRDFETDEAVEVFIDPR
FT                   HIMVFDEHGRAVTAPKLAA"
FT   CDS_pept        complement(560662..562188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0710"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48247"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48247"
FT                   /db_xref="GOA:Q98M66"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M66"
FT                   /protein_id="BAB48247.1"
FT                   /translation="MDTSSVRDIFVIGGGINGCGIARDAVGRGFSVFLAEMNDLASGTS
FT                   SGSTKLIHGGLRYLEFYEFRLVREALMEREVLWKNAPHIIWPMRFVLPYAKGLRPAWLI
FT                   RLGLFLYDHIGGRKLLPATRTLDMASDPAGKPLKPLFKKAFEYSDGWVNDARLVALNAR
FT                   DAADRGATIRTRTKVVGARRENGLWTIKIENLQNGETEEIKARLLVNAAGPWVDHVLSG
FT                   VVGLNDVHNVRLVQGSHIVIAKKFDDPRAYFFQNKDGRIIFAIPYEDEFTLIGTTDRDY
FT                   PGDPHDVKISDTEIDYLCAAASEYFAQPVKRSDIVWTYSAVRPLYDDGASKAQEATRDY
FT                   VLKADGGEGTAPIVNAFGGKITTYRRLSESMLEKIEGFLGKRGKPWTSDAPLPGGDFPA
FT                   TGFDAQVAKLKTAYPFLDARLARRLTRLYGTRAQRLLGLAKSNAELGRNFGGDLYEAEV
FT                   RYLVENEWALTAEDVLWRRTKRGLHLSREHVAALDEFMRGISRRHVAAAE"
FT   CDS_pept        complement(562316..563083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0711"
FT                   /product="glycerol-3-phosphate regulon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48248"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48248"
FT                   /db_xref="GOA:Q98M65"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M65"
FT                   /protein_id="BAB48248.1"
FT                   /translation="MYLSPRHAEIIQMAKDHGRVLVDDLATHFNVTPQTIRKDLNDLCD
FT                   QRLLSRIHGGALFPSGIENMEYEARRKIAADEKEAIGRAAARLIPDNASLFINIGTTTE
FT                   AVSKALLDHNGLMVITNNINVANRMRIYPSIEVVIAGGVVRGSDGGVVGEAAVDFIRQF
FT                   KVDYAVIGASAIDHDGALLDFDFREVKVAQAIIANARHVILVSDQTKFERTAPVRIGHL
FT                   SQVNTFITDRCDIPSVRKICQEAEVQLIETSLG"
FT   CDS_pept        complement(563210..564622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0712"
FT                   /product="aromatic amino acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48249"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48249"
FT                   /db_xref="GOA:Q98M64"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M64"
FT                   /protein_id="BAB48249.1"
FT                   /translation="MNNDEFRQWSRRAADWGADYRNSLRERPVRPLVEPGDIFRSIDAS
FT                   PPEDAEPMDRIFADFEEKIVPGMTHWQHPRFFAYFPANAAPVSVVAEYLVSAMAAQCML
FT                   WQTSPAATELETRTVDWMRQALGLPEGFSGVIQDSASSATLNAVLTMRERALDWQGNKK
FT                   GLAGQGQLRIYSSDQVHTSIDRAIWVSGIGEDNLVRIPVGGRFRSMDTAALEAAIVADR
FT                   AAGMLPAGIIGSVGGTSIGGTDDIAAVAGVARRHGLYFHVDAAWAGSAMICPEYRHFWA
FT                   GAEQADSVVFNPHKWLGAQFDCSIQFLRQPEDLVRTLAIKPEFLKTHGRDGIINYSEWS
FT                   VPLGRRFRALKLWFLLRAHGLENLRAMVRNHVTWSEGLAARLAKEPDFEIVSEPMLSLF
FT                   SFRHRAPSSADADEHNLRLVNAINDDGRIYLTQTRVDGQVAIRFQVGQFEATAGDVDSA
FT                   FAVITEIARGMA"
FT   CDS_pept        complement(564834..565565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0713"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48250"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48250"
FT                   /db_xref="GOA:Q98M63"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016545"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M63"
FT                   /protein_id="BAB48250.1"
FT                   /translation="MTYCVGLKIDRGLVFMSDTRTNAGMDSISTFKKMHVWEQPGERVI
FT                   VLMSAGNLATTQAVVSLLDERTKAVTDRHEKLLETPSMYQTVRLVGDTVKEVIAQSSPA
FT                   GEKADSYFNASFILGGQILGSPPRLFMIYPEGNFIESTDDTPFFQIGETKYGKPIIIRA
FT                   YERTMSLAETVKLLLVSFDSTLKSNLSVGLPLDLLFLEKDAFKVGLKKRIAQDDQYYRT
FT                   ISDGWSNALKSAFASLPDFPG"
FT   CDS_pept        complement(565597..566388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0715"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48251"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48251"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M62"
FT                   /protein_id="BAB48251.1"
FT                   /translation="MRLKITHRTEYRYDAPVQYLLQRLRLLPVSGQTQTVLSWALKVEG
FT                   AREEVRFTDHYGNDTRLLSVEGDHDFITVEASGEVVTRDTSGVCGSHQGFAPLWLFAQE
FT                   TPLTAIGGGIRKLAEAVGTGTDIERLHRLMAMIGERVAYTPGSTKATTPAEEALALKTG
FT                   VCQDHSHIFAAAARAMGFPSRYVSGYLMMDAVEQAASHAWAEAHVPGLGWVAFDPANGI
FT                   SPDERYVKVATGRDYRDASPVSGIRQGQAEERLAVTVTVEQ"
FT   CDS_pept        complement(566396..567337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0716"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48252"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48252"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M61"
FT                   /protein_id="BAB48252.1"
FT                   /translation="MLLGRTANGLYWMNRYIERAENMARLVDAGLRMALTRTQNASEEW
FT                   NSVLLSAGSDVAFKQKYSDYTAADVADFLLRDTSNPSSTMSSIETARNNARMVRTALTR
FT                   ETWESINEAWMSLKRMLARPIDERDLPSVLDAIKRETALIRGSFYGTMLRNEIFDFSQL
FT                   GTYVERADNTARILDVKYYVLLPSISWVGSTLDNYQWESILRSVSAHRSYRWVYDADYK
FT                   PTNIADYLILNVRMPRSLTFCYRFLSEHLKFLSDDYGERHACHATAEKTQAMLRAGSIK
FT                   DIFDAGLHEFLAGFIRDNTRLGDEIAQDYRFY"
FT   CDS_pept        complement(567429..568865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0717"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48253"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48253"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M60"
FT                   /protein_id="BAB48253.1"
FT                   /translation="MASQGSMRLAAFDEMLPEVSGLRRPYSAYDRWLKEQDPARLTEKM
FT                   QDAERVFRKTGITFAVYGEQEASERLIPFDIVPRIISGNEWRRLTQGIEQRVQALNAFL
FT                   DDIYHRQEILRAGRVPRDLIAKNEAFLPEMIGVRPPAGVYTHIIGVDIVRISEDEFYVL
FT                   EDNARTPSGVSYMLENRETMMQLFPELFQKIKVRPVENYPQLLRQSLAAVRPQSTKGAP
FT                   TIAVLTPGSFNSAYFEHAFLADQMGVQLVEGQDLRVVDGHVAMRTTEGYKQIDVLYRRV
FT                   DDSFLDPLTFRPDSALGIPGIMDVYRAGNITIANAPGTGIADDKAIYSYMPEIVEFYTG
FT                   RKAILGNIPTWRCSEPDSLKYVLEHIHELVIKEVHGSGGYGMLVGPAATKKECEAFAKK
FT                   LAAKPSNYIAQPTLALSTCPILTDKGLAPRHVDLRPYVLVSDRIQIVPGGLTRVALKEG
FT                   SLVVNSSQGGGTKDTWVLDD"
FT   CDS_pept        complement(569012..569248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0718"
FT                   /product="probable transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48254"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48254"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M59"
FT                   /protein_id="BAB48254.1"
FT                   /translation="MKAFFVQIKCELGKSYEVASALADAEIASEIYSTAGNYDLLAKFY
FT                   VDDEEDVGHFVNEKVQILPGIKDTFTVVTFRAF"
FT   CDS_pept        569379..569921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0720"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48255"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48255"
FT                   /db_xref="GOA:Q98M58"
FT                   /db_xref="InterPro:IPR032347"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M58"
FT                   /protein_id="BAB48255.1"
FT                   /translation="MTFRWRIFAIGETGIHRQAYVIVRLRTSFLRDHSEGQRRQAMRRA
FT                   FFAFTVIPFLFISSAFAGDAEIKAGQAVIDGQLKALLADDGAKAYSFAAPNVKQVFPTV
FT                   DAFMNMVTNGYPPVRKPQSYAFGKVEQTGPGSIIQQVLIVGPDGKDYEAVYTLQQQPDG
FT                   TLQITGCSLRASNSLST"
FT   CDS_pept        complement(569926..571056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0721"
FT                   /product="tRNA guanine transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48256"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48256"
FT                   /db_xref="GOA:Q98M57"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M57"
FT                   /protein_id="BAB48256.1"
FT                   /translation="MAKPFSFKVLATDGRARRGIIDMPRGEIRTPAFMPVGTGGTVKTM
FT                   YMDQVRGVGADIILGNTYHLMLRPGAERVARLGGLHEFARWPHPILTDSGGFQVMSLSK
FT                   LRKLTEKGVTFRSHIDGAPYEMSPERSIEIQSLLDSDIQMQLDECTALPAELKEIERAM
FT                   ELSLRWAERCKTAFGDQPGKAMFGIVQGGDNAALRVRSAQALSAMGLKGYAVGGLAVGE
FT                   PQAVMLEMLDITCPELPADKPRYLMGVGTPDDILKSVARGIDMFDCVMPTRAGRHGLAY
FT                   TRRGKVNLRNARHADDPRPLDEESDCPAARDYSRAYLHHLVRSQEALGAMLLTWNNLSY
FT                   YQKLMQDIRAAIETQTFEARGAEITEGWARGDIPVL"
FT   CDS_pept        complement(571049..571318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0722"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48257"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48257"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M56"
FT                   /protein_id="BAB48257.1"
FT                   /translation="MDDDLQTLDRDALIAEVKKLRAGIRAHRDTSGHDLCWHHPDLWDL
FT                   LPEKTEPSIAVPPWPKFMRGCIQYRQSLDRQAPDAPIHDKEFNG"
FT   CDS_pept        complement(571311..572396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0724"
FT                   /product="S-adenosylmethionine tRNA ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48258"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48258"
FT                   /db_xref="GOA:Q98M55"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M55"
FT                   /protein_id="BAB48258.1"
FT                   /translation="MRVDLFDFELPEERIALRPAEPRDSAKMLVVKSGEALDDRKVGDL
FT                   PSLLRAGDVLVFNDTKVIPAQLKGIRRRGEAQAQVEATLHMRVAPDRWLAFMRPGKRIA
FT                   AGDRIHFGHDGNSCFLGQLDATVIEKGEGGEALLGFDLSGPFLDEALHAVGHIPLPPYI
FT                   ASKRDDDERDRADYQTIYAREEGAVAAPTAGLHFTPELFAALDAKGVERHFVTLHVGAG
FT                   TFLPVKADDTADHKMHAEIGSVSRETADALNAAKARGGRIIAVGTTSLRLLESAAREDG
FT                   TVPAWSGPTDIFITPGYRFRTADMLMTNFHLPRSTLFMLVSAFSGLDTMGAAYAHAIAN
FT                   RYRFYSYGDASLLYRAEMSDG"
FT   CDS_pept        complement(572396..572845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0725"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48259"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48259"
FT                   /db_xref="GOA:Q98M54"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M54"
FT                   /protein_id="BAB48259.1"
FT                   /translation="MMGVVWSLLGILSGAFIAIQAPINSQLARGLGLPVAAAAFSFLSG
FT                   AIVLGIIAVTVVKLQGISLDWKAPAPWLFVAGGMLGGFYVTLSTVLTPRIGAAALMAFL
FT                   VAGQLLAGMLIDRVGFLGVAVREISLGRVAGAVMLLAGALLIRLY"
FT   CDS_pept        complement(572858..573370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0727"
FT                   /product="peptidyl prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48260"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48260"
FT                   /db_xref="GOA:Q98M53"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M53"
FT                   /protein_id="BAB48260.1"
FT                   /translation="MAEIKDRENALIMETTKGKVVIELFPDLAPGHVARIKELAREGAY
FT                   DGVVFHRVIDGFMAQTGDVKFGNSSKPTFAPSRAGMGGSDKPDLKAEFSNANHGRGTCS
FT                   MARSQNPNSANSQFFICFDDAAFLNRQYTVWGQVIEGMDNVDKIKRGEPVVDPDKIVSL
FT                   KVAADVK"
FT   CDS_pept        complement(573399..573893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0728"
FT                   /product="peptidyl prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48261"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48261"
FT                   /db_xref="GOA:Q98M52"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M52"
FT                   /protein_id="BAB48261.1"
FT                   /translation="MIITLKDGDVTIALRPDLAPKHVAQIKKLVRDHAYDNVAFHRVID
FT                   GFMAQTGDVKFGNMKKGFNSQAVGTGGSDLPDLPAEFSQTEHYKRGVVGMARSQDPNSA
FT                   NSQFFIMFAPAPPLDGQYTIVGNVVSGMELVDHIKKGDEADNGTVSDPDRMIKVRIAAD
FT                   K"
FT   CDS_pept        complement(574002..574502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0730"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48262"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48262"
FT                   /db_xref="GOA:Q98M51"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M51"
FT                   /protein_id="BAB48262.1"
FT                   /translation="MIERTALYAGSFDPLTNGHLDVLKASLAVADIVYAAIGIHPGKKP
FT                   LFSFEERVQLIEDATKAEFGRDGARIKVVAFDGLVIDAARKQGASIMIRGLRDGTDLDY
FT                   EMQMAGMNETMAPELQTVFLPASPSVRTITATLVRQIASMGGDIRPFVPAAVAGALTAK
FT                   FAK"
FT   CDS_pept        574801..574953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0731"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48263"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48263"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M50"
FT                   /protein_id="BAB48263.1"
FT                   /translation="MLIYMLATAMTVAMLIATVFGLHQEAQRIRVKATTKRFEGFGPRE
FT                   PYRHY"
FT   CDS_pept        complement(575010..577730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0732"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48264"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48264"
FT                   /db_xref="GOA:Q98M49"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M49"
FT                   /protein_id="BAB48264.1"
FT                   /translation="MQSSYLSYAMSVIVSRALPDVRDGLKPVHRRILYAAHESGYHWNR
FT                   KYVKSARPVADVMGKYHPHGDASIYDALVRMAQDWSLRVPLIDGQGNFGSIDGDPPAAM
FT                   RYTESRLTKVAHELLEDIDKDTVDFQETYDASDTEPKVLPARFPNLLVNGSGGIAVGMA
FT                   TNIPPHNLGEVCNGAIAIIDNPAIDLPALMEIIPGPDFPTGGIVLGRSGIYSAYSTGRG
FT                   SIVMRGKVNIEQRGNDRESIIITEVPYQVNKASMIEKMAELVRDKRIEGISDIRDESDR
FT                   QGYRVVIELKRDAVADVILNQLYRFTPLQTSFGANMVALNGGKPELLTLTDMLKAFVSF
FT                   REEVITRRTKFLLRKARDRAHVLVGLAIAVANIDEVIKLIRTAPDPQTAREQLMERRWP
FT                   AGDVESLILLIDDPRHRINADGTYNLSEEQARAILELRLQRLTALGRDEIADELNSIGA
FT                   EIVDYLDILSSRARVQQIVKDELAAVRDEFGTPRRTELTDGGADMEDEDLIQREDMVVT
FT                   VSHSGYIKRVPLSLYRAQRRGGKGRSGMSTKEEDFVTRLFVANTHTPVLFFSSRGIVYK
FT                   EKVWRLPIGNPQSRGKALINMLPLEQGERITTIMPLPEDETSWGELDVMFATTRGTVRR
FT                   NKLSDFVQVNRNGKIAMKLEEEGDEILGVETCTDNDDVLLTASSGQCIRFSVGDVRVFQ
FT                   SRNSVGVRGITMAETDRIISMSVIENVDASPAERAAYLKRAAAERRLAAGANGEEEEIA
FT                   LTNEEIGEEAELSDERYEFLKAHEQYVLTVTEYGYGKRSSSYDFRLTGRGGKGIRATDV
FT                   SKTAEIGRLVATFPVGNDDQIMLVSDGGTVIRVPVNGIRFASRATKGVTIFNTAEGEKV
FT                   VSVERISEPQSDEESEETVEGGTESAPDAGPENAE"
FT   CDS_pept        578016..579719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0734"
FT                   /product="probable sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48265"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48265"
FT                   /db_xref="GOA:Q98M48"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M48"
FT                   /protein_id="BAB48265.1"
FT                   /translation="MSWRRWLPLQALSGWQFSDLNGDLIAGLTLAAIAIPEQMATARLG
FT                   GFAPEIGFFAFVAGSVAFALFGANRHLSVGADSTITPLFAGSLALLATSGSPHYLALAA
FT                   MLALLVGLIVTLSGIFRLGWIADLLSVPVTTGFLAGIAVHIIVSQMPGLLGLPAESGET
FT                   LRRVGEIAGNLHLTNPWSLGLGLGVFAIVFCSERISARIPGALIGMVLATLAVVVFGLR
FT                   DHGVEVLGALPNGLPGAYLPVASLGDVQALVPLALLIAIVVMVQTAATSRSFASQPDAS
FT                   PDVNRDFVGVGAGSILSSLFGAFAVNASPPRTAIVSQSGGRSQLSGLIAAAIVLALGAF
FT                   GGALLANVPQAALAGVLMFVAQHILRWKVFAGVYRQAPVEFVLILVTTAAIVVLPIATG
FT                   VAVGIGLSLLHGIWSATRTEPIELEQVPGTSVWWPPAKPSAGEQLPGVLVAAFQAPLSF
FT                   VNADRFKRGVCDLVDARDETVKLVVLEASNIVEIDYTAAQALIDTITHCRKAGAIFAIA
FT                   RMESLRAQAALARFGIAEMVGTQHIFHSVDAAIKSLGPGKQQQQEQDGVP"
FT   CDS_pept        579716..580339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0735"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48266"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48266"
FT                   /db_xref="InterPro:IPR014956"
FT                   /db_xref="InterPro:IPR016932"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M47"
FT                   /protein_id="BAB48266.1"
FT                   /translation="MIDPREPIVTPVPVEELRPTQITVGMREVALKRQMIREQDAKKKT
FT                   GAFLGKHMVPVVLGPKNRNYVTDHHHLARALLEEGVKDVLVTVISDLSALDKDTFLFVL
FT                   DNRGWMHPFDESGRRRDYSAIPKTIGELIDDPYRSMAGELRRMGGFAKDTTPFSEFIWA
FT                   DFLRRRIDRNAVAKNFDKAMKEALSLAKGKDADYLPGWCGPTSD"
FT   CDS_pept        complement(580414..581280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0736"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48267"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48267"
FT                   /db_xref="GOA:Q98M46"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M46"
FT                   /protein_id="BAB48267.1"
FT                   /translation="MIATTRTLAFGPGWHVADVICTAGAGDRPFEEAHQEFCVAAVTSG
FT                   TFRYRAQQGTAMLAPGALLLGNSGTCYECGHEHGSGDRCLSFHFKPAYMERIVAGVPGA
FT                   STLAFEAPRLPPLPALAPLLAEAEAARETGDSEAFEELGVRIAAAAVATISGATSIRRG
FT                   PSRRDQKRVAEAVRRIELDADGPVSLSTLADETATSPYHFLRIFRQVAGMTPYQFLLKT
FT                   RLHRAAVQLRLSDDAVSAIAFDAGFNDLSTFNRRFRRVMGETPGDYRASRSGRTVIRAP
FT                   KARRDAL"
FT   CDS_pept        581498..581896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0738"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48268"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48268"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M45"
FT                   /protein_id="BAB48268.1"
FT                   /translation="MLSGRGEVHFGWVLEGRAIQDVWILPARNTDSQPSLGKWTFYGTT
FT                   LRVYDPGADAWHIFWSDPRNQYFSRQLGQAEGDAIVQVGADGTGSSVRWSFSRITENSF
FT                   RWLGERSHDNGATWRLEVEFLARRVATA"
FT   CDS_pept        582150..583277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0739"
FT                   /product="probable lipopolysaccharide modification
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48269"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48269"
FT                   /db_xref="GOA:Q98M44"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M44"
FT                   /protein_id="BAB48269.1"
FT                   /translation="MAKNAEIEILRAISILMVITAHVPFILSWESAYWWPVFRVANFWA
FT                   GVDIFFAISGFVVTATLLRHIRSETPFTALKSFWIRRFFRLVPLSWMTLALSIVLAATW
FT                   NGFGFFGSPQNNFYDAVAVVIYVQNWHFFQCLSAGWKICGINLHFWSLSLEEQFYIALP
FT                   LVFIFSRKWLAAICALLIVIQFPLYRPNTSWLWITRTDAISWGVLIALFSQHADYWRLA
FT                   PTIFRHRHIGLLFAALAITAICFLSGGLIVSFYVGLIALLTGVLVWIASYDRGYLFRNA
FT                   KDQRLLLWIGNRSYAIYLLHSIAFRLVKEGCARYAGSADAIRNSAHSVVILAGGLILTA
FT                   AIAEIACRLVEAPFQTKGRAMAQRIGAPATVAVPT"
FT   CDS_pept        583495..584124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0740"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48270"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48270"
FT                   /db_xref="GOA:Q98M43"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M43"
FT                   /protein_id="BAB48270.1"
FT                   /translation="MPSFDSLFNAFVTILVTIDPPGLAPLFLAVTRGMNREERQQVSVR
FT                   ASVIGFLVMALFAVAGASILSVFGITLPAFRVAGGFLLFFIAFEMVFERRQDRKEKIGD
FT                   VAITKDMIHNIAAFPLAIPLIAGPGAISATVLLSGSFQGFAAQAALVGIIFVCLAITYL
FT                   VFVLSERIDRILGQTGRSILTRLLGVILAALAVQFVADGIKALMAG"
FT   CDS_pept        complement(584153..584578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0741"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48271"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48271"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M42"
FT                   /protein_id="BAB48271.1"
FT                   /translation="MKARIKWVEERTFIGESGSGHKLVLGTASGPDGKTPGPSPMELVL
FT                   IGTGGCSAYDVVHILEKGREAVEDCVVELDADRAETDPKVFTRIHMHFIVKGRALSSDK
FT                   VQRAINLSIEKYCSASAMMAKTATITHDFEVIDTAAK"
FT   CDS_pept        complement(584695..585213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0743"
FT                   /product="single-strand DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48272"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48272"
FT                   /db_xref="GOA:Q98M41"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M41"
FT                   /protein_id="BAB48272.1"
FT                   /translation="MAGSVNKVILVGNLGADPEIRRLNSGEPVVNIRIATSESWRDKNS
FT                   GERKEKTEWHNVVIFNEGIAKVAEQYLKKGMKVYVEGQLQTRKWQDQTGADKYTTEVVL
FT                   QRFRGELQMLDGRQGEGGQVGGYSGGGSSRGSDFGQSGPNESFNRGGGAPRGGGGGGSS
FT                   RELDDEIPF"
FT   CDS_pept        585440..585754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0745"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48273"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48273"
FT                   /db_xref="GOA:Q98M40"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M40"
FT                   /protein_id="BAB48273.1"
FT                   /translation="MIEAEIFRALADPTRRAVFERLAAAEMSVSELRSGLTVSQPAVSQ
FT                   HLAVLRGAGLVVERRAGRNAYYRADPQGLAPLLSWIERYRTFWPERIERLKTVLKDMDQ
FT                   "
FT   CDS_pept        585751..586245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0746"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48274"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48274"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M39"
FT                   /protein_id="BAB48274.1"
FT                   /translation="MKDLGSMNAKTQGDAAPEALEFEYDLAEPPEKVWRALTVPELLAA
FT                   WMMPNDIRPEIGNRFAFAGTEAAIECEILDAEPERLLRYSWRQQPGDAARQDPLDSVVT
FT                   FTLARTVSGGTHLRIVHDGFGGKAMPAVAMASGGCRLSLGLHGRAKPVAANIPNTLLLA
FT                   A"
FT   CDS_pept        586268..586873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0748"
FT                   /product="ATP-dependent protease proteolytic subunit
FT                   ClpP-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48275"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48275"
FT                   /db_xref="GOA:Q98M38"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M38"
FT                   /protein_id="BAB48275.1"
FT                   /translation="MSGLASLVPMVIEQSSRGERAFDIFSRLLRERIIFINGEINDDVS
FT                   ALVCAQLLSLESDNPDKEISLYINSPGGVVTSGFAIYDTMQYVSCPVSTVCMGFAASMG
FT                   SFLLMAGTPGRRIALPNATILLHQPLGGFQGQASDIQRHAERIGKTKQRMAELYAQHCG
FT                   RSYEEVERTLDRDHFMTAREAQTWGIVDHVFDTRKKAA"
FT   CDS_pept        586961..587254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0749"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48276"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48276"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M37"
FT                   /protein_id="BAB48276.1"
FT                   /translation="MIDTHSPTHRVIAAAVLIFASLANGMALADDSAPPAQKGALPGVS
FT                   GDYRIAKPAPQPEPDDAFPSNGNGTFKIGDTDVRISGSITVDMGTGGLKPPR"
FT   CDS_pept        587958..590879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0750"
FT                   /product="excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48277"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48277"
FT                   /db_xref="GOA:Q98M36"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M36"
FT                   /protein_id="BAB48277.1"
FT                   /translation="MADHKFLSIRGAREHNLKNVDLDLPRDSLIVMTGLSGSGKSSLAF
FT                   DTIYAEGQRRYVESLSAYARQFLEMMQKPDVDQIDGLSPAISIEQKTTSKNPRSTVGTV
FT                   TEIYDYMRLLFARVGVPYSPATGLPIESQTVSQMVDRVLALEEGTRLFLLAPIVRGRKG
FT                   EYRKELLELQKKGFQRVKVDGVFYEIADVPALDKKYKHDIDVVVDRIVVRGDLATRLAD
FT                   SIETALKLAEGLAVAEFADKPLDSSQTGEDSVNKSKNETHERILFSEKFACPVSGFTIP
FT                   EIEPRLFSFNNPFGACPTCDGLGSQRAIDPNLVVPDENVSLRDGAVSPWAKSTSPYYVQ
FT                   TLEALGKAYNFKLGDKFKDLSAEAQDAILRGTGEREVTFQYDDGLRSYKTTKTFEGVIP
FT                   NLERRWKETESAWMREEIERFMSATPCPVCKGYRLKPEALAVKIGGKHIGEVTEQSIRN
FT                   ADKWFTDLPAQLNDKQNEIAVRVLKEIRERLRFLNDVGLDYLTLSRNSGTLSGGESQRI
FT                   RLASQIGSGLTGVLYVLDEPSIGLHQRDNTRLLDTLKHLRDIGNTVIVVEHDEDAILHA
FT                   DYVVDMGPAAGIHGGEIIAQGTPQQVMANPNSITGKYLSGALEVATPGVRREAKKNRRL
FT                   KIVGARGNNLKNVTAEIPLGTFTAVTGVSGGGKSTFLIETLFKAASRRIMGSREHPAEH
FT                   DRIEGLEFLDKVIDIDQSPIGRTPRSNPATYTGAFTPIRDWFAGLPEAKARGYQPGRFS
FT                   FNVKGGRCEACQGDGVIKIEMHFLPDVYVTCDVCHGKRYNRETLDVLFKGKSIADVLDM
FT                   TVEEGVDFFAAVPGVRDKLDTLKQVGLGYIHIGQQATTLSGGEAQRIKLAKELSRKATG
FT                   KTLYILDEPTTGLHFHDVAKLLEVLHELVDQGNTVVVIEHNLEVIKTADWVLDLGPEGG
FT                   DGGGELVAQGTPEAIVREKRSYTGQFLKELLERRPGGKREAAE"
FT   CDS_pept        590913..591383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0751"
FT                   /product="probable acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48278"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48278"
FT                   /db_xref="GOA:Q98M35"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M35"
FT                   /protein_id="BAB48278.1"
FT                   /translation="MTIRRALAGDIQTVVSLTEAAYAPYNAILDAPPIPVTEDYAPRIA
FT                   NGEVWLLESGGEPAGVLTLERHADHAMIFSVAVSPGFQGKGFGIALLKHADEQTRQWGL
FT                   PEIRLYTNAKMERNIALYLAYGYRETGRRPNPYRPGWVLVDMAKPVDETTTA"
FT   CDS_pept        591443..592249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0752"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48279"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48279"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M34"
FT                   /protein_id="BAB48279.1"
FT                   /translation="MSKSGTIRSGMGGWTFEPWDTSFYPDKLSKAKQLQYASRQVPSIE
FT                   VNGTYYSSFKEPTFVKWASEAPDGFVYSLKGNRFVTNRRVLGEAGESMMRFLGSGVAAL
FT                   GDKLGPILWQFAPTKKFDPDDFEAFLKLLPEKQDGVALRHALEVRNDSFFVPEFAALAR
FT                   KYKAAIVYADHAKYPDIADVTGDFVYARLQTGSDDNPDCYTPKGLDEWAARAKIWAEGK
FT                   QPADLRRADPATDAPVQPRDVFVYFITEGKVRAPFGAMALMKRIAG"
FT   CDS_pept        592298..593584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0754"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48280"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48280"
FT                   /db_xref="GOA:Q98M33"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M33"
FT                   /protein_id="BAB48280.1"
FT                   /translation="MRFARSKTPIPGHLRRDRNFIDTSLLHECGDGKPHSWSRRRQGKR
FT                   GMSLDYTSLLLAVGFSAACLSLTLFGMWLTARTERFLLTWAISLVFVVGDIFVYDAYID
FT                   MPGRLLGIATLALLLLGFSTMLGAAFQFRTGGSPLPLALLGCVSLAVTLPPMALGYDGL
FT                   GFMFENLFAALLLFATAFEYWRGRDEAPALTIGITTLYSATAVSFMLCAAVLAWDGRLV
FT                   LGHAPSNWAEELSLIVVIASMTGIGALSLALNQGRLARHHRRNALTDPLTGLLNRRALF
FT                   DMHGHVPVGAFTAVVVFDLDNFKAINDEFGHAAGDEVLKVFARELAGNLRQTDIAARMG
FT                   GEEFALVLKRTLPETVEDAAERIRTAFATRLIETETGSLRCTVSAGFAFGSKEGLSFDK
FT                   VLSAADKALYDAKRGGRNRVTASPFRRAS"
FT   CDS_pept        complement(593635..593811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0755"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48281"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48281"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M32"
FT                   /protein_id="BAB48281.1"
FT                   /translation="MERYVEDYQKRRLTERVDIIAAINILRSQGCEYDDLIEEITKVFY
FT                   VDLDTFNEIVMAA"
FT   CDS_pept        complement(594091..594786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0756"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48282"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48282"
FT                   /db_xref="GOA:Q98M31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M31"
FT                   /protein_id="BAB48282.1"
FT                   /translation="MLEVSNATLHYGAAQALRGVSLKAGAGKITCVLGRNGVGKTSLMR
FT                   SIVGHHRLTSGSVAFEGKALDRSAAYDRARSGIAFVPQGREIFPLLTVRENLESGFAPL
FT                   KRADRNVPAHVFELFPVLKQMLGRRGGDLSGGQQQQLAIGRALVMRPKLLVLDEPTEGI
FT                   QPSIIKDIGRAIRFLRDQAGIAVLLVEQYLDFCRELADEVNIMDRGQIVHTGPAEDLDR
FT                   ADVRKFLTV"
FT   CDS_pept        complement(594856..595602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0758"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48283"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48283"
FT                   /db_xref="GOA:Q98M30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017781"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M30"
FT                   /protein_id="BAB48283.1"
FT                   /translation="MSKSNTILYLDGVSVSFDGFRAINNLSLVLDKGEMRAIIGPNGAG
FT                   KTTMMDIVTGKTRPDEGEVFFDGQVDLTRHDEAEIAMMGIGRKFQKPTVFESHTIEDNL
FT                   MLALKGPRSIFPALFHRRSAAEARQIDDILGIIRLGDKRHELAANLSHGQKQWLEIGML
FT                   LAQDPKLLLVDEPVAGMTDAETEETARLLKDIARDHSVIVVEHDMHFVRELGVKVTCLH
FT                   EGSVLSEGTLDFVSADERVVEVYLGR"
FT   CDS_pept        complement(595608..596843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0759"
FT                   /product="probable permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48284"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48284"
FT                   /db_xref="GOA:Q98M29"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017778"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M29"
FT                   /protein_id="BAB48284.1"
FT                   /translation="MITGRFFAAGADRRIAITILILLAAAIVVPLLNLAVSPTSAFYVP
FT                   AYIVALTGKYLCYALLALALDLVWGYCGILSLGHGAFFALGGYAMGMYLMRQIGSRGVY
FT                   GNPILPDFMVFLNYKELPWFWYGFDHFWFAAIMVLAVPGLLAFVFGWFAFRSRVTGVYL
FT                   SIITQAMTYALLLAFFRNDMGFGGNNGLTDFKDILGFNVQADATRSALFAASAAMLALA
FT                   VFITWAIVGSKYGKLLMAVRDAESRTRFLGWRAENVKLFAFTVSAVMAGIAGALYVPQV
FT                   GIINPGEFEPSNSIEVVIWAAVGGRGTIVGPIIGALLVNAGKSWFTGVLPELWLFALGG
FT                   LFVAVTLLLPKGIIGMWDSWRGNAKALRAASVAEEAGTKVAVASATSKPARSPARNPGE
FT                   WSLSDPEPQAAE"
FT   CDS_pept        complement(596840..597793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0760"
FT                   /product="probable permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48285"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48285"
FT                   /db_xref="GOA:Q98M28"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017779"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M28"
FT                   /protein_id="BAB48285.1"
FT                   /translation="MKDAATAAIANINSTLAFWDAGQNIWYGISLGSVLLLAAIGLAIT
FT                   FGVMGVINMAHGEMVMLGAYTTFVVQQVIRTSFPGLFDWSLVIALPLAFLVAALVGLAI
FT                   ERGVIRFLYGRPLETLLATWGVSLILQQAVRSIFGPTNQEVGNPSWMSGSFDIGQLAIT
FT                   WNRLWILVFALTVFGVLLYVMKRTPWGLQMRAVTANRRMAASMGIRTPWVDALTFALGS
FT                   GIAGIAGVALSQIDNVSPNLGRGYIIDSFMVVVFGGVGNLWGTLVGAFSLGIVNKFLEP
FT                   YAGAVLGKIVVLVLIILFIQKRPRGLFALKGRAVEA"
FT   CDS_pept        complement(598564..599874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0762"
FT                   /product="urea/short-chain amide ABC transporter,
FT                   periplasmic urea/short-chain amide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48286"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48286"
FT                   /db_xref="InterPro:IPR017777"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M27"
FT                   /protein_id="BAB48286.1"
FT                   /translation="MRGNFSTITKMFSASVVAAGLLMSAPARAADDTIKVGILHSLSGT
FT                   MAISETTLKDAMLMLIDEQNAKGGLLGKKLEAVVVDPASNWPLFAEKARELISKDKVAA
FT                   VFGCWTSVSRKSVLPVFSELDNILFYPVQYEGEESERNVFYTGAAPNQQAIPAVDYLMS
FT                   KDGGSVKRWVLEGTDYVYPRTTNKILEAYLKSKGVAAEDIMTNYTPFGFSDWQTEVSAI
FT                   KKFGSAGKKTAVVSTVNGDANVPFYKELGNQGIKAEDIPVMAFSVGEEELAGLDTKPLV
FT                   GHLAAWNYFESVNTPENKKFIANWHKFIKNNKRTTNDPMEAHYIGFNMWVKAVEKAGTT
FT                   DPDKVIDAMIGVSVPNLTGGYSTMMPNHHITKPVLIGEIQANGQFETVSKTPGLVMGDE
FT                   WSDYLPDSKDLISDWRAPLSCGNFNVKTGKCGGKGTN"
FT   CDS_pept        600188..600595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0763"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48287"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48287"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M26"
FT                   /protein_id="BAB48287.1"
FT                   /translation="MASLISRILIGTVLLAAATGAAHADFSDGKMPDGTYHCEVYLLGM
FT                   FLDLGDITIKGNVYTGPVTFGTAQQAYNYQMNANGEISWLGPLGGYTAGGNSLSMTQAT
FT                   LDGQNPPSFDIIMKQPDGAFTASTCTLGSNP"
FT   CDS_pept        600720..602633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0764"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48288"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48288"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M25"
FT                   /protein_id="BAB48288.1"
FT                   /translation="MANSPSSSSPVIREIIAERVSRRSLLKGSLASGAVIAGGSFVGSL
FT                   FAGETHAAAALSTLGFSELKRVYDKTHAAAEGYETTIVARWGDPLVAGLLDFDGNKVAA
FT                   DEQDKRFGYNCDYIAFLPLPKGSVNSDHGLLCVNNEYISPNVMFPGMTEDGAGKAMSKE
FT                   QVDLGLAAMGHSIVEIMLKDGKWQTVEDSPLNRRVTANTEMAVSGPVAGHALMKTSADA
FT                   TGTKVLGTSYNCSGGFTPWGTVLTCEEGVSDLFGGDPKKAPTADILDRYGFDGSDIYGR
FT                   GRFHDRFNIDKEPNEPNRFDWVVEIDPYDPRSRPVKRTALGRMSHEASTVVLNKDGRIV
FT                   VYMGDDDYFEYMYRYVSNKAYDKTNPASSNGLLDDGVLSVARYDADGSMTWLPLVHGQG
FT                   KLTAENGFADQADVLLKTRLAADALGATPMDRPEDIETNPVTGRVYAVMTKNKKRDESK
FT                   VNPANTRPENLWGHIVELIPPGGRGIEADHTADKYAWDLFVLCGNPKDAKVGATFHPDT
FT                   SDNGWFVCPDNITFDPAGRLWVATDGANDFDLPDGVYGVDTEGPTRGLPKLLFTCPHGA
FT                   EATGPCFTPDGTTLFLSVQHPSEDAETLDKAQSLWPDFKDGQPPRPSVVAIRRKDGQPV
FT                   GA"
FT   CDS_pept        complement(602693..603439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0765"
FT                   /product="purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48289"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48289"
FT                   /db_xref="GOA:Q98M24"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M24"
FT                   /protein_id="BAB48289.1"
FT                   /translation="MRGRSGLGEQRLTTHIEAGKGDYAETVLLPGDPQRAEWMAKTFLE
FT                   APRCVNRRRGALGFTGLFRGQPVSIQATGIGVSSFLIYAHELLDYYGARTLIRTGTCGG
FT                   LSAEATLRSLVISQSARPENAENGQVFGLYDAEAGPDPALLVCALAKAAELGIDHHAGL
FT                   TVCTDIFYHPEAHTRYAEARALGALAVDMETSALYRIAAHFGARALSLLTVVDNLVTGE
FT                   QADYSERQALFTDMSRLALEIAGEGR"
FT   CDS_pept        complement(603499..606195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0767"
FT                   /product="sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48290"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48290"
FT                   /db_xref="GOA:Q98M23"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M23"
FT                   /protein_id="BAB48290.1"
FT                   /translation="MRRASGPCFHARRLPKTEVTFGRHALGAGVGTSDFTSRGHMAKEA
FT                   RGDFYPVPIVDQNTRPGAVTRLIIFIVVLTGAAIVFGLFRERLGDPFLLGMLGVLAMIG
FT                   VGFLFATAIGFVQVTPRSTGDELSKAFVDSMAQGLLVTDTKGRVVYANRAYADMTGASS
FT                   AADLKTVEGLLSDVPEASVTIYRLASGLRDGQPGDGEFRLAQSIRPGAEPGARWYRARA
FT                   RTFNVPGQRLPMLAWQLADISQERAEQERFFLDLQKAIDHLDHAPAGFFSADQDGRVTY
FT                   INATLAEWLGIDLASFTPGAVTLPDIVAGDGMALVRSVKADPGTTRNAVIDLDLTTMTG
FT                   EALPVRFMHRVSASREGIGGPTRTIVLNRTQGEDASADLRASEVRFTRFFNSTPMAIAG
FT                   VDASGRILRTNAPFLSLFSSVVDRDAVDRRVRLDTVIHERERPAFAAAFEKARQRQADI
FT                   EPIDTVLPGNEERHIRFYVNAVADGTGGEGAEESAIVYAVETTEQKALEGQMAQSQKMQ
FT                   AVGQLAGGIAHDFNNVLTAIIMASDLLLTNHRPSDPSFPDIMNIKQNANRAASLVRQLL
FT                   AFSRKQTLRPEVLNLTDVLADLRMLLARLVGNDIKLKIDHGRDLWPVKVDIGQFEQVVV
FT                   NLAVNARDAMPAGGDLTVRTRNVTAEECKTFSYRELAAADYVVVEVEDTGSGIAPDVLK
FT                   KIFEPFFTTKEVGKGTGLGLSMVYGIIKQTGGFIFCDSEVGKGSTFRIFLPRHIAEAKK
FT                   GAEPGDAPSAAPVKPVDSTKDLSGSATVLLVEDEDAVRMGGMRALTSRGYTVHEASSGV
FT                   EALEVFEALGGKVDIVVSDVVMPEMDGPTLLGELRKRQPDIKFVFVSGYAEDAFARNLP
FT                   ADAHFGFLPKPFSLKQLATIVKDMLES"
FT   CDS_pept        606394..607143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0769"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48291"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48291"
FT                   /db_xref="GOA:Q98M22"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M22"
FT                   /protein_id="BAB48291.1"
FT                   /translation="MQWLDSVAGPGYAAALLWTFAALILLVIVLVIIRLVRNLTFGTFV
FT                   AGGRNRKTRLAVMDATAVDSHRRLVLVRRDDIEHLLLIGGPTDVVVERDIRLAAPRRPA
FT                   LTGDGGLQPVPATAAPTAKPRPPQPAPAPARPAPQPVTAAPPPARPRPAAPPPAPAPAP
FT                   KPVAQPYQSTNVTPLPAYGSANANAVRQAPPPPQDSIDDALMKDLEVSLDQPRSGGPVG
FT                   KPATKPPQSLDDEMTRLLGELSSSQKR"
FT   CDS_pept        complement(607299..607715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0773"
FT                   /product="DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48292"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48292"
FT                   /db_xref="GOA:Q98M21"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M21"
FT                   /protein_id="BAB48292.1"
FT                   /translation="MNDIVTADYVPSEDEPFMNERQKSYFRLKLVTWKNDILREARETL
FT                   EILQQENANHPDLADRASSETDRAIELRARDRQRKLIAKIDSALQRIDEGTYGYCEETG
FT                   EPIALKRLDARPIATLSIEAQERHERREKVYRDD"
FT   CDS_pept        607987..608490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0774"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48293"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48293"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M20"
FT                   /protein_id="BAB48293.1"
FT                   /translation="MSRLYLLRHAKAGWALPGMRDFDRPLDAAGRADAEIMGAAMRSRG
FT                   YVPDLTLCSNARRAKETLEGLAGQTDTGKVLFFDTLYSEDAAGYLRLIREHGGPGSLLV
FT                   IGHNPMTEDLAMAVSGDGDETARAMLNHGFPTSGLAVVRFLDNLAKAGQDTGYLEAFLT
FT                   PADL"
FT   CDS_pept        608567..610042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0775"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48294"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48294"
FT                   /db_xref="InterPro:IPR007413"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M19"
FT                   /protein_id="BAB48294.1"
FT                   /translation="MASSLTTFTDEARIALDTLSGRATGLFSPSLRLGVTGLSRAGKTV
FT                   FISALVHNLIHGGRLPLFEAQKSGRIARAFLEEQPDDAVPRFQYEDHIAALVNDRAWPD
FT                   STRAISELRLTIEYESASGWSRMFSSGKLSVDIVDYPGEWLLDLPLLGKSFADFSREAM
FT                   EMATLPVREDLSRAWRAISAEIDPNGDADEMTARRLAESFAAYLKACKLDERALSTLPP
FT                   GRFLMPGDLEGSPALTFAPLAGLDRRPRPGSLHAMMERRYEAYKTHVVKPFFREHITRL
FT                   DRQIVLIDAMQALNAGPGAMADLERAVTEILGCFRPGRGSFLTDLFSRRIDRILVAATK
FT                   ADHLHHESHDRLQAIVRRLADRAVARANFTGADVDVVAMAAVRATREGTVKQGRETLPV
FT                   IIGTPIAGEKINGETFDGKTETAIFPGDLPEKIDAVFEVSEPDHRQDSTDPAIRFVRFR
FT                   PPKLERTAEGVTLSLPHIRLDRALQFLIGDHLA"
FT   CDS_pept        610039..611124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0776"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48295"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48295"
FT                   /db_xref="GOA:Q98M18"
FT                   /db_xref="InterPro:IPR006507"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M18"
FT                   /protein_id="BAB48295.1"
FT                   /translation="MTAPRKPAAFRIEPEAAPTQETPKARQAELSRKPRGLKTDVALVI
FT                   PAEVDVFDEPDIVAAEPPPAAAPRKRSLFGSIFFGAIGVLVSLAVGLWTDQLIRDLFAR
FT                   AEWLGWLAAGMAAIAVLALVVILIREFLAIARLAEVEKLQKRALDAIARDDPKAARSVV
FT                   DELSAFVAAKPETAAGRRALAELRGEIIDGGNLVRLAEAEILGPLDARAKVMILEAAKR
FT                   VSLVTAVSPRALVDVAYVVFEAGRLIRRLSELYGGRPGTLGFFRLARSVLAHLAVTGSI
FT                   AVGDSFVQQIVGHGLAARLSAKLGEGVVNGMMTARIGIAAMETARPLPFSAAKRPGLGD
FT                   FLSALTSFAAKKDTETTGSGK"
FT   CDS_pept        611239..611799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0777"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48296"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48296"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M17"
FT                   /protein_id="BAB48296.1"
FT                   /translation="MSSMKSVILSSVLPLAVAITAVVGLASRASAAEPDKQFFQSAEGK
FT                   WVGPGEIVAGKYKGTKFNCSFTGSTPDGTMGMTLDGGCRVGMFTQPMSAKIERKGRDYK
FT                   GSFMGGSAGAGLDIIGGNVVDARKVVFTINRNQLRGVMQARIPDDNSMTVTVAVRVQDQ
FT                   LVPVIGMSLKRVDAVEVGSIAPN"
FT   CDS_pept        complement(611887..612045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0779"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48297"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48297"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M16"
FT                   /protein_id="BAB48297.1"
FT                   /translation="MAAALQEAITKDPSKAADLTAKVQAVTTKYQGTTTLADACKAYDE
FT                   VTAAIKG"
FT   CDS_pept        complement(612332..613540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0781"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48298"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48298"
FT                   /db_xref="GOA:Q98M15"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M15"
FT                   /protein_id="BAB48298.1"
FT                   /translation="MTDTTLQLEDAAIDVDAAAPATWDATIWFAVISLAATSFALVSAE
FT                   FLPAGLLTPLARDLGISEGTAGQVVTATASVGAVTAMLSNVLIGRLNRKAVLVGLSALA
FT                   VGSNILAALATDFWLLLLGRAGLGIALSAFWALSVAVVARLVGANATGRGMAIVTLGVS
FT                   LATIAAPSMGALISDWLGWRSAMAMTAGLALLAMLLQLLSLPSLPATASNSLADVLRLT
FT                   RRRGIQLGMLAILLLMTGHFAGSVYVRPFLEHVTLLATGPIALALLGFGIAAVIGNIAG
FT                   GRMADANIHVALVVNAALMAFAALALVLWGVHIGVAFGFATLWGFAFGMAPVVLPTNLS
FT                   RAAPDALEAAGSLMVASFQVAITIGAVVGGYAVDTYGPTAPLTVTAILAASTAVLALLQ
FT                   PRG"
FT   CDS_pept        complement(613600..614589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0782"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48299"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48299"
FT                   /db_xref="GOA:Q98M14"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M14"
FT                   /protein_id="BAB48299.1"
FT                   /translation="MTDHSSRPSPPPHIPIDALSEILQDFRLSGVNYGRCELRHPWSIE
FT                   FPQQSLLRFHFVGQGPCWIHTEAEGWQELRDGDLALLPQGIAHRLASAPDVAGGSLDDC
FT                   RVTKLGSNVCEVVREGTGATSTLFCGSMALGACALNPLITLMPPIIKGCDVAGNDPVVG
FT                   PLLTAMTVEAAQPQMGSATILSRMADLLTARLIRCWVNCTGASTTGWLAAIRDPHIGRA
FT                   LAAMHRDPGHNWTLESLASLAGQSRSIFAERFSAVLGEGAARYLARLRMQLARELLGQN
FT                   GLSVAEVAARLGYDSEASFARAFKRITNVSPGVVRRTIPGRMDMNFGL"
FT   CDS_pept        614761..616596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0783"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48300"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48300"
FT                   /db_xref="GOA:Q98M13"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M13"
FT                   /protein_id="BAB48300.1"
FT                   /translation="MAAETSGSDLIQVVALLAAGVVAVPIFKRMGLGSILGYLAAGVVI
FT                   GPFGLRIFSESGAILHVAELGVVMFLFIIGLEMQPSRLWGLRREIFGLGALQVGVCAVL
FT                   LTGVGMAGGFPVSQSFVAGAGFVLTSTAIVMQLLEERGEIASPKGQRIVSILLLEDLAI
FT                   VPLLALIAFLAPGGADTSMSERLTEVGIGLAAIVGLVLAGRYLLNPFFRILADARAREV
FT                   MTAAALLVVLGSALAMQLSGLSMAMGAFLAGVLLSESTFRHQLEADIEPFRGILLGLFF
FT                   LAVGMSLDLHVVAANWRLIAVYVVAYMVMKALGIYIVARILKTGHREALERAVFMAQGG
FT                   EFAFVLYSAAAAVGIIDNQANATLTAIVIISMVLTPLAIIALRYVTPRDEQSLDGVDVA
FT                   DGLTGSVLIIGFGRFGQIASQPLLLRGIDVSIIDNDVEMIQAAADFGFKVYYGDGTRLD
FT                   ILHAAGAGRARAVLICVDKADAAVRIVQLIKAEFPLLTVLARAFDRGTALQLIRAGVDY
FT                   QLRETFESALVFGGSALESLGVDPEDVAETIEDVRRRDTERFETQLAEGIRAGQRFLRG
FT                   NIGTPIPTPLSTPRRPGQALNEETAGVLHKSETAD"
FT   CDS_pept        616612..617157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0784"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48301"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48301"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M12"
FT                   /protein_id="BAB48301.1"
FT                   /translation="MELDSGALSVTKFWRDAGEDAWFEKNDAFDGDFRDRFLDLHYAAA
FT                   RRECDAWSNHAEGSLALMILLDQFPRNCFRGTGHMYATDPLAKHFAEKAVAAGHDLALE
FT                   PELRVFLYLPFEHAENLADQDISVELHTARAEFNLKYALEHRDIIKRFGRFPHRNRMLG
FT                   RETTPQEQAFLDEGGFSG"
FT   CDS_pept        complement(617161..617673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0786"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48302"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48302"
FT                   /db_xref="GOA:Q98M11"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M11"
FT                   /protein_id="BAB48302.1"
FT                   /translation="MSGPSNTVYLSLGGNLGDPAASMAAALRILDADTDTRVTAVSSLY
FT                   RTPPWGKLDQPDFLNAAAELSTRLSPRALLDLCLDAERKLKRVREERWGPRLIDIDILV
FT                   FGDRVIHETGLEVPHPRMLERAFVLAPLAEIAPDLAVGGRSVSERLSAVDAAGIERLPS
FT                   GRDWWLT"
FT   CDS_pept        complement(617657..618016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0787"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48303"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48303"
FT                   /db_xref="GOA:Q98M10"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M10"
FT                   /protein_id="BAB48303.1"
FT                   /translation="MYVIRLKNCAFFARHGVLDEEEALGQRFYVDAVLSVEPGRALVDD
FT                   AIEETVNYGIAFTVIEKIITGERRFLIEALAMEVAKALTERFPQIRRAEITVRKPNAPV
FT                   PGVLDYVEVTVVWPE"
FT   CDS_pept        complement(618020..618871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0788"
FT                   /product="dihydroxypteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48304"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48304"
FT                   /db_xref="GOA:Q98M09"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M09"
FT                   /protein_id="BAB48304.1"
FT                   /translation="MTARRWQLAHGRHLDLGGKAVVVGILNVTPDSFSDGGLFDAPEAA
FT                   LAQARRMIGEGAGIIDVGGESTRPGAAAISASEEQARVLPVIEALARSGDVLISVDTYR
FT                   ADTARLAVAAGAHIVNDVWGLQREPDIARVAAETGAGLIIMHTGRDRKKLPDVIADQFA
FT                   FLERSLEIARRNGIADDRIVLDPGFGFAKETAEENLDLMARFSELHALGFPLMAGTSRK
FT                   RFIGTVTGRDAADRAPGTAATSVILRLKGAHLFRVHDVAINVDALAMADAMLARETAAS
FT                   ER"
FT   CDS_pept        618971..619594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0789"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48305"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48305"
FT                   /db_xref="InterPro:IPR010321"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M08"
FT                   /protein_id="BAB48305.1"
FT                   /translation="MMKRSLLCALLLAATAVPAGAANLVKTYSYFSIGGSTLEDIEKQL
FT                   SKHGPQVKSTGSRHPGATQMAFTTRISYARQAGSCRIADAAVTVKVKVILPEWRRPRKA
FT                   EPEVKLFWDTLAADIKRHEERHVEIAKNYGRELENALKATYPRTDCGTAKAKAAEITAA
FT                   VLARHDRAQVQFDRVESVNFESRILRLMRYRIQRIENGQLPPPP"
FT   CDS_pept        619811..621304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0791"
FT                   /product="probable membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48306"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48306"
FT                   /db_xref="GOA:Q98M07"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M07"
FT                   /protein_id="BAB48306.1"
FT                   /translation="MDKIMDQAVDKQTMAAAATPLTESEKNAIIGGVLLSMLLAALDQT
FT                   IIAPAMPTIARALGHAEYLPWMVTGYLLTATAVAPLYGKISDVYGRRPTIYAAILIFLV
FT                   GSLVSAMAPNMFVLVIGRAIQGAGGGGLFALAQTVIGDLVPPRERARYAAWVSGTWAVA
FT                   SIAGPLLGGTFAEHLHWSLIFWINIPLGLLAMAIINKPLKKLPIAAKHHRIDGLGALLL
FT                   VIATALLLLALNWGGSTYAWFSREIVGLVAGSAVFWALFAIRLMGATEPLISLEVLGNP
FT                   IVLAGALSMFLLQAANIGASVYLPVYLQTVIGLSVSESGMAMLGLLLGTVAGAATSGRL
FT                   IPRFVHYKRIAMIGITLAIVSIGLLSAIAGHASLLEVEILTTLIGLGSGTTFPVATVSV
FT                   QNAVDRTHLGVATGVLTFLRTLGGALGVALLGAVAIGYGLPLSAEGSQTHIQLTSALPF
FT                   VMIFITAGITLVLALVAMMLMPEKALRGRDEVAAPVLAE"
FT   CDS_pept        complement(621315..622346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0792"
FT                   /product="thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48307"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48307"
FT                   /db_xref="GOA:Q98M06"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M06"
FT                   /protein_id="BAB48307.1"
FT                   /translation="MTGIISTDVLIVGAGPVGLFAVFELGLFDMKCHLIDILDKPGGQC
FT                   AELYPEKPIYDIPGWPSISAQGLVDKLLEQIHPFKPDFTYNRMVSSLEKLEDGSFRVTT
FT                   DENEVFEAKVVVIAAGGGSFQPKRPPIPGIEPYEGKSVFYSVRRMEDFRGHDLVIVGGG
FT                   DSALDWTLNLQPVAKSVTLVHRRPEFRAAPDSVNKMYAMQEMKQLEFRVGQVTGLTGAD
FT                   GQLSSATIKGGPDGDIEVPCTRMLPFFGLTMKLGPIAEWGLNLHENLIPVDTEKFQTSV
FT                   PGIFAVGDINSYPGKLKLILSGFHEVALMAQAAKRIVSPGERIVFQYTTSSTSLQKKLG
FT                   VVG"
FT   CDS_pept        complement(622430..622750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0793"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48308"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48308"
FT                   /db_xref="GOA:Q98M05"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M05"
FT                   /protein_id="BAB48308.1"
FT                   /translation="MTKLTFIAHDGTQFDVDAENGSTVMENAIRNAVPGIEAECGGACA
FT                   CATCHVYVDEAWTAEVGEPEAMEEDMLDFAYDVQPNSRLSCQIKVRDALDGLVVRVPER
FT                   QG"
FT   CDS_pept        622716..623192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0794"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48309"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48309"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M04"
FT                   /protein_id="BAB48309.1"
FT                   /translation="MPSWAMKVSLVICHLKGVSAEIITPADKSTAARKRRSVTFFQKTG
FT                   SAIDGGDEIAHFVDQFAEPIEGLAVFRLPLDLGGTIGDGKGADAASGPLQPMRQQKPVL
FT                   EIGIDYFVAYRQRLLYKQRQHLLLEGAVAHRLPGKVCQIDRSGLPGSRDVASGH"
FT   CDS_pept        623492..629866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0796"
FT                   /product="kinesin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48310"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48310"
FT                   /db_xref="GOA:Q98M03"
FT                   /db_xref="InterPro:IPR000074"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M03"
FT                   /protein_id="BAB48310.1"
FT                   /translation="MAKKPTTTTRNLDSDVARELEKALDLDLSGDIGSGDLDIAASMED
FT                   LEAQISQAADELAREGRDQRPALAANQAAPIANQAANPAPKAKPAELRPVETRNGNGTQ
FT                   PTGFAPANDDRQKDYKTLLHSLNRRASNTVYWIVAFVSLAWIAGAGGLANLLFGPSIWR
FT                   IGTLDQFLARPELIGLAVAAIVPIILFWAFAAMIRRAQDMRIAAQSMTEVAFRLTEPEN
FT                   MAQDRVMMIGQAVRREVAAMGEGIERTLARAVELETLVHSEVNQIERSYSENETRIRSL
FT                   VDGLGSEREAVVTHAERVRASIAGAHETLRDEIGAASDIIRDSILNASTKLSMTITNSG
FT                   DTLIDRINESSMSIFDSVEGRLDTITDKLSTSGEAFASLLDTRIAKLTDTTDGLTRSLT
FT                   DLLDDRTTGMVSLLGGAARTLNSEFEASLNGIERTLAERGQALISEFQTRAEALDTGTQ
FT                   KLNAALEARARQINETLVERAREIAHTFAESKDTLAAMIDQGKTQIGADMADIVTSTSS
FT                   MLEARASDFAGRMEAARHVVSRSFDSDIQRLADARVGIEEAVENHSRKLSESRDRMAAA
FT                   MQADLEKFAESRDGIDAAVTNQVQKLAEGRSLIARALEEDLRKVNESRAAIDASLGSHL
FT                   ERLEEGRNRLSLALNEDSGKLVQARTIIDEMVAGHVGKLAEGRNILSRALEADLGKLSD
FT                   SRASIDGLVAGQVEKIAEGRAVLAKALENDIAGIKSLIEVHSAKLVEDRSQLGRSLEDD
FT                   LSGIRGLLDDHSVKLANDRSLLSQTLEADLAKLAESRSSIDGLVAGQVEKLAEGRDILK
FT                   RALESDLSTIKGVISSQSERLAEDRGQLSRVLEADLQNVNSVIADHMNRLVQDRSTLSK
FT                   ALEDDLAKLADSRSSIDGLVAGQVEKLAEGRDILKRALEADLNTIKNTVADQSQKLVDD
FT                   RAQFARALEADLESVNSLVNSHSERLVQDRSTLSKALEVDLDNVNGLINSHAERLVQDR
FT                   STLSKALEADLESVSGLVNSHADRLVQERSTLSRALEDDLAKLAESRSSIDGLVAGQVE
FT                   KLAEGRDVLRRALEADLAKLAESRSSIDGLVAGQVEKLAEGRDILKRALEADLQKLSES
FT                   RGDIDGVIAGHVGKLAEGRNMLSRALEDDLGKLAETRKDVDRSLSGHIDQIAARSTDIS
FT                   AAIAADVEKIEQAFSRQTGIIEERAGTMERALSTGVDNVRSVLEKSAVFVAGALREKVL
FT                   EVTSTLHEQAGAAFSDADRKIAERAEQTSAALLARAEDIARTFEEADRRLHARAEDTSN
FT                   ALLARADDTSSSLLARAHETADQLAARAGEIAGSFELADQKLAARAQDTADQLAARASE
FT                   IAGTFDAADQKLVARAIETAQSLAARAGDILRNFESADQRLGMRIGESAEALAARATDL
FT                   GRIFDAADQQLVSRIAEGSDALSNRASEIGRIFDEADQRLVSRIADSSSTIGEHAQSIV
FT                   GAFASTEQKVADRARQTGQELAVHAREIEQALAGADERLASTAAAAAARVEEQIASVEN
FT                   RLAHTTETMGQRLNEQVSSAEAQLVSRANVIAETFTAVGQHIGQSTNDAAKTIGANTRE
FT                   LNTMLAARSAEMSKILDETARPLVERFAQGGSELQKSMEEVTERATEKLRSENAALVNA
FT                   LANRTAETLSAVEGARSSLSDSVADLIGRMTKSSSQLGQLIEQAAVNLGQVDERLTGST
FT                   QSFAATTEKAAQTFASSARLVDSNTTRLTELSSSTLREVASIATKFDEHSRLLASASDL
FT                   LSSAQSNLEHTLERQSSLEDLAVGLVKKSEDLERVMRSFENLVGQTLQNAEGKTMESAD
FT                   KIRNAITDVVDSATKRFADATDEMRRTASSIKSELDLTRAELKKGVIEMPEEAKESTSA
FT                   IRRAVSEQINALKELSDIVAKSGRGGGDTSEPRNLRPAPQAQAARPAEPPRRPPAPQPE
FT                   LRTPQPPLGGTALRGTLDLERPAEPRQRPEAGARTPQGGWVRDLLTAASNDADLRPATP
FT                   PSPPAEAPRAAPAQRSPLHVVESLNSLSVDIARAIDHDASIELWNRYRRGERDVFTRRL
FT                   YTLKGQQTFDEIRRKYQGEAEFRAAVDRYCDDFEKLLKDVSRNDRDNIMAQTYLTSDTG
FT                   KVYTMLAHASGRLH"
FT   CDS_pept        complement(630228..630821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0797"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48311"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48311"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M02"
FT                   /protein_id="BAB48311.1"
FT                   /translation="MKTGGLTPAAALLALSLAGCAVLGGKPAPLDTFELSAPSVDAHGH
FT                   SRKQILIAQPSALKALDSQNIVIKPSDRSIQYLKGAQWADRLPLIVQARLAETFQRSGS
FT                   FAGVGKPGEGLAIDYQVIVEIRSFEVSVDGGEHAEVDLFVRLLNDRNGEVRASKSFTAS
FT                   APVSGSGNPAYIKALDSAFGDAAKQIVRWTDSVI"
FT   CDS_pept        complement(630916..632289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0798"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48312"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48312"
FT                   /db_xref="GOA:Q98M01"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M01"
FT                   /protein_id="BAB48312.1"
FT                   /translation="METRANYVIVGIFTLVAILAAFGFVYWTAAIGDRGETTLLRVRIP
FT                   GSASGLGRGSFVLFNGVKVGDVKRVYIDVDNPTVAIADTEIDRLTPITKSTQADIGLAG
FT                   LTGQANIELKGADPKEVKLLDQAEKEGKVAEIVANPSAVTNLLQTAQNIFSRADKVLSE
FT                   LEGFTRDVRGPLTQTVQNVQTFSDALAKNSDGIDKFLSSVSALSEELKGVSGKLDGTLK
FT                   AAEGLLNAVDRDKIKSIVANVDTVTANLKQTSQQLDGVIKNVDTAVGSVNDFAKQTQGT
FT                   LAKVDGVLDGVDPAQVRAALANIQKASENANKAAADIAVVTEKFANRADDIDQTIKDAK
FT                   QLAQRLNDASVRVDGILARVDTLLGSGQADGLMADARDTLKSFKQVADTLNARLGVITD
FT                   NLARFSGQGLSNVEALVQDSRRSITRIEEAVTDLSRNPQRILSGGDGEVRQFDGRARR"
FT   CDS_pept        complement(632304..633113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0800"
FT                   /product="ATP-binding component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48313"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48313"
FT                   /db_xref="GOA:Q98M00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M00"
FT                   /protein_id="BAB48313.1"
FT                   /translation="MAKGNGIKVEEKDESEIVLSVRDVTVAIEDKLILDKLSLDIKRGE
FT                   ILGFVGASGAGKSVLLRTILGLMPKQSGTIKLFGVDVDKASDIERLRIDMRLGVLFQHG
FT                   ALFSALTVQENVQVPMREYLDLPRKLMDELALLKIELVGLPPDAAQKFPSELSGGMIKR
FT                   AALARALALDPDIVFLDEPTSGLDPISAAEFDELVVKLRDTMDLTVYMVTHDLDTLFTA
FT                   CDHVAVLGKKKVLVEGTIDDMLKSEEPWVKSYFRGKRARQLDLAARA"
FT   CDS_pept        complement(633118..634305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0801"
FT                   /product="permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48314"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48314"
FT                   /db_xref="GOA:Q98LZ9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LZ9"
FT                   /protein_id="BAB48314.1"
FT                   /translation="MLTIGKRDASGRAASEADHQPRVAVGEEAGVLGCAFSGIWTTRTV
FT                   ALIDADMRKIEKRSGFKTLALDLSKIEKIDTAGAWLIDRLVSAFEKKNVEVRLQGQSEI
FT                   ASILLDAVGEAVRREPESGPARPPNIIIRALEAVGRRVYEMRDDFLASMNILGATIRGA
FT                   QMKLGRGHAVNPAAIFNQIDRMGVGAIPVVVLMSAIVGAIVAQQGAYQLSYFGADIFVV
FT                   DLVGVLILRELGVLMTAIMIAGRSGSAITAEIGSMKMREEVDALKVIGLNPIGVLVFPR
FT                   LVALVIALPCLTIIANFAALGGGIVAAWLYSDIPPAAFIDRLRVAIDLSTIFAGLIKAP
FT                   FMAMIIGTIASVEGMKVGGSAESLGQHVTASVVKSIFVVIILDGLFAMFYAAIEF"
FT   CDS_pept        634383..635366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0803"
FT                   /product="probable muconate cycloisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48315"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48315"
FT                   /db_xref="GOA:Q98LZ8"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LZ8"
FT                   /protein_id="BAB48315.1"
FT                   /translation="MARVISVEAERFPIAGSFTISRGSKTEAEVITCTISQDGHSGRGE
FT                   CVPYKRYGETMDGVHAAIEAMRERIAGGIDRTALLDAMPAGAARNAVDCALWDLEAKIS
FT                   GKPVANAIWPAPLRPLETAYTLSLGEPEAMAAQASANAGRPLLKVKIGGDNDTARIRAV
FT                   TEAAPQSRIILDANEGWTDDNIVANLVFAAEHGIALVEQPLPAGRDEILRHIAHPLPIC
FT                   ADESVHEAKNLETLVGLYDAVNIKLDKSGGLTAALVLRDRARELGFGIMVGCMVGTSLA
FT                   MAPAVLLAQDADFVDLDGPLLLARDRVPGLVYQGSLVSPPDRALWG"
FT   CDS_pept        complement(635286..636551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0804"
FT                   /product="probable transporter of 3-phenylpropionic acid"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48316"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48316"
FT                   /db_xref="GOA:Q98LZ7"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR026032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LZ7"
FT                   /protein_id="BAB48316.1"
FT                   /translation="MSLPPLSPEQLVKPRHFELRMSLIFGTLFISLGTHLPYFPLWLQA
FT                   KGFHAEQIAVILAAPMFLRVVTTPLLTTLADRARDRANVYVALVAASLLLSAGYFLTPT
FT                   YAMVLAVSLGLTIVWTPHSPIADSLALSGVRRFGSNYASMRKWGSICYLCANVAGGFIL
FT                   AATGPQAVPVIIVLALAAALVAGLLAPRMGRPRKASPLSAAEIQHAAPSLFNAYFLYFT
FT                   FGVGIITASHAFLYGFVSIYWKSIGISDSVVGLLWAWGVVSEVCMFLLFNRIFASVSVV
FT                   KVMVIAGIGSIVRWILFPLVWPLGLGIAGFFAVQSLHSVSVAMVLIGLQKMIAETVSEE
FT                   RTGAAQGIAYFFNGFFMAAVTLASGPLYDRLGVDGFLVMIPIAIVGLVLIGLAARSAPK
FT                   RPVGRGDERTLVDEARHTVAGK"
FT   CDS_pept        complement(636678..637460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0806"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48317"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48317"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LZ6"
FT                   /protein_id="BAB48317.1"
FT                   /translation="MFISDVHLGSKAAKADFLIDFLRYHDADIIYLVGDIVDGWRLRRS
FT                   WHWPQSHNDVVQKLLRKARKGASITYIAGNHDEFARQFQGVHFGGIVVADRAIHETADG
FT                   KRLLVIHGDQFDTVVHNQRWLAYLGDHAYDAAMIVNRVVTRLRQLLGLPYWSFSSWAKV
FT                   KVKKAVNFIGSFQTVLTEEARRSHVDGVICGHIHHAAIENFDDVRYINTGDWVESCTAV
FT                   VEHFDGRMEILTWAQVLPESFDEPFIPMLIEDRVGQAA"
FT   CDS_pept        637613..638392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0808"
FT                   /product="probable short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48318"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48318"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LZ5"
FT                   /protein_id="BAB48318.1"
FT                   /translation="MDLGIRGKKAIVCASSKGLGKGCAMALAEAGCDIVVNGRNAELVA
FT                   KTAAELRERFDVTVTEVVGDVSKPDVQKALLAACPEPDILVNNNGGPPLRDFRELDRAK
FT                   ILEGVTQNMVTPIELVQAVLDGMAKRGFGRIVNITSLSVYVPIPGLDLSSGARAGLTSF
FT                   LAGVARTVIDRNVTINSLLPGKLDTDRLRGPHEAGTSEAPAAAAARKTRISADVPAKRL
FT                   GTPEEFGQICAFLCSVHAGYLTGQNIPVDGGLYVSAF"
FT   CDS_pept        638569..640893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0809"
FT                   /product="malate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48319"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48319"
FT                   /db_xref="GOA:Q98LZ4"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LZ4"
FT                   /protein_id="BAB48319.1"
FT                   /translation="MEGENKKTARSDLDEAALYFHKHPTPGKLEIQATKPLGNQRDLAL
FT                   AYSPGVAAPCLEIRDNPATAADYTARANLVGVVSNGSAVLGLGNIGPLASKPVMEGKAV
FT                   LFKKFAGIDVFDIEIDAPEIERMVETVAALEPTFGGINLEDIKAPECFEVEERLKARMS
FT                   IPVFHDDQHGTAIIVAAAVLNGLEFAGKTISDIKVVTSGAGAAALACLNLLVSLGVRIE
FT                   NIWVTDRFGVAYKGRTEEMDRWKDPYVKDTEARTLADVIPGADVFLGLSAAGVLKPELL
FT                   QHMAPKPLILALANPNPEIMPEVARAARPDAMICTGRSDFPNQVNNVLCFPYIFRGALD
FT                   CGASAINEEMKMAAVRAIAALAREEPSDVAARAYSGETPIFGPDFLIPSPFDPRLILRI
FT                   APAVAKAACDTGVATRPITDFAAYIDKLNRFVFRSGLVMKPVFSSAKASSAKRVIYADG
FT                   EDERVLRAAQVVLEEGIAEPILIGRPHVIEVRLKRYGLRIKPGVDFGLINPEDDPRYRH
FT                   YVDLLIELAGRRGVTTEAARTMVRTDNTVIAALALKRGDADAMVCGLEGRFERHLRNVT
FT                   LIIGPRAGIKDYDLSTLSMLISQRGIIFLTDTHVSVDPTAEEIAEMTVLAAEEIQRFGI
FT                   EPKAALLSHSDFGSRDSPSALKMRQAAAILARIAPELQCDGEMHADSALSEHLRQRVYP
FT                   HSRLKGEANLLVFPNLDSANITLTALRAMMDALHVGPILLGTDKPAHILTPSVTSRGVV
FT                   NMTALAVVEAAHKAQAIANLD"
FT   CDS_pept        641086..641766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0810"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48320"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48320"
FT                   /db_xref="GOA:Q98LZ3"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LZ3"
FT                   /protein_id="BAB48320.1"
FT                   /translation="MKGLLLASALLSLIGGQALAADAISAEPATAHDWSGVYVGGQIGY
FT                   GFGKTDATYNLPNTPTIRGSQDYDTDGFLGGVQIGYNYQINSAVLGVEADVSGADIKGH
FT                   SDEITSGLGDRYDTKVDWFGTLRARAGYAFDRTLIYGTGGLAFGSVENRYVDGPFDTFS
FT                   EKNTKVGWTIGAGLEQAITDHWSAKFEYQYVDLRDQTIDYAPNSNTTFDNTFNAVKIGM
FT                   NYKF"
FT   CDS_pept        641929..643131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0812"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48321"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48321"
FT                   /db_xref="InterPro:IPR021293"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LZ2"
FT                   /protein_id="BAB48321.1"
FT                   /translation="MTSGGLKRAHAAMLLGLLLSGATITEPQAASRVCRQLEADLAAAS
FT                   RGGGGGPAMIRKYDAAIDRQREQISKARDQADSAGCGFSLFSRNINRCAGLNATIDRMN
FT                   ANLDSLQAKRAQLAGGGGSRRDRGRILAALDANGCRDDTVAPRRAPLQEADRGEQDGKA
FT                   DLFDQLFGNQQSDTLDQPDDPSEERNVRGVLNLPGIPDVPGTGGEFHTTCVRTCDGYFF
FT                   PMSNAASVGDFERDQKNCESSCPGTEMQVFYSRGMDDDSASMTSSVTGRPYSELPTAYL
FT                   YKQSNMSRPPACGCNAAQNFQIIGGNPPPPQQSLPETEAAPLVPVPASKPDPGADPETL
FT                   ANREGGLDREAVKRLSAKPVTSPVSALPPEQRKVRVVGPTFLPDPSAAINLQAPAPKAV
FT                   Q"
FT   CDS_pept        complement(643049..644422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0813"
FT                   /product="glutamyl tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48322"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48322"
FT                   /db_xref="GOA:Q98LZ1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98LZ1"
FT                   /protein_id="BAB48322.1"
FT                   /translation="MTVTVRFAPSPTGRIHIGNARTALFNWLFALNNKGRFIQRFDDTD
FT                   IGRSKQEFADAILYDLHWLGIFPDATEYQSRRFEVYDAAVERLKAAGVLYACYETPEEL
FT                   DLRRKVRRTRGLPPVYGREALALTHEQVAEYQADGRRPHWRFLLPNFTGDPLQPERTEV
FT                   HWKDLVRGEETVDLASLSDPVLVREDGTYLYTLPSVVDDIEMGVSHVIRGDDHVTNTGV
FT                   QIALFKALGTEPPVFGHHNLLTTVSGEGLSKRTGALSIESLREDGIEPMAVASLAVLVG
FT                   TSENVAAAHDLTELAGHFDPAATSKSSAKFDPDELFVLNRVLMHHMPFDEARDRLMVLG
FT                   ISGEQAEPFWLAVRGNLDRLADAVGWWRILREGPQDRPEFSDDDRDFLGQAFEVLPEEP
FT                   WNGTVWKDWTGKIREATGRKGKGLFMPLRLALTGLPSGPELADLLPLMGREGTLARRP"
FT   CDS_pept        complement(644570..645973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0814"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48323"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48323"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LZ0"
FT                   /protein_id="BAB48323.1"
FT                   /translation="MASGIGRRPSPSGAVSWTDLRGMWHPHGLDVFYDAGLQHAFSTTG
FT                   CCMFTQRQSRDSRLVPLGSDWPAQDFDFTMHLASEDTGMEKLAAPSVLATQHGTVRPLA
FT                   AEDLERVAALFLTKFRRRRRHLLDRAIAEVAEYMRKIYLAPTDQSGASSALVQINPQGD
FT                   LGGFLGVLKACYELNGAVLNAAIIGPLMADTGTDHGSAGPQLLRAVHQGEFDLHLTDSA
FT                   NRVSLAFARPMKYQLLPTHCLGWTRIFRPAAVASAVVRGRWPGLSRFVLDPCARAFDPF
FT                   TRKRFEPTVQHSSSHRVHRQPMDAAQFAERLPTIVSDYALRPRWQDDELLRLLALAAEK
FT                   RADGPLHFSGTYDEAGKMLGCYAFYGQAGGIANLLQIQSSGPHWGATLDSLIEEAWNMG
FT                   CAGIIGQTQNRFMPQLFSYKNVFFRYAGGTMVRSRIPEVAQAVRSGDIFIGGLMGDRWT
FT                   RLSSDDFGR"
FT   CDS_pept        complement(645980..647785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0815"
FT                   /product="ATP-binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48324"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48324"
FT                   /db_xref="GOA:Q98LY9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LY9"
FT                   /protein_id="BAB48324.1"
FT                   /translation="MAHFKIDLRASAFRSVLGFTLTHWRRQPWRLSLIMGGFLLSTLAD
FT                   VLTPLYSGRLVDAVASSAGANAVAWNAAMTAFSILMALALTGVVLRNLAFMGIVELTLK
FT                   MMADIAADAFHRVQRFSTDWHANSFAGSTVRKVTRGMWALDLLNDTILIALLPSVVMLV
FT                   GSTLLLGWFWPLMGVVVAAGSVLFIMVTAMLSLGYVAPAARLANTWDTRLGGSLADAVS
FT                   CNAVVKGFGAEEREERRLAKVVAKWRARTRRTWVRGTINGTTQGALLLVMRAAVIGLSL
FT                   LLWSWGQASAGDVAFVLTSFFVLQGYLRDIGTHIRNLQRSINDMEELVDFQSEPLGIED
FT                   RPGARPIRITQGSISFDRVTFHYGNHRSPLYRDFSVDIAPGERVGLVGHSGSGKTTFVK
FT                   LIQRLYDVNAGRILVDGQDISQVAQASLRGQIAIVQQEPILFHRSLAENIAYARPSATQ
FT                   EEIEHAARLASAHDFISSLPKGYGTLVGERGVKLSGGERQRVAIARAFLADARILILDE
FT                   ATSSLDSESEVLIQQAMERLMVGRTTLVIAHRLSTVRALDRLLVFDRGNIVEEGSHDEL
FT                   IRLKGGIYRRLFERQALELTKGLVI"
FT   CDS_pept        complement(648179..648589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0817"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48325"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48325"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LY8"
FT                   /protein_id="BAB48325.1"
FT                   /translation="MPDCEISFDLARIDFRATSDLLMASYWGTGRSDEFHHRAFANSLC
FT                   AAAYIDGKQVGFGRAITDRTVFAYLADIIVWPQNRGQGIGQRLVQALIDHPELGSVSHW
FT                   SLSTGDAHGVYEKLGFKASTDGRYMRLDRAVQ"
FT   CDS_pept        complement(648643..650319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0818"
FT                   /product="NH3-dependent NAD synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48326"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48326"
FT                   /db_xref="GOA:Q98LY7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LY7"
FT                   /protein_id="BAB48326.1"
FT                   /translation="MTKKPDILRIAIAQLNPTVGDVAGNLAKAREARADAARQGADLVL
FT                   YTELFLAGYPPEDLVLKPAFLKACEKAAQEFAADTSDGGPGVIIGTPLKRKSGTHNSII
FT                   VADGGKIIAERYKLDLPNYGEFDEKRVFQAGPEIQGPVNFRGVRIGIPICEDIWGDVGI
FT                   CESLAESGAEILLVPNGSPYYRAKIDVRYQVVIRQIIECGLPITYANQLGGQDELIFDG
FT                   ASFAIGADKTLAFQMSQFEEAVDVVTWKRGEDGWVCSEGPMSKIPEREEADYRACMLGL
FT                   RDYVNKNGFKNVVLGLSGGIDSAICAALAVDALGEERLRAVMMPYRYTSKDSLKDAEDC
FT                   ARALGCRYDIVPIFEPVEGFLHALTQLFEGTKEGITEENLQSRARGTILMAISNKFGSM
FT                   VVTTGNKSEMSVGYATLYGDMNGGFNPIKDLYKMQVYALSRWRNSHVPPGALGPSGEVI
FT                   PKNIIDKAPSAELRENQTDQDSLPPYPVLDDILECLVENEMGVDDIVARGHDRATVTRI
FT                   EHLLYIAEYKRRQAAPGVKITRKNFGRDRRYPITNRFRDRG"
FT   CDS_pept        complement(650427..651143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0820"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48327"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48327"
FT                   /db_xref="GOA:Q98LY6"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LY6"
FT                   /protein_id="BAB48327.1"
FT                   /translation="MADFQKIRLRAAKRKGGEAELATLLGPVPDNAAVADIPDDRILST
FT                   MAERIFAAGFVWRVIEQKWPGFEEAFLRFEPKRLLFQPDDFWHDLTSDQRIVRNPQKIK
FT                   SVRDNAAFVERVSKEHGGFGEFLANWPAGDQVGLMAYLGKHGSRLGGNTGQYFLRWLGW
FT                   DAFVISADMAAALCDAGLDIAESPTSKKDLDKIQAQINQWVADTGLPRRHISRILAMSI
FT                   GENHSPQSLREYMGDD"
FT   CDS_pept        651308..651793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0821"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48328"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48328"
FT                   /db_xref="GOA:Q98LY5"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LY5"
FT                   /protein_id="BAB48328.1"
FT                   /translation="MLQSTLERTTISRDTNKAVAFHQTFGDRLADTIARIGGSWSFILG
FT                   FIAFLILWTSGNVWLLTRDAFDPYPFIFLNLVLSMVAALQAPVIMMAQNRQTERDRIDA
FT                   AHDYEVNLKAEIEIMALHEKLDELRHSQIIGMRDEIVRLAEAVKSIDERLARQQSAS"
FT   CDS_pept        651790..652377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0822"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48329"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48329"
FT                   /db_xref="GOA:Q98LY4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LY4"
FT                   /protein_id="BAB48329.1"
FT                   /translation="MTEAIHHFIEQYGLLAVFLGCVAEGESAAILGGFFAHQHVFVLWH
FT                   AIVAAALGAFVGDTCFFILGRSFADNRQVVRLRRRPGFRRAYRLLNTHPDIFVLSNRYV
FT                   YGMRLVGGIAAGLSTIAAPRFVILNAISSVIWAVLFSTIGYVFGLGAEHFVGQALMRHE
FT                   RLFIGLGIGLTVAALAWLVARHIAKRERRREQ"
FT   CDS_pept        complement(652401..652760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0823"
FT                   /product="diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48330"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48330"
FT                   /db_xref="GOA:Q98LY3"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LY3"
FT                   /protein_id="BAB48330.1"
FT                   /translation="MQRLIDAFFNSVRAFRKLAASEKAFQQELMLLVLALPAAWFVSVS
FT                   WRGYALLIGAVLLLIMVEVLNTGIEAACDAFSREFNVDIQLAKDCGSLAVLISVVIVAG
FT                   VWGIALIERITGFPI"
FT   CDS_pept        complement(652839..653255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0824"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48331"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48331"
FT                   /db_xref="GOA:Q98LY2"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LY2"
FT                   /protein_id="BAB48331.1"
FT                   /translation="MSDSHQGSCLCGAVRFRTKGALRGVVYCHCSQCRKQSGHFYAATN
FT                   VADADIVIEGTESITWYEASAFAGRGFCKTCGSVLFWKPRTQDYISVMAGAFDKPTGLK
FT                   GDCHIFVGDKGDYYSIDDGLPQFEKSTPSIAVAE"
FT   CDS_pept        653485..654741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0825"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48332"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48332"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LY1"
FT                   /protein_id="BAB48332.1"
FT                   /translation="MEVVRIKETLALPHLWSHQAKMAGGDASLRKTFWAIGSRSPCRRS
FT                   TEPANSALGSEGKSGSDMQPAAATTERSTDIAATVVATMRQLGVLGLPRNYEIFYEALS
FT                   GTNRELSLAVVSLSSRPTQDELDKIGRAFFAQNHGPGIVEHARDVIARELEEVAALLRS
FT                   ERSHIEKYGRILDETSNGLSGRSLLSQDLLQKIANAMAVATNSTIDHGKQIASTLSDKT
FT                   AELESVKSKLEEYKRLADTDPLTQIRNRRAFDKEITRIYNSNKGILFNALILADIDRFK
FT                   DINDRYGHPVGDKIIQIIAEIFQTSIRGDMFVARTGGEEFALIIEGASEDATYEIAERI
FT                   RALIEQTPFTSSQTGMNYGTVTVSMGICMASEAEGPEDLYTKADRALYRSKVSGRNRVT
FT                   KHSTMAGRAGKSWLLYKKD"
FT   CDS_pept        complement(654855..656228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0826"
FT                   /product="probable 2-dehydro-3-deoxyphosphoheptonate
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48333"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48333"
FT                   /db_xref="GOA:Q98LY0"
FT                   /db_xref="InterPro:IPR002480"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LY0"
FT                   /protein_id="BAB48333.1"
FT                   /translation="MTKWSPNSWRAKPIKQVPAYPDLAALKNTEAQLATFPPLVFAGEA
FT                   RKLKKQLAAVAAGEAFLLQGGDCAESFAEHGADNIRDFFRVFLQMSVVLTFAGAQPVVK
FT                   VGRVAGQFAKPRSSDNETKGEVTLPSYRGDIINGIEFDAKSRIPDPARQEMAYRQSAAT
FT                   LNLLRAFAQGGYANLENVHSWMLGFVSDSPQGEKYESLANRITETMDFMKAVGITSETN
FT                   YALRETDFYTSHEALLLGYEEALTRVDSTSGDWYATSGHMIWIGDRTRQPDHAHVEYCR
FT                   GIKNPLGLKCGPSLTADGLLELIDLLNPENEPGRLTLIARFGSDKVADHLPKLVRAVQK
FT                   EGRSVVWSSDPMHGNTIEAAGYKTRPFDRILKEVQTFFEVHRAEGTHPGGIHVEMTGKN
FT                   VTECTGGARAITAEELQDRYHTHCDPRLNADQAIELAFLVSDLLKKSHPVQHRQAVNG"
FT   CDS_pept        complement(656418..659915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0827"
FT                   /product="transcription repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48334"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48334"
FT                   /db_xref="GOA:Q98LX9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LX9"
FT                   /protein_id="BAB48334.1"
FT                   /translation="MSLIPTIGLPKGRAGQFIVDGVADGYEAFALVQAALEIAPDKPVL
FT                   FVARDGQRLPVIIEALAFAAPGLPVLELPAWDCLPYDRVSPGSDAAAKRLDALTAMIAL
FT                   AKKPHRAVILTTANALLQRIPPADLVEAQTFHARPGNQIDMNALIARLETSGFERVPTV
FT                   RGIGEFAVRGGILDLFAPGWAEALRLDFFGDTLESIRVFDAATQRTTGQRKSMALQAMS
FT                   EVALTPETISRFRRSYIEAFGAPQRDDGLYAAVSEGRRFAGMEHWLPFFYERLETVFDY
FT                   LPDTPVVFDHLAHEALAERHTLILDHYEARKKQADAALKDAVPYKPVAPDLLYLSPENL
FT                   IASLGPREAIDFTPFDAPDAGAKKVYHAGSRHGRSFVEERADPNVNVFDVVVRHIADER
FT                   AARRRIVIAGWTEGSLDRLGQILAEHHLGNLKQVETLAEAEQLDPGQAALAVLPLESGF
FT                   ETERLVVVAEQDILGDRLIRRSKRKKRASDFIAEASALSTGDIVVHADHGIGRFIGLRT
FT                   IEAVGAPHDCLEIHYAGDDRLFLPVENIELLSRYGSDSAEATLDKLGGGAWQSRKAKLK
FT                   RRLLDMAGQLIRIAAERQMRAAPALVPAEGLYDEFAARFPYEETDDQQTAIDSVRDDLG
FT                   AGKPMDRLICGDVGFGKTEVALRAAFIAAMEGFQVAVVVPTTLLSRQHFKTFSQRFSGL
FT                   PIRVAQASRLVGAKELAETKKALAEGQVDIVVGTHALLGSSISFKNLGLLIIDEEQHFG
FT                   VKHKERLKDLKTDVHVLTLSATPIPRTLQLALTGVRELSLIATPPVDRMAVRTFISPFD
FT                   PLVIRETLLRERYRGGHSFYVVPRISDLSEIHEFLKESVPELKVAVAHGQMPPGELDDI
FT                   MNAFYDGQYDVLLSTTIVESGLDIPTANTLIIHRADMFGLSQLYQLRGRVGRSKVRAYA
FT                   LFTLPANRKLTDTAERRLKVLQSLDTLGAGFQLASHDLDIRGAGNLLGEEQSGHIKEVG
FT                   FELYQQMLEEAVAEVKDSGEVQDGGWSPQIAVGTAVMIPESYVPDLQLRLALYRRLGDL
FT                   ENTEEIDAFGAELIDRFGPLPDEVKHLLKIVFIKALCRKANVEKLDAGPKGVVIHFRKR
FT                   EFSNPVGLVKFIGEQGSLAKIRPDHSVVFTRDWPTAEKRLAGSAVVMTQLARLVEKAA"
FT   CDS_pept        complement(659986..660273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0828"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48335"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48335"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LX8"
FT                   /protein_id="BAB48335.1"
FT                   /translation="MTGTKRSSEGLDAHRRKLLFRSWHRGMREMDLILGTFADAEIGAL
FT                   TGEEIEQYERLLDISDTEFLPLITGERPIPADIDCAVLQKILASRRTMTF"
FT   CDS_pept        660366..662474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0830"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48336"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48336"
FT                   /db_xref="GOA:Q98LX7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LX7"
FT                   /protein_id="BAB48336.1"
FT                   /translation="MRPSILDPLFVPITSLAGVGPKVGALIEKVVTADLGDRAARAGDL
FT                   LFVLPHTVIDRRSRPGIAGSAEGQIVTLDVRIDRHQPPPRGNRSVPYRVYAHDDTGEIG
FT                   LTFFHAHAAYLEKAMPVGEHVVVSGRMEWFNGRPTMVHPDHIALASEAENLPLVEPVYP
FT                   LTAGLSGKVLRRAIGQALARLPELPEWQDVAFMRRHTFPTFADALTRIHNPADPIDVSI
FT                   EGAAWRRLAYDELLAGQVSLALVRAKIRRLSGRPLVGDGRIVEKLRAALPYSLTASQEF
FT                   ALAEINADLADPERMLRLLQGDVGSGKTVVALLAMARAVEAGGQAALMAPTEILARQHL
FT                   ATIAPFAAKVGLRIAILTGREKGRERTETLAGLASGEIDIVVGTHALFQETVTFHDLVL
FT                   AVIDEQHRFGVHQRLAITAKGDAPDMLVMTATPIPRTLVLTAFGDMDVSKLTEKPAGRQ
FT                   PIRTVTLPLERLDELVARMQDAVAGGQKIYWICPLVEESEEIKLMSAEDRFASLKPLFG
FT                   DRIGLVHGRMKGAEKDEAMRAFKEGETRILIATTVIEVGVDVPDATVMVIEHAERFGLA
FT                   QLHQLRGRVGRGDKPSSCVLLYKDPLGETAKRRLSVMRETEDGFLIAEEDLKLRGEGEL
FT                   LGTRQSGTPGFQVARIEAHADLLEAARDDARLILSRDPELQSDRGEALRLLLYLFGRDE
FT                   AVRLLRAG"
FT   CDS_pept        complement(662426..663178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0832"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48337"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48337"
FT                   /db_xref="GOA:Q98LX6"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LX6"
FT                   /protein_id="BAB48337.1"
FT                   /translation="MSDAPKTSGMTRLRNYFLTGFVVCAPLAITAYIAWSFIGWVDSWV
FT                   KPYIPARYSPDTYLPFPVPGFGLIVALILITLIGFLTANIVGRAIVGFGERLLGRMPLV
FT                   RGIYGSLKQIFEAVLSNKGDMFRQVGLVEYPRKGVWSLVFVASEKETEINEKLDQEGDP
FT                   LIAVFMPCTPNPTTGFLMYVLKSDIVLLDMTIEDGAKLIVSAGLVAPEVKSKMVTLNGE
FT                   PINGTVANPPLGSHPARRSRTASSRPNR"
FT   CDS_pept        complement(663270..665093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0833"
FT                   /product="glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48338"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48338"
FT                   /db_xref="GOA:Q98LX5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98LX5"
FT                   /protein_id="BAB48338.1"
FT                   /translation="MCGIVGIVGHSQVAPLIVDALKRLEYRGYDSAGVATIEHGELARR
FT                   RAEGKLINLERRLKEEPLDGTIGIGHTRWATHGVPNETNAHPHFSDGVAIVHNGIIENF
FT                   AELRDELVRDGYAFSSQTDTEVVAHLVARELAKGLKPVEAAHQALKRLEGAFALAIMFK
FT                   GDEDLIVGARNGPPLAVGHGDGEMFLGSDAIALAPFTNSITYLEDGDWAVVRRDSVAIF
FT                   DIDGKKVERKRQQSLSTSFMVDKGNRRHFMEKEIHEQPEVISHTLAHYVDFVSGVSKPL
FT                   DLPFDFAKIGRLAISACGTAYLAGLIGKYWFERYARLPVDIDVASEFRYREMPLSANDA
FT                   AFFISQSGETADTLASLRYCRKAGMKIGAVVNVRESTMARESDVVLPTLAGPEIGVAST
FT                   KAFTCQLSVLASLAVRAGVARGVISQEQEKTLVRALSEAPRYANQVLKLEEQIERIARE
FT                   LSRYKDVLYLGRDTNFPLAMEGALKLKEISYIHAEGYAAGELKHGPIALIDENMPVIVI
FT                   APHDRIFEKTVSNMQEVAARGGKIILITDSKGAAQVSVKTMETIILPDVPEIISPIIYA
FT                   LPIQMLAYFAAVFMGTDVDQPRNLAKSVTVE"
FT   CDS_pept        665301..665516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0834"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48339"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48339"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LX4"
FT                   /protein_id="BAB48339.1"
FT                   /translation="MNEAQPTITLWRPIGPEELKLIEASNMRAFPPRLPEQPIFYPVLS
FT                   EAYAVQIARDWNVPASGAGFVTGLPC"
FT   CDS_pept        665510..665674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0835"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48340"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48340"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LX3"
FT                   /protein_id="BAB48340.1"
FT                   /translation="MLKSFLDRYRVEHAGSKAHLEYWIPAEDLDDFNKAIVGKIEVTAT
FT                   FGRDTAPAN"
FT   CDS_pept        complement(665678..667054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0836"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48341"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48341"
FT                   /db_xref="GOA:Q98LX2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98LX2"
FT                   /protein_id="BAB48341.1"
FT                   /translation="MSQRSCLSVILAAGEGTRMKSALPKVLHQIAGLPMVAHVVKAADA
FT                   AGASSDAIVIGHGAEEMRKAVTKFSPKAETFVQEERLGTAHAVLAAREAISRGYDDILV
FT                   MFGDTPLIDAEALNLARLKLAEGAAVAVIGFRPPLPNGYGRLVEKGGKLIAIREEKDCS
FT                   EAEKKIGFCNAGMMAVAGAHALKLLDAVGNKNAKGEYYLTDIVEIAGAQGLDVVATEAS
FT                   FENALGINNRAELAQAEGIWQARRRQEAMLSGVTLIAPETVYFSHDTEIGADTVVEPNV
FT                   WFGPGVKIAGGAKIHAFSHIEGATIAANCDVGPFARLRPGADLRNKAKVGNFCEVKQAV
FT                   IEEGAKVNHLTYIGDARVGAGANIGAGTITCNYDGFSKFFTDIGEGAFVGSNSSLVAPV
FT                   SIGKGGYIASGSVITESVPDDALAFGRARQKTIPGKGKELRERFASAAAAKKKAAGADH
FT                   "
FT   CDS_pept        complement(667211..667957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0838"
FT                   /product="c-type cytochrome biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48342"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48342"
FT                   /db_xref="GOA:Q98LX1"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LX1"
FT                   /protein_id="BAB48342.1"
FT                   /translation="MALDIGYVSAVGAGAISFLSPCVLPLVPPYLCYMAGVSVDDFRGD
FT                   AGVTAREGTRGALLYSSIAFVLGFSTVFVALGAGASTIGRLLRVWQEPLAMGAGVLIIL
FT                   MGLNFLGILRIPLLSREARFQSQGKPANAIAAYIMGLAFAFGWTPCIGPVLGPILTLAG
FT                   GRETVGEGALLLAAYSLGLGIPFLIAAVFSGAFMRFLGKFRVHLGRVEKAIGALLVVAG
FT                   VFFLTGGVQTVSYWLLENFPVLGRLG"
FT   CDS_pept        668879..671500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0839"
FT                   /product="DNA topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48343"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48343"
FT                   /db_xref="GOA:Q98LX0"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LX0"
FT                   /protein_id="BAB48343.1"
FT                   /translation="MDVVVVESPAKAKTINKYLGKNYKVLASFGHVRDLPAKDGSVRPD
FT                   EDFAMSWAVDTASGKRLADIAKAVKDADGLILATDPDREGEAISWHVLEVLKQKRALKD
FT                   KPVSRVVFNAITKSSVLEAMANPRQIDAPLVDAYLARRALDYLVGFTLSPVLWRKLPGA
FT                   RSAGRVQSVALRLVCDRESEIERFIREEYWQIAAILGTPRNETFEARLTAFERKKLQKL
FT                   DIANKAQADDIKAMLEGATFKALSVEAKPTKRNPGPPFTTSTLQQAASSGLGFSATRTM
FT                   QVAQRLYEGMEIGGETTGLITYMRTDGVQMAPEAIDAARDAIAKEFGPKYLPEKPRFYT
FT                   TKAKNAQEAHEAIRPTDFMRTPASVRQYLDSDQMRLYELIWKRAIASQMQPAEIERTTV
FT                   EIEAVNGARTAELRAVGSVVRFDGFIAAYTDQKDDDAEDEENRRLPEIRAGEQLARQAI
FT                   NATQHTTEPPPRYSEATLIKKLEELGIGRPSTYTAILKTLEDRDYVTIDKRRLVPQAKG
FT                   RLLSAFLESFFERYVEYDFTASLEEKLDEISDGKLAWKDVLRDFWKDFSGAVADIKELR
FT                   VTDVLDALNEELAPLVFPAREDGSNPRICPKCGTGNLSLKLGKFGAFVGCSNYPECSFT
FT                   RQLGDAANPNGENGGGDDGTKVLGKDPYTAEEITLRSGRFGPYLQRGDGKDAKRSSLPK
FT                   GWTPETIDHEKALALLALPRDIGKHPETSKMISAGLGRYGPFVLHDGTYANLDSIEDVF
FT                   SIGLNRAVTVIAEKQSKGKGGRNGGTPAALKELGDHPDGGGKIVVRDGKYGPYVNFGKV
FT                   NATLPKGKDPQSVTIEDALALIAEKEAKGGGGKKPFRKAAAAKAPAAKKTAARKPAAKK
FT                   KG"
FT   CDS_pept        671507..673813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0841"
FT                   /product="ribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48344"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48344"
FT                   /db_xref="GOA:Q98LW9"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LW9"
FT                   /protein_id="BAB48344.1"
FT                   /translation="MARRITGRSHGDPRTADTRAKVKDDYRPSRDEILRYIAENPDRAG
FT                   KRDIAKAFALRGDDRIWLKDILRDLQDEGVLTKERKRLARVGALPHVAVLDIFGRDGDG
FT                   ILLAHPAESIGSGEPPVVSIRVSRSGNGPAPGIGDRVLAKTFPTDDPSGPAYTGRVMKI
FT                   FEKRTDAVLGVFRVLKDGTFRIEPVERRQPELIVDKEFQNGAENGDLVEVEPARASRYG
FT                   LPKAKVLNVLGSLTSEKAVSMIAIHAHDIPHIFPADVIAESEAVKPATLDRREDWRDLP
FT                   LVTIDPADAKDHDDAVFATPDLDEKNPGGVIATVAIADVAAYVRYGTALDREALKRGNS
FT                   VYFPDRVVPMLPERISNDLCSLREGQDRPALAVRMTFSAEGHKIRHSFHRVMMKSAAKL
FT                   AYPQAQAAIDGAPDEKTGPILDTVLKPLWDAYAILKRGRAGRQPLELDLPERKIMLKPD
FT                   GTVDRVIVPERLDAHKLIEEFMIQANVAAAETLEAKKQALVYRVHDAPSLAKQESLREF
FT                   LQTLGLSLARGAQMRPSQFNGILERVRGADNEALVNEVVLRSQSQAEYSPGNIGHFGLN
FT                   LRRYAHFTSPIRRYADLIVHRGLIAALGLGPGGLTQDEAARLEDVAILISGTERRAMAA
FT                   ERDTVDRLIAAYLAERIDDRFDARISGVTKSGLFVQLPQYGADGFIPVSTLGGDYYIYD
FT                   EAARSLFGERTGKGYQLADHVEVRLVEVAPMAGAMRFEMLTDPKPLPGSTRSFHKAKGR
FT                   ARASQSRPGSRGRRR"
FT   CDS_pept        673813..674265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0842"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48345"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48345"
FT                   /db_xref="GOA:Q98LW8"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LW8"
FT                   /protein_id="BAB48345.1"
FT                   /translation="MPKELGIQEQVFGGEHHTGRVARPLWTAMKRGLLGRCPNCGEGKL
FT                   FRGFTKTVDTCSVCGEEIHHHRADDLPAYLVIVIVGHIVLGAFMGVEATSTLSTWQHIL
FT                   IWVPLTIILSVALLQPVKGAVIGLQWAFYMHGFGGEKDGAGSHHGA"
FT   CDS_pept        674348..675079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0843"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48346"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48346"
FT                   /db_xref="GOA:Q98LW7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LW7"
FT                   /protein_id="BAB48346.1"
FT                   /translation="MTKADVDKLDKGLAAHGGRPLRPRDAATLILLDRKGDEVLVLMGR
FT                   RHAGHAFMPGKFVFPGGRTDPADSRIATATALHRDEEAKLLAGPGRTSAARARAVALSA
FT                   IRETYEEAGLLIGERAAFATDKRDWQGFVEHGVRPSLETLRFIARAITPPNRVRRFDTR
FT                   FFSAWRSDVAVELPGGGPTNELEELVWLPLAKAREADIPDITRMILDELEKRLAHDPLL
FT                   RPGGPVPFYRLVRNRFTRELL"
FT   CDS_pept        675158..676336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0845"
FT                   /product="multidrug-efflux transporter lile protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48347"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48347"
FT                   /db_xref="GOA:Q98LW6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LW6"
FT                   /protein_id="BAB48347.1"
FT                   /translation="MTVDTQPQGDERVHWLPMVAAISSISVVGIAIGLGMPLLSVILET
FT                   RGHSASMIGLNTAVAGLASIAGAPLATPLAMRFGVAWTMIAMIATGALAFVGFHFAPNF
FT                   WMWFPLRIVLHIALTVLFILSEFWISTSAPPHRRGLVLGIYATVLSLGFAAGPWLFAHL
FT                   GSSGFRPFGVIIALVTLAAIPVLAARNESPSIVADGETSNFLRYIWLVPTATFAVLVFG
FT                   AVETGGFALFPVYGNRIGYSEADAALLLTMIGLGNVLLQIPIGMISDRVSDRRYLLLAC
FT                   ATVGLAGTLFMPFFAANWHLMAALLFVWGGVVAAMYTIGLAHLGSQLSGHELASANAAF
FT                   VLCYGVGMVLGPQAIGIGMDSFGPSGFGWSLGLFFGAYIALVCFRLVRKILL"
FT   CDS_pept        676449..676907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0847"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48348"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48348"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LW5"
FT                   /protein_id="BAB48348.1"
FT                   /translation="MIDSGFETTSLRMTLLLLVTFQAPAADVDRIMDAVVAIAPLAMGK
FT                   YDRNAYQSAHGIERYRPLEGAAAGAEIELRRRPGTVEVSFELPDDQALAAQVVEAIFQA
FT                   HSYQEPVIRIQPILASRSKGLDDRANPNRWWNTTGDWKKIAAPETQTA"
FT   CDS_pept        677061..677228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0848"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48349"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48349"
FT                   /db_xref="GOA:Q98LW4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98LW4"
FT                   /protein_id="BAB48349.1"
FT                   /translation="MAKAANIKIKLLSTADTGFFYVTSKNSRTKTDKLSFRKYDPVAKK
FT                   HVEFKETKIK"
FT   CDS_pept        complement(677824..678891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0849"
FT                   /product="ATP-binding protein of sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48350"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48350"
FT                   /db_xref="GOA:Q98LW3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LW3"
FT                   /protein_id="BAB48350.1"
FT                   /translation="MASVTLDKVRKDYGAVRVLHAVDLEIADGEFVVLVGPSGCGKSTL
FT                   LRMIAGLEEASGGEIRIGERLVNDVAPKDRDIAMVFQSYALYPHMDVSKNMGFSLLLKK
FT                   AQKSTIDARVDGAAKRLGLDTFLQRLPRQLSGGQRQRVAMGRAIVRDPKVFLFDEPLSN
FT                   LDAKLRVHMRAEIKALHQQLKTTSVYVTHDQIEAMTMADRIVVMHDGLIQQVGAPLDLY
FT                   DRPANVFVAGFIGSPGMNFLPATVEKGAKADAVLSDGQKLRLPDGLPLKDGDAITIGLR
FT                   PEHIRLAEDGALQGEVVVVEPLGLSTQFYVTLANQQLCVFAMGRAGVKPGDIVRLAADP
FT                   AALHLFDPKSGDRIG"
FT   CDS_pept        complement(678896..679744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0851"
FT                   /product="permease protein of suger ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48351"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48351"
FT                   /db_xref="GOA:Q98LW2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LW2"
FT                   /protein_id="BAB48351.1"
FT                   /translation="MIAGRSNSQRFFGGVGLYAAIAAYVVFALFPIYWTLKISVTPERL
FT                   LYSEGVTFWPSRMTLQNFVTVLEATDFPRYFLNSVIVSVSTAALVTVTATLAGYAMSRF
FT                   TFRGKAALALMLLLTQTFPLVMVIPPIYRVMGQIGLINSLTGLIIIYTAFNTAFATFLM
FT                   QSFFDGIPKDLEEAAMIDGCTRAQAMRKVIVPLTLPGMGATLGFVFTAAWSELLFALML
FT                   ISSDDQKTFAVGLLTFIGKFAVDWGQMMAASILALIPVCIFFAFLQRYLVTGLTAGAVK
FT                   G"
FT   CDS_pept        complement(679744..680667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0853"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48352"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48352"
FT                   /db_xref="GOA:Q98LW1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LW1"
FT                   /protein_id="BAB48352.1"
FT                   /translation="MTYAVSEIRSAGKPRRKRLSHAAIEPWLYLSPSIILLVVVLLVPL
FT                   VIGISYSFRKFSAFKSEFVGLGQYRAMLSDPVLGQALVNTLWWTVASLFFQFFLGLGLA
FT                   LLLDKPFRGRKLVQALVFLPWAVPSFLSGLTWAWLFNPIIGPLPHWLFALGLKAEPTNI
FT                   LSDPATAMWGPIVANVWFGIPFFAITLLAALKSIPSELHEAAAIDGASPWQRFTKVTLP
FT                   FLAPTIAITVMLRTIWIATFADLIFVMTEGGPAGSTNTVPVYIYVSAFKSLDKGYASAV
FT                   AVLLLVLLIAYAIALIAIRRSLVRHV"
FT   CDS_pept        complement(680851..682143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0854"
FT                   /product="probable secreted solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48353"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48353"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LW0"
FT                   /protein_id="BAB48353.1"
FT                   /translation="MGVLNMKKLTVMLATVAGLAISAGSALADSTLKMVEVITSPPRTE
FT                   FLKKQIAEFEAANPGVKVELISLPWGQAFEKFLTMVQAGDTPDVVEMPERWMGLYANNA
FT                   QLEDLGPYMAKWDDAKTLGERAKQFGSTVNNTQFMIPYGYYVNALFWNKKLFKQAGLDG
FT                   PPATLDEFVADSKKISAIPGKYGYCLRGGPGAFNGMHMFMNIAQGKGGYFNKDGTSTIN
FT                   EEGSVKGLQMLADMYKDGLAPKDAVSWGFNETVTGFYSGTCAMLNQDPDALLGIADKMS
FT                   ADDFAVAPLPVGPSGKSYPTLGYAGWAMFANSQHKDDAWKLMATLLSPKDNLEWAKEVG
FT                   VVPIHNGADQDPHFKTEQFKGWFTELSDTSKYEMVTPPTHLENLGNFVDQVAIKNFQEV
FT                   LLGQKTAKDVADQWAAFLTKEQQDWLAKNKK"
FT   CDS_pept        complement(682158..683345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0856"
FT                   /product="methionine gamma lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48354"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48354"
FT                   /db_xref="GOA:Q98LV9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LV9"
FT                   /protein_id="BAB48354.1"
FT                   /translation="MNEHPSGFDHDYLAEAATLLAHDEPFPGGAVVPPIYQTSLFTFAN
FT                   YAEMADTFAGKRKQPIYSRGDNPTVMEFEARVAALEGAEAARGFSSGMAAISATVLAFV
FT                   GAGERIVAVRNCYGDAYRLFERLLPRLNIKVDYVDGSDPDAVAAALPGAKLLYLESPTS
FT                   MMFELQDIAHLTRLAKEQGIVTTIDNSWATPVFQKPISHGVDLVLHSASKYLGGHSDTV
FT                   AGVVAGSAAHIKHINEQTYSYLGGKLSPFEAWLLLRGLRTLPLRLPHHMKSGLTLAERL
FT                   KAHAHVERVNHPAYSNHPGKATLAGYAGLFSFEVTDDIDIPVFVDALKYFRIGVSWGGH
FT                   ESLVVPAKASLEQTPGLNSMARFGVSPRTIRFNVGLESVEDLWADVAQAFEKARK"
FT   CDS_pept        complement(683342..684124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0857"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48355"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48355"
FT                   /db_xref="GOA:Q98LV8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LV8"
FT                   /protein_id="BAB48355.1"
FT                   /translation="MQKLVGPLDHLNSGGFVDQNSLPPIQTTARDDAVLKALVGFVRAE
FT                   ALQPGNRLPTERILAERLKVSRNTVREALTRWEGLGLVERRQGSGTYLKAAVSPDMLHM
FT                   PLTLAGGNDFTSLMHTLEIRRALEAEAAALCAERASPADIAEIKRKLDIMEQAFRTRDG
FT                   MSSEEDWEFHQAIYRVSGNPLFEQIIAAMHELFHRFWEHPLGVRDFGHASFPYHRTIYE
FT                   CIAARDPQGARAEALKLIATVEDDLKRGAAKLKLSSQT"
FT   CDS_pept        complement(684236..685786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0858"
FT                   /product="probable tetracycline 6-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48356"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48356"
FT                   /db_xref="GOA:Q98LV7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LV7"
FT                   /protein_id="BAB48356.1"
FT                   /translation="MAYKGLAARPGSSRKTHANQARKREWRLTISEHAVVIAGGGPTGL
FT                   MLAGELALAGIDVAIVERRPDQQLIGLRAGGLHARTIEILDQRGIADRFLSQGQSFPTV
FT                   GFHMIRLDISDFPSRHNYLLALRQNHIERILVDWIDELGVPIYRGQDVTGFAQDDDGVD
FT                   LDLSGGQRLRAQYLIGCDGGRSTIRKAAGIEFPGWDPTMSWMIAEVEMSGEPALGFRSD
FT                   AYGIHAIGKIEENGRVGVVLTERQLTIGGEPTLADLREALVAVYGTDYGVHSPTWISRF
FT                   TDMTRQAAAYRDRRVLLAGDAAHIHPPMGGQGLNIGVQDAVNLGWKLAQVVKLISPESL
FT                   LDSYHAERHPIAARVLRNAKAQVALRRIDASTKALNDTLTELLGMDEPRKRIAAEMSGL
FT                   GIHYDLGAGHPLLGRRMPDLDLATASGPVRVFSLLHDARPVLLNLGEPGGLDIAPWANR
FT                   VRQIEAGYNGTWELPVLGTVAPAAAVLIRPDGYVAWVGIGTQHGLAEALTTWFGPPAT"
FT   CDS_pept        complement(686216..687442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0859"
FT                   /product="response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48357"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48357"
FT                   /db_xref="GOA:Q98LV6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LV6"
FT                   /protein_id="BAB48357.1"
FT                   /translation="MLLDVMMPDMDGFEVCRRLKSDPATSHIPVVMITALDQVSDRVRG
FT                   LEAGADDFLTKPVNDLQLMTRVKSLVRLKSLTDELRLRASTTRNIGIEELLSRNFASED
FT                   TTPKVLLIDERKSSVERIQKMLRDRADLDVIGDPHAGFFQAAETSYECVMISTAFADFD
FT                   PLRLCSQLRSLDRTRFVPIILLAEEGEEERIIRGLELGINDYLMRPIDQQELTARLRTQ
FT                   VRRKRYNDQLRASVTQTIEMAVTDGLTGLHNRRYLDSHLQTLFDRAVARRRPLSVMITD
FT                   LDRFKSINDAHGHDGGDEVLREFARRLRKNVRGIDLACRFGGEEFVVVMPDTDGAVAEK
FT                   VAERIRAEIAQKPFAIGADGKTIEVTVSVGVSSVLKGVDTVAALMKRADLALYEAKSGG
FT                   RNRVVAKAA"
FT   CDS_pept        complement(687623..687994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0861"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48358"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48358"
FT                   /db_xref="GOA:Q98LV5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LV5"
FT                   /protein_id="BAB48358.1"
FT                   /translation="MPKKVMIVEDNELNMKLFRDLIEASGYETVRTRNGLEALDLARKH
FT                   RPDLILMDIQLPEVSGLEVTKWLKEDDDLHVIPVIAVTAFAMKGDEERIRQGGCEAYIS
FT                   KPISVPRFIETIKSYLGDA"
FT   CDS_pept        688238..688540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0862"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48359"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48359"
FT                   /db_xref="InterPro:IPR021955"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LV4"
FT                   /protein_id="BAB48359.1"
FT                   /translation="MMANAASMREEAETIAVKALGFVASDPELLPRFLAITGIEAHSIR
FT                   KAAGEPGFLAGVLQFILAHEPTLMRFAEETGTPPAAVGKALRALPLGDDNHERSI"
FT   CDS_pept        688537..689190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0864"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48360"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48360"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LV3"
FT                   /protein_id="BAB48360.1"
FT                   /translation="MSDDPETARQIEELAADGRPLLVLDVDDVVLEFIRPFPHFLKSRG
FT                   YGLTLASFRLTGNIAETASGRLIEQLEVTALLGDFFDAQAEWQGITDGAAETLARLGGR
FT                   AEIILLTAMPHRHRAVRRAHLDALGLNYPLLTTEMAKGPAVARLRGKSGRPVVFVDDQP
FT                   HNLASVRESVADANLFHLMADNSLRAFLPPVPDDVIVVQDWHEAGPKIVGALGL"
FT   CDS_pept        complement(689256..690923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0865"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48361"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48361"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LV2"
FT                   /protein_id="BAB48361.1"
FT                   /translation="MMVFAYQKYETIFAFSIQRRLPVNRMLPVAFTALLFSAPAFGQAV
FT                   DSQGAKQLSDDLSRYVGKQAFDKGILKVSVEGGAYKIAFDVKALAATFPEQGKVKLDFA
FT                   PYALLVKPRSDGTWDVSIDFSQSGSFEFTGPEGLQSTQFSIKDGKGSGVYDPNLAAFIS
FT                   GTSSLAGMTMASKDAKQQMEASTGAGTATIAATKAANGGVDFTMSQKISNFVEAIKLDD
FT                   PENGLNFPVTIKSPELSVEASGKGVQTRPLLDLLAFAVANEDEKTLEANQAQLKSLLRA
FT                   ALPVWERIDGTYGFKDFAVDSPIGTFGATQLSTVFGSDGVSQSGKVTYGIKASGLTVPQ
FT                   QLLPSWSVALLPTDIDLNFGGANIDLDSMAKKAIEAFDLNQDPPLSAEFGDQLKADFLA
FT                   KAPKVMIGHSVVKNKDMEIALEGEMTSFGQKPDANLTVDVAGFDKIMAHLQEAAKAEPE
FT                   VGQYVPVALMAKGFAKTLPDGRLEWAVSTKADGSVTVNGVMLKPADPAVDDGGDGGDGG
FT                   DGADDSSGGDNGGGANSGGGDANGGSSDNGGAGAKLNP"
FT   CDS_pept        691609..692925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0866"
FT                   /product="DNA damage inducible protein P"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48362"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48362"
FT                   /db_xref="GOA:Q98LV1"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98LV1"
FT                   /protein_id="BAB48362.1"
FT                   /translation="MAAPVNNPDHGFCRDCLTFQRSETRRCERCGSPRLARHPELYRLH
FT                   LAHIDCDAFYAAIEKRDNPALKDKPLIIGGGKRGVVSTACYIARIRGVRSAMPMFKALE
FT                   ACPEAVVIPPNMEKYVRVGREVRAMMQTLTPLVEPLSIDEAFLDFAGTERLHGQPPAVV
FT                   LARFALAVEKEIGITVSAGLSYCKFLAKIASDFRKPRGFSVIGEAEAVGFLATKPVTMI
FT                   WGVGKAFNATLERDGIRTIGQLQTMERGDLMRRYGVMGDRLYRLSRGEDVRRVDPDQDA
FT                   KSVSAETTFDTDIASLDELVSVLRGLSEKVSARLKKSGIAGRTVVLKLKTQDFKLRTRN
FT                   RQLGDPTRLADRIFQAGVELLRKETDGTKFRLLGIGVSDLSDDDKADPPDLVDVQSRKR
FT                   AMAEGAIDALRDKFGRKAVETGYTFGRGRDAHPPEPLED"
FT   CDS_pept        complement(692960..693466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0867"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48363"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48363"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LV0"
FT                   /protein_id="BAB48363.1"
FT                   /translation="MRPFAQFALAGCLLVAAGTAHADETKFLQSFKGNFAGKGTVQVTS
FT                   DVPNVNVSCSFKSNATSTSLSLDGSCRGLILVTRAISAKLNVTGAKYSGVYVGSRTGPA
FT                   QLNGSRSGNAINLGIQWAQEINGDRKARMTVEKRGENGIRLTVTDTDPKTGKNVVMSRI
FT                   DLSRT"
FT   CDS_pept        693663..694544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0868"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48364"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48364"
FT                   /db_xref="GOA:Q98LU9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LU9"
FT                   /protein_id="BAB48364.1"
FT                   /translation="MAPTPSIPKAAFWMALSISSFLAMSVAGRATTAELNVFQVLELRS
FT                   VIGFFILLPLVLTSGGFAAMRTQRPLAHIARNVVHYSGQAAWLYALTLIPLAVLISIEF
FT                   TTPIWTAILAVTFLGERLSRPKLAAVGLGLIGVVVIVRPGVDAVDPGHLVVLGAAVCFG
FT                   ISLVLVKSLTRTDSVVRIIFWMLIIQSALGLVPALYVWRTPSLELWPWILLIAFTGMSS
FT                   HFCMARALTYADATVISPMDFLRVPLSALVGWLLYHEQIDAFTAGGALLILMGNLLNLQ
FT                   RKPVQPAEVAAS"
FT   CDS_pept        complement(694719..695522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0869"
FT                   /product="ion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48365"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48365"
FT                   /db_xref="GOA:Q98LU8"
FT                   /db_xref="InterPro:IPR003938"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LU8"
FT                   /protein_id="BAB48365.1"
FT                   /translation="MKAADKRASPDRSAMARLRDTLRRLYHGRTAAAFRFQVAAIVIDL
FT                   AIIGFFIATPVIQQSASFLWLDYAVAALVGADLIARLLASNDMLRLMKQPTSWVDVFIL
FT                   LTLLMPTALANLGFLRILRLWSLSRSGSIWRHFEMRGLRPWREASHAVINLLTFLFVIT
FT                   GFVYTFFFRNGAGLENYIDALYFTVATVTTTGFGDIVLPGMAGKLTAIVTMIIGISLFV
FT                   RLAQAMFRPAKVFFPCPQCVLQRHEPDAVHCKACGHVLNIPNEGD"
FT   CDS_pept        complement(695575..699102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0870"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48366"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48366"
FT                   /db_xref="GOA:Q98LU7"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LU7"
FT                   /protein_id="BAB48366.1"
FT                   /translation="MADDRLPRDPLKREAAIAAARPEVPARPFVHLRVHSAYSLLEGAL
FT                   QLGKIVGHAVKDEAPAIAVTDTNNLFGALEFAQKAVKDGIQPIIGCQIALAFSGENSDG
FT                   QRDRRRQGPEMRPVVLLAATEAGYSNLVRLVSRVYLETPPGEAVHLTTEMLEGKADGLI
FT                   CLSGGPRGPIGNALKEDRRDLAEVRLLTLKTLFGDRLYVELDRVAGYDRVIEHQTIDLA
FT                   YAHELPLVATNEAFFSSRDDYEAHDALIAIAEGSVVAVDTRRRLSPDNFLRSQAEMAQL
FT                   FADLPEAIDNTVEIALRCSYYPKTRSPILPRFTGGDASDKDAAEKAEAAELARQAREGL
FT                   DARLALHGPTPGYTVEQYRERLEFELGIIEKMKFPGYFLIVADFIKWAKAQGIPVGPGR
FT                   GSGAGSLVAYSTTITDIDPLRFSLLFERFLNPDRVSMPDFDIDFCQDRREEVIRYVQQK
FT                   YGRDQVGQIITFGTLQARAVLRDVGRVLQMPYGQVDKLSKMVPQNPANPVKLADAIANE
FT                   PRFAEEAEKEPIVQTLLDMAQKLEGLYRHASTHAAGIVIGDRPLSELVPMYRDPRSDMP
FT                   VTQFNMKYVEQAGLVKFDFLGLKTLTVLETAVKLIRRRGIDIDLATIPLDDPETYAMLS
FT                   RGEVVGVFQVESAGMRKALIGMRPDCIEDIIALVALYRPGPMENIPTYNARKHGEEEMA
FT                   SIHPKIDHLVKETQGVIVYQEQVMQIAQELSGYSLGEADLLRRAMGKKIRAEMDKQRER
FT                   FVSGAVERGVSKPQADFIFDLLAKFADYGFNKSHAAAYAVVSYQTAYLKAHYPVEFLAA
FT                   SMTLDMGNTDKLADFRQDALRLGIEVLAPSVMTSFRPFEVGENRIYYSMAALKGVGDAA
FT                   VEHIVAVRGEKPFKNLADFCERVDPKIVGKRVFESLIMAGALDCFGHDRAQMMAGVERM
FT                   MGLASLAQQNAVSGQADIFGASLGAQSQALNLPATDPWLAADRLHREFQVVGFYLSAHP
FT                   LDEYKAALQKMRVQNWAEFSAAVKRGASAGRLAGTVTSKQERKTRTGNKMGVVAFSDTS
FT                   GQYEAVLFSEALAQYRDLLEAGRSVVITVAAEDRPEGVNLRINSVQSLEEEASRIQKAL
FT                   RIFVRNEGPASIIQSQLTQRGESQVSIIVIKEEAQGEVEIALQGGYRVSPQIASAMRAV
FT                   PGVVEVELV"
FT   CDS_pept        complement(699356..701368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0871"
FT                   /product="propionyl-CoA carboxylase alpha chain precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48367"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48367"
FT                   /db_xref="GOA:Q98LU6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR041265"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LU6"
FT                   /protein_id="BAB48367.1"
FT                   /translation="MFTKILIANRGEIACRVIKTARKMGIATVAVYSDADRDAVHVEMA
FT                   DEAVHIGPSPAAQSYLVPEKIIAACKETGAQAVHPGYGFLSERAAFCEALEKEGIVFIG
FT                   PKPKAIKAMGDKIESKKFANAAKVSTVPGWLGVIENADHAEKIAGEIGYPVMIKASAGG
FT                   GGKGMRIAWNQSEVRDGFDRARSEAKSSFGDDRVFIEKFVVDPRHIEIQVLADAHGNAL
FT                   YLGERECSIQRRNQKVAEEAPSPFLDAKTRKAMGEQSVALARAVDYQSAGTVEFIVDKD
FT                   KNFYFLEMNTRLQVEHPVTELVTGIDLVEQMIRVAAGEKLSLKQSDIKLNGWAVESRLY
FT                   AEDPYRNFLPSIGRLTRYRPPEEGQFGDVVIRNDTGVTEGSEISMFYDPMLAKLCTWAP
FT                   TRIEAIDAMSEVLDSFVVDGIEHNIPFLAALMQHPRWREGAISTGFIAEEYPDGFAPVV
FT                   PNSREKAVLASIVTAVELLRRDRLDRLGGRLAPHSGVLKRDWVVRLGDDYLQASILEGM
FT                   ISIPMEIDLSIDGGKALTVSSDWRPGDLIWRGTVGKRSVVAQIRPVANGLRIAWKGMSV
FT                   TARAMLPRIAELERLMPEKVAPDTSKLLLCPMPGLVVSIAVTEGQEVKAGETLAVVEAM
FT                   KMENVLRAERDLVVSKLNAKPGDSLAVDAVIMEFA"
FT   CDS_pept        701568..702695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0872"
FT                   /product="glutathione dependent formaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48368"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48368"
FT                   /db_xref="GOA:Q98LU5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LU5"
FT                   /protein_id="BAB48368.1"
FT                   /translation="MKTRAAVAVAAGKPLEIMEVDLDGPREGEVLVEIKATGICHTDEF
FT                   TLSGADPEGLFPAILGHEGAGVVVDVGKGVTSVKKGDHVIPLYTPECRQCPSCLSRKTN
FT                   LCTAIRATQGQGLMPDGSSRFSIGKDKIFHYMGCSTFSNFTVLPEIALAKVNPDAPFDK
FT                   ICYIGCGVTTGIGAVINTAKVEQGATAVVFGLGGIGLNVIQGLKLAGADMIIGVDLNND
FT                   KKAWGERFGMTHFVNPKEIDGDIVPHLVNMTKRGADQIGGADYTFDCTGNTKVMRQALE
FT                   ASHRGWGKSVVIGVAGAGQEISTRPFQLVTGRTWMGTAFGGARGRTDVPRIVDWYMDGK
FT                   IQIDPMITHLLKLEDINKGFDLMHEGKSIRSVVVY"
FT   CDS_pept        702658..703332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0874"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48369"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48369"
FT                   /db_xref="GOA:Q98LU4"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR014185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98LU4"
FT                   /protein_id="BAB48369.1"
FT                   /translation="MRASRSVASWFTEASHTPPTDRPATSVVQNWEEKRMAEKLHPRID
FT                   NGLPKESASFAGGTLVCACTSKPVKVKVKGQIAHNHACGCTKCWKPEGAIFSVVAVAGT
FT                   GDVTVTENGDKLKVVDASALIQRHACTGCGVHMHGPVERDHAFKGLTFIHPERFVEDGW
FT                   SPPGFTAFVSSIIESGVDPKRMDGIRAQLRTIGLEPYDCLNPGLMDYIATWTAKKSGAL
FT                   PA"
FT   CDS_pept        703363..703863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0875"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48370"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48370"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98LU3"
FT                   /protein_id="BAB48370.1"
FT                   /translation="MFPAPVRFGEIMPAPTIYVDADACPVKAEVEKVAERLGVVVTYVS
FT                   NGGLRPSRDPMIRNVVVSKGADAADDWIVENAKSNDVVVTADIPLAARAVALGAHVLGP
FT                   TGRPFTPETIGMAVAMRDLKQHLRETGESKGYNASFAPQDRSRFLGELDRILRRALKSA
FT                   TPG"
FT   CDS_pept        703883..704572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0876"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48371"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48371"
FT                   /db_xref="GOA:Q98LU2"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LU2"
FT                   /protein_id="BAB48371.1"
FT                   /translation="METAMAAETPIPRPVQRHMLFAMSACFGALAFLVALLLHAPLAYS
FT                   IGANAFFAAYVILVVSQMPKFTGKYLSKNARATDQPVLVIFAVTLVVVIVAVVSLFLLI
FT                   NQKNRGNSVELGFALLSIPLGWFTIHAMAALHYAHVYWMDGDAVDAETKKKIPVGGLLF
FT                   PGDKRPEGWDFLYFSAVIGMTAQTADTNISTTHMRCVVLVHSILSFFFNTVIVAAAVNL
FT                   AVSLGGP"
FT   CDS_pept        704670..705551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0877"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48372"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48372"
FT                   /db_xref="GOA:Q98LU1"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LU1"
FT                   /protein_id="BAB48372.1"
FT                   /translation="MQSVARSQSATGPDAPVSSDSTLIYRQSRWTRLTHWIWAISLFFM
FT                   LLSGLQIFNARPQLYIGKQSGFGYNNTIFEIGAVNTDAGPRGFTEIFGHRFDTTGVLGW
FT                   SGPPGNETARGFPSWATIPSYYDLGTARVVHFFFAWILTTTLIVWLVASLVNGHIRRDL
FT                   APRLDDLKRLPRDIVDHARLKFHHTREYNTLQKMAYGGVLFVLLPLMIITGLAMSPSMN
FT                   SVLPFLNEVLGGRQTARTIHFTVMLLLVGFFIIHILMILAAGPINELRSIITGWYRTDP
FT                   PAHDDKTTERSA"
FT   CDS_pept        705520..706362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0879"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48373"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48373"
FT                   /db_xref="GOA:Q98LU0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LU0"
FT                   /protein_id="BAB48373.1"
FT                   /translation="MTTRRPRGVPDMAKFEISPNFQISRRKFLTAASLGASGIMLSGCD
FT                   AFDSQLSIGSGLRSFLENANGLTYRAQRLLAGRDALAPEFTEADIRQPQRPNGVTAPDD
FT                   DTYKGLLANNFADWRLEVSGLVEKPLSLSREQLQNMPSRTQITRHDCVEGWSCIAKWTG
FT                   TPLSLVLDQAVVKPQARYVMFHCLDTIDRSLSGDIKYYGTIDLIDARHPQTILAYGLNG
FT                   KPLPVENGAPLRVRVERQLGYKMPKYLYKIELVDGFANVGGGRGGYWEDNGYDWYGGI"
FT   CDS_pept        complement(706411..707412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0880"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48374"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48374"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LT9"
FT                   /protein_id="BAB48374.1"
FT                   /translation="MGELIMSAPVAGLTSKNRIAAEDVLMLRRDVFADGVVTRGEAEAL
FT                   FALDQTAQDKCAEWAPFFVEAVTDYIVHQEKPSGYISQDNADWLVRTISRDGMVDSRTE
FT                   LELLVHVLEKARSSPSKLCVYALEQVAHAVIDGKGPLMLGGALVPGLIAKAEVELLRRI
FT                   LYAHGGDGNIAITRGEAEVLFRINEQTAQAKNDPSWNDLFVKAIANFVMCSAGYEAPTR
FT                   DVALRQESFLEHAEPEIGGFFSRMVSGGLAGIIEAYRSPDDIEAEWEAKNRAAEALARR
FT                   AETIDAGEAKWLIEHIGTNRPLYENERALLTLIKHASPEIHPALRPLLDKVA"
FT   CDS_pept        707925..709025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0883"
FT                   /product="glycine cleavage system protein T"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48375"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48375"
FT                   /db_xref="GOA:Q98LT8"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LT8"
FT                   /protein_id="BAB48375.1"
FT                   /translation="MTGDDSKHLPLEDIHTAAGARFGAFAGWSMPLTYPAGVMKEHLHT
FT                   REHVGLFDISHMKLFEVSGPQAVALLNRACPLDAGALEISQSKLSFFLNEAGGILDDLI
FT                   VTRLGDTRFMVVANAGNAVADEKHLRELATNFDVKVEPLDRVFLAIQGPEAWAALSRAG
FT                   IETGSLLFMHGVEPRKDWFMSRSGYTGEDGFEIGLPEADARDLVAKLLEDERVLWIGLA
FT                   ARDSLRLEAGLCLHGQDITPETDPAAAALMWAIPRDIRASGAFIGADALRAAVERGPAQ
FT                   KRVGLKPEGRQPVRAGVALFDADGNPAGHVTSGGFGPSAGHPVAMGYVAASLAKPGTRV
FT                   FAEVRGTKIPVDISSLPFTPHRYRKG"
FT   CDS_pept        709022..709399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0884"
FT                   /product="glycine cleavage system protein H"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48376"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48376"
FT                   /db_xref="GOA:Q98LT7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98LT7"
FT                   /protein_id="BAB48376.1"
FT                   /translation="MNLMAKTYFTSDHEWLRVEGGIATVGITDYAQEQLGDLVFVELPE
FT                   TGKKLTKGDTAVVVESVKAASDVYAPVDGEITEANGTLSSDPSLVNSAATGAGWLWKMR
FT                   LADESQLAGLMDEAAYKAHIA"
FT   CDS_pept        709414..712227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0885"
FT                   /product="glycine cleavage system protein P"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48377"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48377"
FT                   /db_xref="GOA:Q98LT6"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98LT6"
FT                   /protein_id="BAB48377.1"
FT                   /translation="MMTTALTPFSARHIGPGVNDVRAMLAVIGVPSVETLISQAVPQSI
FT                   RLDLPLTLPAPASEAEALAELSAIMAKNTVLKSFIGAGYHGVHVPPVIQRNLFENPAWY
FT                   TAYTPYQAEISQGRLEMLFNFQTLVTELTGLPVASASLLDEATAVAEAVGIALRHHRDK
FT                   RTKVAFAGTPHPQTLDVVRTRAEPLGIEIDGETIDDNTAALLVSWPDTLGVYGDHKAAI
FT                   DKARAAGALVVFIADPLGLTLTDAPAKLGADIAVGPMQRFGVPMGFGGPHAAYCAVSDR
FT                   LTRLMPGRLVGQSTDSKGRPGYRLALQTREQHIRRDKATSNICTAQALLANMATAYAIW
FT                   HGPAGLQAIAGRIHALANRLASGLKAAGVSVLGASRFDTVTVEAKGKAAEIAEAAEKTG
FT                   RLLRVLDADHVGIAFDETSTDADLDAIASLFGAKAAPSADSTVPGKPRGKEFLTQPVFN
FT                   ENKSETDMMRLLRRLADKDLALDRSMIPLGSCTMKLNAAAEMMPVSWPSIADLHPFAPA
FT                   SHSAGYRAMIGELEGWLSEITGFDAVSLQPNAGSQGEYAGLLAIRAYHRSRGEGHRTVC
FT                   LIPSSAHGTNPASAAMAGMSVVVVRCLEDGNIDMDDMRAKANEHSKNLAALMFTYPSTH
FT                   GVYEEGARHLCALIHEHGGQVYFDGANLNALVALARPADIGADVCHMNLHKTFCIPHGG
FT                   GGPGVGPIGVKAHLKPYLPGHVTEGSAHAVSAAPFGSASILPITWMYIRMMGAAGLKQA
FT                   TETAIISANYVATRLAPHFPLLYKGRHDRIAHECILDTRVLKESAGISVDDIAKRLIDY
FT                   GFHAPTMSFPVAGTLMVEPTESEPKRELDRFCEAMIAIAGEAAKVARGDWPLADNPLVN
FT                   APHTAAETLAGQWTHPYSRLEAAYPAGDADTAAKYWPPVSRIDNVAGDRNLVCSCPPLS
FT                   DYLGAAE"
FT   CDS_pept        complement(712240..713415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0886"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48378"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48378"
FT                   /db_xref="GOA:Q98LT5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LT5"
FT                   /protein_id="BAB48378.1"
FT                   /translation="MLDFSSLLLAAALSGTCLAVTMFAIWLTAPRARFVLTVACGILVL
FT                   VAHVILFWRYTKEPDPLLCQIALALLSLGFLIICLSAMQYLGVPDHRRVIVPTLAAMAV
FT                   CAAFTFLGLDGVGFIVTYATVTVLLSTIGAMFWVNGSHDRRILLVVSFLSGTCAVSFAL
FT                   CGVVLMAKGQWALGAAPDNWAERLNSVVAVACMTGLGALTLSLHHLQAQIELKAETMTD
FT                   PLTGLMNRRGLMSLHGERPFGPFMAVVMFDLDHFKRTNDIYGHPVGDQVLCRFAAVIRK
FT                   YARTGVDAFRLGGEEFAIVMSRMTEERAHDLASKIGVAFGTEIVPTPLGPLRSTVSGGI
FT                   GFGGADGSSLDEVLAEADAALYAAKRAGRNCVVSRKRMGKAEPVKPALRSA"
FT   CDS_pept        complement(713590..714063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0888"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48379"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48379"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LT4"
FT                   /protein_id="BAB48379.1"
FT                   /translation="MRQTQFAAAAMMAAVLMITGCTTNNNVDTTKTTAIQPKAKDVDTS
FT                   DLAQGKAQFRDANYGLAEQHFRKAVELKADNAEAWMGLAASYDELGRFDFADRAYGQLL
FT                   KVAGRKPQIVNNMGYSQLLRGNKKKARALLLEAKAGMADPTVVNANLALLNKG"
FT   CDS_pept        complement(714223..715050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0890"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48380"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48380"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LT3"
FT                   /protein_id="BAB48380.1"
FT                   /translation="MRILLCAAALAAASLWPALAAADDCGDAAALLRQAYPKVQKSADG
FT                   RSFTLEPHTSITLAVPQDGMPGLVCKVWPAHNDLLLVAVPLIDSAQSVDGQHVGDIELL
FT                   VVDRKTLQVRQRLLQPKLMNDDAVAIRGIEFDTARYGLAPGVTAFGLRIDMANHSQPNP
FT                   FNETDLRLYAIAGNALQAVLDGLAVAGHGGEGDTSCAGSFHSSQVSLAMSPTIHRGYHD
FT                   IIAVERQDTDEPLPDKDGECQSHPGKSVSRTYQLRYDGSRYPVPAALKAMDPP"
FT   CDS_pept        complement(715197..716042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0891"
FT                   /product="probable regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48381"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48381"
FT                   /db_xref="GOA:Q98LT2"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR012379"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LT2"
FT                   /protein_id="BAB48381.1"
FT                   /translation="MSAGPNSILNVTKGAPFALDAASFGMIAAGVAAIDLSNVFTIVHN
FT                   SLRHGPGVALWIPSVAEASSGVSALAAVWIIASALRLASPGRMHWGGVALVHALASLCF
FT                   SAQHVLGMVALRKVIYGVMGAHYQFELGDWLYEYRKDLLTYLIIAACLAAFRSRAENVR
FT                   REAAPRFESEPVFDIDIGARTIRVPLRAVLALRAAGNYVEVLLEDGRRLLVRGTLTSYA
FT                   ERLVPSGFERTHRSWLVNRARVTGLRPAGSGDMHLDLPGGCEAPLSRRFPEALRRLKQK
FT                   "
FT   CDS_pept        complement(716919..717836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0893"
FT                   /product="probable integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48382"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48382"
FT                   /db_xref="GOA:Q98LT1"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LT1"
FT                   /protein_id="BAB48382.1"
FT                   /translation="MPVAILLLVLGSVAVAWPMVAAKGDRNDVKRRLKVDHGAMAAKPE
FT                   PPQKKNANVVRERAVKRAQEFYAKSDPENVARLRMKLIQAGYMEPRAVGTFFIIRFSAL
FT                   VGGAIGAFVLNQWLASAEATMTSRWAFVILSGVAGYFLPGLVLTQQVREKMREYRNGFP
FT                   DFMDLMIVCSDAGMSMEAGIERVSKELAKTYPALSQNLQLVSLELRAGRSLDDALKALA
FT                   DRLSLDEVRSFATLLQQSKELGTSLSGALRVFSDEMRHKRMSLAEEKAHALPAKMSIPV
FT                   TVCILPVVLMIAIIPIIVKMTGSH"
FT   CDS_pept        complement(717886..718791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0894"
FT                   /product="probable integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48383"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48383"
FT                   /db_xref="GOA:Q98LT0"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LT0"
FT                   /protein_id="BAB48383.1"
FT                   /translation="MIAEACYLLYAGRSDKRTAINRRMKLQESKISQEQVLIQLRKERG
FT                   LDAGTSLFSPDRFRALRTQSGMIMPLSKFLMITSGVAMAMTLVAIWHGLPLLMGLLLFV
FT                   VLMPLVPVMVMRSKRKRRLKRFGMQLPEALELITRGLKAGHPVPVAIAMVSREMPDPIG
FT                   TEFGVIADEVTYGSDLVSALNSLFDRVGHEDLPLFITAVSIQSSSGGNLREILDGLALT
FT                   IRERGKLRRKVRAISTEGRMSAYILTAIPALLFAAIMALMPGFYRDVWDEPKTWYLIGG
FT                   SVTWLMLGNLMMFKMSNFRF"
FT   CDS_pept        complement(718856..720277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0895"
FT                   /product="probable secretory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48384"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48384"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LS9"
FT                   /protein_id="BAB48384.1"
FT                   /translation="MTSRFSTLQNRDARPQRSAESTPVAHHAVVIPTSRKALPAKPDVA
FT                   PAKNANKVLDARVRIHRMLLEEINLVALERLPKDEMRRQVHDFVSEKTRQERMAINTAE
FT                   LEALVDDIVDEMVGLGPLEPLLKDPEINDILINGHQNCFIEKKGKLQQVHIPFKDEAHL
FT                   LRIINKIVAAVGRRVDESQPMVDARMLDGSRFNAAIRPVGVDGPLVSIRKFSKNKLGLH
FT                   KLVEFGAITQNMAEVLAAAVHARKTTIISGGTGTGKTTMLNALSAFIPEDERLITIEDA
FT                   AELQLQQPHVARMETRPANIEGHGELKQRDLVKNALRMRPDRVILGECRGEEAFDMLQA
FT                   MNTGHEGSMATIHANTPRDAISRLEQMLGMTGMPMTVQSIRSQIASAIDIIVQLTRLSD
FT                   GKRKVTSVAEVTGMEGDVIQMQEIFRFVRTGMDADGGILGYFEATGIRPRFLEDLRAMG
FT                   IEFPGRYFEPGRPQE"
FT   CDS_pept        complement(720274..721062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0896"
FT                   /product="probable septum site-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48385"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48385"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LS8"
FT                   /protein_id="BAB48385.1"
FT                   /translation="MPAAGGVGTTTLALQTAFQLHHSVTRGASTCVVDLNFQQGACAEY
FT                   LDLEPRFDITEIENQPERLDRQLLDVMLSKHASGLCVLAAPTHPAEMRSFKTDVVVRML
FT                   DLVSAYFDNVVIDMPRTWFPWTETVLLGSNKLYIVAEMTVPCLRHTQRLIQAVYETAGK
FT                   EVKPNVIVNRFEQKMFDNGIKQADVQEILGEHFVGGIANNYRLVREAVDRGVPLHEIDP
FT                   NANVVNDLKKIILPEEAVATGAKSKSLFGLGKGFLKRKAG"
FT   CDS_pept        complement(721524..721703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0897"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48386"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48386"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LS7"
FT                   /protein_id="BAB48386.1"
FT                   /translation="MTPGSGNAQAANTVMQMVDPWKYGVQNTRLLVPAKRGDAGPVTPD
FT                   QAAASKASQTTTGN"
FT   CDS_pept        complement(721798..723183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0899"
FT                   /product="probable secretory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48387"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48387"
FT                   /db_xref="GOA:Q98LS6"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LS6"
FT                   /protein_id="BAB48387.1"
FT                   /translation="MAAALVAGAMLALPGVAKADNDIVYVSATKNASIKVAKGKPKTIV
FT                   TNAAFYQIVIGDPEIANVNPLTDKSFYVLGNNLGTTGIALFDEKKQLVGTVDIEVTLDT
FT                   DQLASTIRASVPDAKIKVGSANGRVVLSGEADDAVAAEKANKIATRFSGTEEVINSVNI
FT                   SSSQQVQLNVRFVEINRQAGQDLGAKYSANFAYGFGGRDVSLDPGTVPAAGTGEIIGRL
FT                   LSNGVSIDIAIKALEERGLARRLAEPNLIARSGETASFLAGGEFPIPVSEDNGKISVSY
FT                   KKYGVSLDFTPTVLKDGLVSLDIAPEVSSIDASSSYNIGTISVPGFIVRRAKTSVDLKN
FT                   GQSFMIAGLLQSQNDITTSRIPGLGKMPVLGALFSSKSYQRRETDLVIIVTPYLVKPVD
FT                   PSKKMVEPTDGTRPASNVDYFLNNTEEVKASDAGRALALADGSAARTAPTTTVGHFLDL
FT                   PKD"
FT   CDS_pept        complement(723274..724200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0900"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48388"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48388"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LS5"
FT                   /protein_id="BAB48388.1"
FT                   /translation="MRGKAITMIGIAAVFGAISIFAADFWVKSQAKADAEEKTASIAAP
FT                   VPPRIEFKTIVVAKAPLRYGQELDRAKLIEIPWPQDSLPQGAFATIDGLLGEGNRIVLS
FT                   PIEVNEPVLLTKLSGPNGRATLSNMLTPGMRAVTIRTDEIAGVGGFVTPGDRVDVVLTR
FT                   DAGEIQEVAKNAQGAAGSTVTSEIVVADAKVLSVGQGADERQTTPQITNSVTIEVTTEG
FT                   AQKVALARTVGTLSLSLRSASEGGDGKNGVTTISSFGGSVAAKAQAAAGSLFDAITKEP
FT                   EKPKFKTVIVTRGTKAEEYQVPERDQK"
FT   CDS_pept        724438..726495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0901"
FT                   /product="DNA topoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48389"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48389"
FT                   /db_xref="GOA:Q98LS4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LS4"
FT                   /protein_id="BAB48389.1"
FT                   /translation="MDDNNDLFGNMDKQPQPVRTPARPADPLVQAAAKRPAATKDGSEG
FT                   YSAADIEVLEGLEPVRRRPGMYIGGTDDKAMHHLFAEVIDNSMDEAVAGHATFIDVELS
FT                   ADGFLTVTDNGRGIPVDPHPKFKKPALEVIMTTLHSGGKFDSKVYETSGGLHGVGVSVV
FT                   NALSDHLEVEVARGRQLYRQRFSRGIPVSGLEQLGEVHNRRGTKIRFHPDEQIFGKGAA
FT                   FEPARLYRMTRSKAYLFGGVEIRWTCDPSLIKEKDQTPAKAEFHFPGGLKDYLKASLGD
FT                   DFQVTREIFAGKSEKQGGHGSLEWAVTWFGGDGFINSYCNTIPTGEGGTHEAGFRNVLT
FT                   RGLRAYADLVGNKRASIVTSEDVMISAAGMLSVFIREPEFVGQTKDRLATIEAIRIVET
FT                   AIRDPFDHWLADNPQEASKLLEWVIARADERVRRRQEKEVSRKSAVRKLRLPGKLADCT
FT                   QNAAAGAELFIVEGDSAGGSAKQARDRASQAVLPLRGKILNVASAGNDKLAANQQISDL
FT                   IQALGCGTRSKYRDEDLRYDRVIIMTDADVDGAHIASLLITFFYQEMPALVRGGHLYLA
FT                   VPPLYSIRQGGKVAYARDDAHKDELLRTEFTGRGKVELGRFKGLGEMMASQLKETTMDP
FT                   RKRTLLRVDVNEIDSATKDRVDELMGTKPEARFRFIQERAEFAETEVLDI"
FT   CDS_pept        726540..728606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0902"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48390"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48390"
FT                   /db_xref="GOA:Q98LS3"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LS3"
FT                   /protein_id="BAB48390.1"
FT                   /translation="MTWARLKAYFETSLAGLTQPTRSDWIFALRTVSAGLIALLAAYAL
FT                   KLDHPQWAMMTVFIVAQPVAGMVLAKGFYRLLGTLAGGLAAIGITTVFGTNPWVLVTVL
FT                   AVWIGICTFVSSLLRNPEAYGAALAGYTAMIIGLPAFGQPHLVVDLAVARCAEIVLGIV
FT                   CAGVTSRLILPKLASDAIISRLKRCILDLATYAAGAFSGGDTATLSALHRKLVADTQTL
FT                   GEMRAYARLEAPSFAPRAHPVRRTIGQLLSALSAARALHSHAAPKNAALIPVRSQLQAL
FT                   VGDLATKPGALDDTAPWVEQLDAISARARQLPDASIDQGDDRVGTITRLTIAADFAEAL
FT                   KQVLRGLDALRAPVTGTGRAGRQPALVVHRDYPGASRNAVRAALATLLVAAFWLTTKWS
FT                   EAAGTVILVAVVSSLFAARPDPVQVSWGFFKGTLLALPFAFLIGQIALPALPGFGWFVL
FT                   FVVPILVPTALGMANPRYVGIATAFAINFLAFLSPHQAMTYDPGPFFAGSASVLVGILL
FT                   AIGVFIVVLPADPWLAANRIVRAMREDLARLCLHERVPRRSAFESLAYDRINQLMPLVQ
FT                   NSGRKGDAVLGGGVAAVTVGLEILRLRGASQNHAIPSETALSIANFLRGLARELLFRAP
FT                   GDPQTATIAVARQYAASIAQRNAPGDMLQIAASLRIIAAAMEDFPDFFARDKA"
FT   CDS_pept        complement(727485..729701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0904"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48391"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48391"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LS2"
FT                   /protein_id="BAB48391.1"
FT                   /translation="MDLYGKSVRARRRGQCAGPGLCQFRIAVRGPLRGGSGADAAARRC
FT                   FVKGAVGDGRSALHEPSRAAADHQRTGLRPARSRRCRAGAFAAAYRCRSDQPRGGESEG
FT                   DAEADRRPSCRLDGAVGGDRRDRRGGSLRGAARQQRRRHRFSELPPHGRTPWASAAGAR
FT                   GADIGHQAACRLPAHAADQARRDVEDIAAGHGIDGRRAGRSRPAGRLRQGLGDTDRGHA
FT                   PGRTCRADRASQAARRPHCELPHPHHRAWQGRFLRLHAGRTRPAVRTAGEGAAGRRPRR
FT                   GLAGIVPQRGPGRGNACDHPACLENLAGGRQWQAHRRRAGSQLADAQGVGRAIRGRRSR
FT                   GPGQVDPSRRAARERAGSRAGHCGGLGFIPREKIGKILHRGGNDAQGCRDLQHVAGGVS
FT                   LGDARRVLPGDSNGGCLRIAGGAEQQFARQPSQEIGDRKCGFGRDGMVLARAAQPQDLQ
FT                   ADRDGGDAAAQHRITLPAGILHQRHQLVDAVIGEAFEGRTPRHALVQAKPCQILAHGPY
FT                   DPVRREPRIGGQHDNEDADRQQNAYQNGRRAGEERARIVGHRLMRAEESEEVDGEGRGY
FT                   ADIARIGHAQRRRHQDRHNEQHEPAEAGQSRQCDLADEKGKGQSQQRALEEAPGHLHRI
FT                   GASGEKAGYDGNENDRARRLGPFRRQPEGRDQQGGKGGTHGIARCAGVVAVHHQRRLPA
FT                   GAAGTCDRRAQGIEPAQHLLERLGEIGGDGEAGDGADPVVTLVD"
FT   CDS_pept        729881..730333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0905"
FT                   /product="probable monoamine oxidase regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48392"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48392"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LS1"
FT                   /protein_id="BAB48392.1"
FT                   /translation="MAGLYLEEFVVGHVFQHTLRKTVTESDNMLFSVMTLNPQPLHIDF
FT                   DFAARSEWGKPLVNSLFTLGLMIGISVNDITVGTTVANLGMKETTFPHPVFHGDTIRVE
FT                   TTVISVRESKSKPDRGIVEFEHRAYNQQGDLVAKCTRQAMMLKKAA"
FT   CDS_pept        730294..731214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0906"
FT                   /product="citrate lyase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48393"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48393"
FT                   /db_xref="GOA:Q98LS0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LS0"
FT                   /protein_id="BAB48393.1"
FT                   /translation="MHQTSDDAEKGRLMRSLLFVPGDSERKLEKGFGAGADVLIVDLED
FT                   SVALQNKAAARDIAARFIGERRGQTSSAIYIRVNDLSTGLTDDDLGALVPVKPDGIMLP
FT                   KSNSGQDVQQLSAKLRVGEAENGLPDGSIKILPIITETPAGVLAAATYAGASARLAGLT
FT                   WGAEDLSAAIGARAARDEHGRYTDVFRHARLTTILAAGAAEVAAIDTVFPNFRDMAAFA
FT                   IECAEAERDGFTGKMAIHPDQVPVINAAFTPSAEAVQQSAAIVAAFEAAGNPGVVGIDG
FT                   KMFDRPHLRLAERLLARAKAAGISA"
FT   CDS_pept        complement(731234..733135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0907"
FT                   /product="probable secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48394"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48394"
FT                   /db_xref="GOA:Q98LR9"
FT                   /db_xref="InterPro:IPR010420"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LR9"
FT                   /protein_id="BAB48394.1"
FT                   /translation="MKKRDSLGTRLRYGFDKSMAAGPIALIGWLAVVSLLIIIAAAAFL
FT                   AVTRIAPEGGEPLNFFEAFWESLMRTLDSGTMGGDTGWAFRLVMLVVTLAGIFVVSALI
FT                   GVLSAGVDGKLDELRKGRSRVLESDHTIILNWSPSIFDVISELVIANASRRRPRIVVMA
FT                   NMDKVAMEDEIAAKVGKLGNTRIICRSGDPTDLYDLAIVNPQTSRSVIVLSPDGDDPDS
FT                   QVIKTVLALVNDPSRRTDPYNIAAEIRDGKNAEVARVVGGAEVQLVLADQLISRIVVHS
FT                   SRQSGLSGVYSELLDFDGCEIYTTTQPELAGKTFGEAVMAYEHCALIGLCDQGGRVNLN
FT                   PPSELVIGKDMRAIIIAEDDAAIRPGSAGIKIDTAAIRDPRPVEAKPERTLILGWNRRG
FT                   PIITYELSRYVAPGSILTIAADTPGLEQEVAGLPVAGDNLSVSCRITDTSSSTALSSLD
FT                   VPSYDHVLVLGYSETMAAQPADTRTLVTLLHLRKIADDAGLHISIVSEMIDVRNRELAA
FT                   VTKADDFVVSNRLVSLMLAQASENQYLAAIFDDLLDEQGSEIYMRPVADYVAIDQPLTF
FT                   WTIAESARLRGEIAIGYRRIRAGDADQRALGGVTVNPLKSEALTYLPEDRIIVLARD"
FT   CDS_pept        complement(733301..734035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0909"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48395"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48395"
FT                   /db_xref="GOA:Q98LR8"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LR8"
FT                   /protein_id="BAB48395.1"
FT                   /translation="MVDHWSISANIMGAQRGRSMMIAKLLLQTFIWFGVMGALLFLSAG
FT                   TFAWPAAWVYLVVMVGLSLTMGVALARRDPGLMNERLSAPIQKNQAAADKVLLSILLIG
FT                   IFGWLSFMGFDFRFGWSAVPFWAQAVGALVLLVGIWICYLTMLENSFAAPVVKIQDERG
FT                   QRVITTGPYSYVRHPMYAGAILFFAGTALLLGSWWGLVSVLVFIVLLAIRTFIEEKTLR
FT                   TGLRGYDDYATRVRYRLIPMVW"
FT   CDS_pept        734120..734830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0908"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48396"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48396"
FT                   /db_xref="GOA:Q98LR7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LR7"
FT                   /protein_id="BAB48396.1"
FT                   /translation="MPRVIKHPEIRREDILDHAQALFLTQGYDRASLNDVIASAGISKG
FT                   AFYHYFASKEALLEALADRFARQALAGVQGVVDDPGLDPLGRLNGLLSQSRQAKIETAA
FT                   EAWALFETMFRPENLVLFHRINLAANASFSPLLVKIIRQGVEDGTFRTFDPEGVADIVM
FT                   QFGLATHDVVAKAIAGGSDADMEVAIEVLEKRVRLYEIALDRILGLPDGSIRIGEPGYI
FT                   RAVMTARRKADKAR"
FT   CDS_pept        complement(734844..735452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0910"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48397"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48397"
FT                   /db_xref="GOA:Q98LR6"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LR6"
FT                   /protein_id="BAB48397.1"
FT                   /translation="MFYEPSKGHGLPHDPSKAIVAPRPIGWISTLNGAGEINLAPYSFF
FT                   NAVSTRPFIVWFSSEGEKDSASFAQETGEFVANLVSRDLAEKMNYTSVNAPRGVNEFVY
FT                   ADLAMAPSRLVKPPRVAAAPAALECRVTEVFRPKALDGTLTSAVIVAGEVVGVHIDDAF
FT                   LKDGLFDITKAGNVARLGYMDYASVDEVFSMRRPHWGKE"
FT   CDS_pept        complement(735453..736037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0911"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48398"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48398"
FT                   /db_xref="GOA:Q98LR5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LR5"
FT                   /protein_id="BAB48398.1"
FT                   /translation="MASPIIDFLLTRNSAPIPDLKEPAPNDAEIATMIAAATRVPDHGR
FT                   LEPWRFILYRGDVRIEIGRKLAALAEQREGPLPEGRRNQELARFSRAPLVIGVVSVPKE
FT                   NPKIPQWEMFLSGGMAAMNLIISANALGYGTNMISNWYSDVPEGRAILGLAPQERVVGF
FT                   IHIGSYAGPAPERPRPDPAKLYADYSGSWAD"
FT   CDS_pept        736193..737155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0912"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48399"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48399"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LR4"
FT                   /protein_id="BAB48399.1"
FT                   /translation="MFEGRLRLFLVWLCAALFLLPVSLAVAQQKDGMGDLKLPGISSYA
FT                   TPKSETPLALSGGGAITLSAQLTDKGTDITRGLVWRVFKPVPVNGKLPMVASAHGGSAV
FT                   FQLEPGSYLVHASYGRAGATKRITVGKEAKRESLVLDAGGLKLDAVLSGGVRIPPKKLR
FT                   FSIYEGTAEANGDRALIIPDVEPNSVVRLNAGIYHVVSTYGAVNAVIRSDIRVEAGKLT
FT                   EATVEHHAAEITMKLVREAGGEAIADTSWSLLNESGDPIKESVGAFASMVLAEGDYTII
FT                   AKNRDRIYQKDFAVVAGQNQEIEVLATEAAAMDPEEGAD"
FT   CDS_pept        complement(737182..738120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0913"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48400"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48400"
FT                   /db_xref="GOA:Q98LR3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LR3"
FT                   /protein_id="BAB48400.1"
FT                   /translation="MLKLKTREKPFPELSYANPRQPALTRWVIHSIEGLSGRDRYAVLY
FT                   DFWRRQVVPTGERVFSRMLDLIDVRIRTADQWPPAPLPDTPLVIVANHPFGIGDGIAVL
FT                   SLVEQLGRPFRVMIHKDLLKIREMEPYSLPIDFSETKDALKNNMAVRHEAVRLLKEGVT
FT                   IVVFPAGGVATAPKGFGRARDLPWKMFPARLVQDAKASVIPMHFSGQNGRLFHLVSGPM
FT                   YMAERDGRVAKFVGKASLTLRLSMLIHEFARLSGKAIDVRVGDVLSWSELEPLRDRKAL
FT                   LDRLYRGVFDLAPQVPRRRIPFLPARTKLAA"
FT   CDS_pept        complement(738204..740180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0914"
FT                   /product="threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48401"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48401"
FT                   /db_xref="GOA:Q98LR2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98LR2"
FT                   /protein_id="BAB48401.1"
FT                   /translation="MLNSVSLTFPDGSVRDYDAAMTGAGLAESISKSLAKKAVAYAING
FT                   TVRDLSDPLGKSGKVEIITRDDARALELIRHDTAHVLAEAVQELWPGTQVTIGPVIENG
FT                   FYYDFARNEPFTPDDFPVIEKKMREIIARNKPFTKEVWSRDKAKKVFADKGERYKLELI
FT                   DAIPEDQDLKIYAQGDWFDLCRGPHMASTGQIGNAFKLMKVAGAYWRGDSNNPMLTRIY
FT                   GTAWADQAQLEAYQTMLEEAEKRDHRKLGREMDLFHFQEEGPGVVFWHAKGWKMFQNLV
FT                   NYMRRRLDEQGYQEVNAPQVLDKSLWETSGHWGWYRDAMFKVTVAGDDTDDDRVFALKP
FT                   MNCPGHVQIFKHGLKSYRDLPVKLAEFGNVHRYEPSGALHGLMRVRGFTQDDAHIFCTE
FT                   EQLASECLRINDLILSTYADFGFDEISVKLSTRPDKRVGTDEAWDHAEAIMGSVLETIR
FT                   TRSGNRIKTSINPGEGAFYGPKFEYVLKDAIGREWQCGTTQVDFNLPERFGAFYIGSDS
FT                   EKKQPVMVHRAICGSMERFLGILIENYSGHFPLWFAPQQVVVATITSEADGYATEVVAK
FT                   LKAAGLLAEADLRNEKINYKVREHSLAKVPVILVCGKREAEEQTVNIRRLGSRDQESLG
FT                   LAEAIAQLTEEAVTPDRRRKRAA"
FT   CDS_pept        740391..741290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0915"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48402"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48402"
FT                   /db_xref="GOA:Q98LR1"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LR1"
FT                   /protein_id="BAB48402.1"
FT                   /translation="MSQTRRPGLRTSPQSSGIVDMENATPSRTALGVARMRALHQFSPQ
FT                   AGLFRDPYAIAILGEAAPAAQELEQEDERRQRMRLFVAARARFAEDWLAAAVLRGVRQL
FT                   VVLGAGLDTFSLRNPYRDLSVFEVDHPATQAWKRKCIADSGLAEPAATRFVPVDFERQS
FT                   LSAELAAAGLQSTAPAFFIWLGVVPYLTKEAILKTLSWIAGVPGSEVVFDYSEPAANRD
FT                   AAGQTALAFHAARVASVGEPWISFFVPAELAKSMGELGFDEIEDIESGDIAARFSEAPK
FT                   GMTNNSGGGHIIRARRTA"
FT   CDS_pept        complement(741372..742124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0916"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48403"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48403"
FT                   /db_xref="GOA:Q98LR0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR002137"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LR0"
FT                   /protein_id="BAB48403.1"
FT                   /translation="MRAQSAPLGDVQCTLIADAASGKVLYQDGTCDQPFSPASTFKVPL
FT                   SLIGYDAGILSDEHTPSWDYKPEFNAAKRDQKIVDPVIWEKDSVLWYSREITRKLGPES
FT                   FAGYVSKLGYGNKDVSGNPGKNDGLTHSWVNSSLKITPVEQVDFLRKLLARKLPVSAKA
FT                   YDLTSAIIPTFQAGGWTVQGKTGSTRLADDADKISDKRSLGWFVGWAKKDGQQIVFARL
FT                   VVDATRTDMPKGLKTRAAFLKDLSLLVK"
FT   CDS_pept        complement(742347..742808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0918"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48404"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48404"
FT                   /db_xref="GOA:Q98LQ9"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98LQ9"
FT                   /protein_id="BAB48404.1"
FT                   /translation="MTAQRTRAGIAFSSRSSHLSHGKRDTETAVHDPHGHAHTVRPPGR
FT                   GRNWPGPWRKTPGRLLGTSFVRLYQLTLSGFVGNSCRHLPTCSEYAHEAIARHGLWAGG
FT                   WMGFFRVLRCGPFGTHGIDLVPEVLADRYVWFMPWRYWRIGRKRAETRA"
FT   CDS_pept        743054..743971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0919"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48405"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48405"
FT                   /db_xref="GOA:Q98LQ8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LQ8"
FT                   /protein_id="BAB48405.1"
FT                   /translation="MRRGRLPLTALRSFEAAGRHLSFSKAAEELFVSQAAISRQIRELE
FT                   TFLRQPLFERHHRRVELTDSGRRLLDQLVRSFDAIDRLLGELVAAPAQSVVRVSVEPSL
FT                   ASVWLVPRLNRFRQLRPDIDVSLEVDARLIEFRGDQPELALRFSANATSWPRSQAERLA
FT                   STVDSPVLSPALLASGPPLEKPIDLARYTLLHEENRQGWARWFEAAGVPADAVPARGPM
FT                   LADISLSKQAALLGHGVALGDLLQIGNELETGALIKPFDIDVASGAYWLVARSLKELSE
FT                   PAAAFADWVRSEFAESRRTLEAKV"
FT   CDS_pept        complement(744101..744547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0920"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48406"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48406"
FT                   /db_xref="GOA:Q98LQ7"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LQ7"
FT                   /protein_id="BAB48406.1"
FT                   /translation="MINDVYNAKILGFAGNIARIGRLDHPDATAKAHSKLCGSTVTVDL
FT                   KMEDGVVTDFAHDVKACALGQASSSIMAQHVVGASAEELRTVRDTMLRMLKENGTPPEG
FT                   RFADLKYLEPVRDYKARHASTMLTFDAVVDAIGQIEKKRAEQAA"
FT   CDS_pept        744830..745423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0922"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48407"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48407"
FT                   /db_xref="GOA:Q98LQ6"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98LQ6"
FT                   /protein_id="BAB48407.1"
FT                   /translation="MEKPVTDRPSEAEVEAAVRTLLRWTGDNPDREGLIDTPKRVAKAF
FT                   REMFGGYDMCPAEELGRTFEEVAGYDDLVIVKDIHFHSHCEHHMVPIIGKAHVGYLPDG
FT                   KVVGLSKIARVVDIFAHRLQTQEALTAQIAGVIQDVLNPRGVAVMIEAEHMCMAMRGIR
FT                   KQGSTTLTSTFTGVFKDTPEEQVRFVTMVRGGGA"
FT   CDS_pept        745536..745997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0923"
FT                   /product="phosphoribosyl c-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48408"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48408"
FT                   /db_xref="GOA:Q98LQ5"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98LQ5"
FT                   /protein_id="BAB48408.1"
FT                   /translation="MSALGFPKTPSDKKALEEGAVFSPRFDPAGLVTVVVTDAEDGMLL
FT                   MVAHMNAQALALTLETGIAHYWSRSRNALWKKGETSGNFQHVVEMRTDCDQDALWLRVK
FT                   VLGHDATCHTGRRSCFYRTVGLVDGKGTLVDDGSKPLFDAEFTYRKPSS"
FT   CDS_pept        746079..747053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0925"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48409"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48409"
FT                   /db_xref="GOA:Q98LQ4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LQ4"
FT                   /protein_id="BAB48409.1"
FT                   /translation="MMLEWASLRNRPDVREANGLTSSGGTSETKSPKKTGISLALGGGC
FT                   ARGWAHIGVLRALDEAGIEVSMIAGTSIGALVGGCYLAGKLDELEEFARSLTKRRIFGL
FT                   LDLNLRGSGLFGGMKLDARLREHVAGVRFEDLPKPFVSVASEIRTGHEIWLSNGSLITA
FT                   MRASYALPGVFEPVNCNGRMLVDGALVNPVPVSVCRAYEQPLVVAVNLHYDLFGRAAVI
FT                   KHSAGELVVEKDAPRPGHVGAEYQSHQTRLGITGVMVEAFNIIQDRISRARLAGDPPDM
FT                   SLQPKLSHIGLTEFHRADEAIQIGYQATTAQIGELTRLQTVLA"
FT   CDS_pept        747214..747780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0926"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48410"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48410"
FT                   /db_xref="GOA:Q98LQ3"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LQ3"
FT                   /protein_id="BAB48410.1"
FT                   /translation="MAKIVYSMLTSLDGYIAGPDGDIGLPVPETELHQHFNDMMRQASA
FT                   VLAGRRMYETMRFWDSPDRETGATEVERDFADAWRDTPKIVFSTTLRQVGSNARLVNGD
FT                   AETAVRSLKTKTDGLVILGGADLAADLTRAGLIDEYRLYMHPVVLGGGKPYFQSGLSLA
FT                   LKPLGTESLPQGVTLLRYAPANQAA"
FT   CDS_pept        complement(747793..749571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0927"
FT                   /product="single-strand DNA-specific exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48411"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48411"
FT                   /db_xref="GOA:Q98LQ2"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LQ2"
FT                   /protein_id="BAB48411.1"
FT                   /translation="MGDRRLFLDIRQSATGLSWEHRLTERQDMVALAIAQGHGVPDIVA
FT                   RVLAGRGVTADETERFLEPTIRDLLPNPASLTDMDKAATRIAAAVMAREKVAIFGDYDV
FT                   DGAASSALLKRFLAHFSIPSEIYIPDRIFEGYGPNPDAMRELVSRGATLIVTVDCGTNS
FT                   AISVDAANEAGADVVVLDHHQVGGALPAAIAVVNPNRDDDLSGQGHLCAAGVVFLALVQ
FT                   TAKILRGLSDVAPPDLLSLLDLVALATVCDVVPLTGVNRAFVVKGLQMARQQKNEGLAA
FT                   LARVSRIGEPISTFHLAYLIGPRINAGGRIGDAALGSRLLATDDPVEARTIAETLDRLN
FT                   QERQLMEQEMLAAARAEADAELAGGSGPAIVVTASNNWHPGIVGLLASRLKDHARRPAF
FT                   AIAFNAVGIGTGSGRSVSGFDLGRLVREAADAGLIVKGGGHGMAAGITVERARLGELRA
FT                   FFEERAAADVFRLQDEESLAIDGALAAEGATLSLLDALEKAGPFGAGHVAPVFVLPRHR
FT                   LADARPVGTNHIRCELQSDAGGRIPAIAFRAVDTVLGEFLFKNRGKSVHVAGSLSGNYW
FT                   NGNRTVQFRIVDAARS"
FT   CDS_pept        complement(750044..751027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0929"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48412"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48412"
FT                   /db_xref="GOA:Q98LQ1"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LQ1"
FT                   /protein_id="BAB48412.1"
FT                   /translation="MNVAQNIVAGLDRILTMELVRVTERAAVAAARLRGRGDEKAADQV
FT                   AVDAMRQELNRLAIKGTVVIGEGERDEAPMLYIGEEVGTGKGPAVDIALDPLEGTTICA
FT                   KNLPNALAVIAIAEKGSLLFAPDVYMDKIAIGPGYAEGVIDIDASPAENIASLARAKGV
FT                   AVSDITTCILDRPRHAKLIDAVRATGAAIRLIGDGDVAGVIHTTDPEETGIDLYLGTGG
FT                   APEGVLAAAALRCTGGQMQGRLILDTPEKVARAAKMGISDPKRIYHAEDMARGDVLFAA
FT                   TGVTDGNMLAGVKFGRTYITTHTIVLRSSSRTVREIKARHQDLDKF"
FT   CDS_pept        complement(751232..751399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0931"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48413"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48413"
FT                   /db_xref="GOA:Q98LQ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LQ0"
FT                   /protein_id="BAB48413.1"
FT                   /translation="MASSMLIGILITFLVIILVLYLVQRLPLDARMRQIVQVIVIIIGI
FT                   ISLLRYLAVF"
FT   CDS_pept        complement(751464..751823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0933"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48414"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48414"
FT                   /db_xref="GOA:Q98LP9"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LP9"
FT                   /protein_id="BAB48414.1"
FT                   /translation="MADTNKSDTPAIDDIQKTLEKQIAELRKEITKINKSISARGAEML
FT                   DDASEQASDFYETASARASRTAQQLRSQAQAVSDVARENPGTTTAVIGVIGLLGFLAGI
FT                   AVGQSMNNDTSRRWY"
FT   CDS_pept        complement(751933..753246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0934"
FT                   /product="homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48415"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48415"
FT                   /db_xref="GOA:Q98LP8"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LP8"
FT                   /protein_id="BAB48415.1"
FT                   /translation="MAEALRVGIAGLGTVGAAVARVLRDKAAELTRQCGRDIVVSAVSA
FT                   RDPKRDRGVDVSAAKWFDDPVKMAQSAEIDVFIELIGGDEGPARLSVKAALEAGRHVVT
FT                   ANKALLAKHGVALAEIAEKKGVLLNYEAAVAGGIPVIKTMREAMAGNSVTRVFGILNGT
FT                   CNYILTRMEAEGISFDACLKDAQRLGYAEADPTFDIEGHDTAHKLSILTSLAFGTKIAA
FT                   NDIYMEGISNITQADIRAAGDLGYRIKLLGVAQRTDSGIEQRVHPTMVPTASVIAQVHG
FT                   VTNAVAIETDILGELLLSGPGAGGNATASAVIGDIADIAKSRPGFQHGPVFGLPAKELR
FT                   PYKKAQMRSHAGGYFIRLTVHDRIGVFAAIAKRMADNDISLESIVQHAVNGEAAAQKTV
FT                   ILVTHETTEAAVRKAVDGITKDGHLTDKPQVIRIERAG"
FT   CDS_pept        complement(753284..754495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0935"
FT                   /product="probable aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48416"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48416"
FT                   /db_xref="GOA:Q98LP7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LP7"
FT                   /protein_id="BAB48416.1"
FT                   /translation="MEEFHKVRRLPPYVFEQVNRLKASARSRGADIIDLGMGNPDLPTP
FT                   KAIVDKLCEVVRDPRTHRYSSSRGIPGLRRAQAAYYQRRFGVKLNPDTQVVATLGSKEG
FT                   FANMAQAITAPGDVILCPNPTYPIHAFGFIMSGGVIRSLQVEPDDGFIPALERGVRHSI
FT                   PKPLALILNYPSNPTALVASLDFYKDVVAFAKKNDIIILSDLAYSEIYFDGNPPPSVLQ
FT                   VPGAIDVCVEFTSMSKTFSMPGWRMGFAVGNERLISALTRVKSYLDYGAFTPIQVAAAH
FT                   ALNGDEIAEVREVYHKRRDVMVDSFGRAGWNIPAPAASMFAWAPIPEPFKHLGSLEFSK
FT                   LLIEHADVAVAPGVGFGEHGDDFVRLALVENEHRIRQAARNIKRFLSTSAKQPNNVVPL
FT                   SAHR"
FT   CDS_pept        complement(754541..755047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0936"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48417"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LP6"
FT                   /protein_id="BAB48417.1"
FT                   /translation="MFWTWFAGFLPKRFLDILTWDIRQGPISLYPGCQGNNMTINIGET
FT                   VFFNAARFCRIGAAIVLVGIAGCSSTNTAGPVPMAENAGPKDTGTFPNLNIPPKVANKQ
FT                   LTQAETNAKLAELKADGNAQGAKSGGGAAVANQAALADLAAKHGPQALKQIEGKCDPAL
FT                   DPTCK"
FT   CDS_pept        755035..756870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0937"
FT                   /product="poly-beta-hydroxybutyrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48418"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48418"
FT                   /db_xref="GOA:Q98LP5"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR010963"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LP5"
FT                   /protein_id="BAB48418.1"
FT                   /translation="MSKTPDSGKTEDDEPSTVEQYLVKDPERFALNMARMIEQAGKAAS
FT                   AWAEPRERGEVRDHVAEPVVDMVKTFSKLSEYWLADPQRALEAQTRLFAGYMTVWANAI
FT                   QRVSPNAEGTDDAVKPERGDKRFQDPEWGRNAFFDFLKQAYLVTSRWASELVEHAEGLD
FT                   EHTRHKASFYVKQVSNAISPSNFILTNPELFRETVASNGENLVRGMKMLAEDIAAGKGD
FT                   LKLRQADYSPFEIGRNIATTPGKVVGRSDVAEIIQYDPATETVLKRPLLICPPWINKFY
FT                   ILDLNPQKSFIRWAIEQGHTVFVISWINPDERHGAKNWEAYIREGLQYGLDTIEKATGE
FT                   RDVNAIGYCVGGTLLAAALALMAREGDDRIKSATFFTTQVDFTYAGDLKVFVDEEQVAA
FT                   VEKSMNEKGYLDGTKMATAFNMLRSGDLIWPYVVNNYMRGKDPLPFDLLYWNADSTRMA
FT                   AANHSFYLRNCYLENNLSRGTMELAGHTVSLGDVTIPVYNLASREDHIAPALSVFLGSK
FT                   YFGGKVDYVMAGSGHIAGVVNPPASGKYQYWTGGKPEGDFGQWIAKAAEHPGSWWPHWQ
FT                   SWIEAKDDTRVPARKPGKHMKTLGDAPGSYVKVRV"
FT   CDS_pept        757045..758343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0938"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48419"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48419"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR013230"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LP4"
FT                   /protein_id="BAB48419.1"
FT                   /translation="MLRRGRTDRTSRGNLTLKSAGWSLAKGERSAILAALCCVLLASCT
FT                   SAGDPTMSVGMPGYNASASDVNVAATGKPIATADSTSQTTATQTTVMSEGDTALPEKVA
FT                   YVPMAKPQAAFPLITPAGAETIAGQTPQALQQPAQTAQQTDAVAQKIAAADAAVTTPKP
FT                   ATAPVMNNPVYVTAGEAPQAEAPKKRGFLASMFGATPASATPAPLINTRSGEQPTAQAK
FT                   PAPAAAAKPIITLASADSTAKPIQLASTGDDAGHITGSDALPGVRQTALFEIKRKSGLD
FT                   DESDVDLNEDEGPIGGSYQVASAAGMARLAPNGLLKQNESVDVACLKPSLVRVLKTIEG
FT                   HYGRKMVVTSGYRDPARNRRANGAKNSLHMYCAAADIQVPGVSKWELANYIRTMPGRGG
FT                   VGTYCHTESVHVDVGPERDWNWRCRRRSGGDDG"
FT   tRNA            758541..758612
FT                   /product="trnE-TTC"
FT   CDS_pept        complement(758704..758901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0939"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48420"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48420"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LP3"
FT                   /protein_id="BAB48420.1"
FT                   /translation="MLQDGARGLGRGDHPEAEEALKGSAQTATCPVMERRVSESLTHSD
FT                   MPDSAWVASVIHAKLFALPF"
FT   CDS_pept        complement(758969..759370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0941"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48421"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48421"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LP2"
FT                   /protein_id="BAB48421.1"
FT                   /translation="MKEQPYREEMMSIRDELQELWDIYVAAYRDGDAAGCAAVFTPDAE
FT                   LHSPYAAAARGRAAIEALHGVWTQHATPDKTLGIIEAGASGHLAWSLAAYSEGEATGNG
FT                   TSLSVFERQAAGGGWLIRMCSLNSTDPGQ"
FT   CDS_pept        760558..760731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0944"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48422"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48422"
FT                   /db_xref="GOA:Q98LP1"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LP1"
FT                   /protein_id="BAB48422.1"
FT                   /translation="MELICSDPSGSIFASPAFLNLTAVFIILAAFAVARLIAMSRTDSL
FT                   DQLRFAPIQSAS"
FT   CDS_pept        760806..761342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0945"
FT                   /product="probable heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48423"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48423"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LP0"
FT                   /protein_id="BAB48423.1"
FT                   /translation="MFVDYYELLEISPNANSETIERVFRYFAMRYHPDNQDTGDESRFS
FT                   EILEAHNVLKDPVKRAQYDIQHKDHLSLRTELIGEASNSTTIERDVAIQAKLLSLLYVK
FT                   RRQDVNNPGIGDTEIERLSGCPREHLEFHLWYLKAKGWIGRIENGTFAITVEGIDRANS
FT                   EHRRDATTRLLDHAG"
FT   CDS_pept        complement(761374..761853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0946"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48424"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48424"
FT                   /db_xref="GOA:Q98LN9"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LN9"
FT                   /protein_id="BAB48424.1"
FT                   /translation="MFGRASHRFAEMAKRPSSSFCRDPRYCAGASAFRRDRSGGAGLEF
FT                   ALIAPFLIILLFGIFALGWSMHSVSSVRYTLETSSRSLQLQNTLTQADIQSIATQKLQA
FT                   LGLKDVNVTIAVDPASGGFRMAHLTATYAFVVDFPYLSSFPINYATTVTVPLVGG"
FT   CDS_pept        complement(761843..762277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0947"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48425"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48425"
FT                   /db_xref="GOA:Q98LN8"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LN8"
FT                   /protein_id="BAB48425.1"
FT                   /translation="MERGSILGDRSGVAAVEFAMVLPFLCAALLGIIDGWSYVTSSLSM
FT                   RAGVKTAANLIMEGSTNDTATQAVAMSSWEKRPTDGQVTLSRIYMCGTTVVDASTLCSG
FT                   PKVPSVYVQIQASATWTPPFTFGVFSASSVIGHLEVIRVR"
FT   CDS_pept        complement(762284..763510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0948"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48426"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48426"
FT                   /db_xref="GOA:Q98LN7"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LN7"
FT                   /protein_id="BAB48426.1"
FT                   /translation="MAFNRFTRIRLVATGIRRSTRANVATIFALSLPIVVGAAGFGVET
FT                   SYWYYNSLRLQATADAAAYAGALEQISGSDKPTIIAAATQSAATNGLGSGTIVVNTPPA
FT                   SGPNTAKKAVEVIVAQNINRMFTSIFTQGQVPEQARAVALITNASKACVLALDPSASQA
FT                   ALFSGNTSVKLIGCSVMSNSIASDAIKLQGSAGLQADCLISGGGVSLSNPVTTVCAAPI
FT                   TQALPAADPFADLPAPAASNPCQNDNKATLSPGTYCSGMTLKGNVTLSPGVYVVQGNLK
FT                   INANAAITGSGVTIFMSGSSSVSINGNASVKLSAPTSGAYSGVLFYGDRTGNSASSTFN
FT                   GTADSLLTGAIYFPKQQISYLGNFSGNNGCTQVVANTIQWSGNSTINQDCTSLGMRDIP
FT                   ATQSVALVE"
FT   CDS_pept        complement(763808..774787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0950"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48427"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48427"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LN6"
FT                   /protein_id="BAB48427.1"
FT                   /translation="MTLTLFVGSTGPAEATCTGPSGGVETCAGSGTQSDISYTAPGVTT
FT                   LNVNTLTIDPSRISLTGSGANPAPATEVQHYTCSTGNAADCVITPEKPAQNGNPAVAES
FT                   CAVASGAPAGTSCVAPPVKAAGGPSGNSGPTLVVNYNQPTANTNTPNSGAVIATGTIGV
FT                   LGASNGSRGGNGSNGYVFSDGGDGANGADGGIVTVNVDGAVMTSNNCVLPTACPNAGIV
FT                   ASSVGGDGGDGGDAKGISGDAGDGGLGGSGGNATVNFNSGSVETQGNYSAGIAAISQGG
FT                   HGGNGGGGGGLVFNPGGGSPAGAGGNANVFTGVGTTITTYGIYSHGIAAQSIGGGGGGS
FT                   AGGFGLFSSSGGSGGNGGNGGIVQVTNNANIATWGNNSQGILAQTIGGGGGDGGSNFGL
FT                   FASGGSGSLGGNGGPANVVTVGVTNSGAIVTHGQESNGILAQSIGGGGGNGGNSGGLVS
FT                   LGGDGASTTNGGIVEVTNTSAGSISTDGKQSAGIFAQSVGGGGGNGGTSGGLFSAGGKG
FT                   GAGGNGARVTVTNAGDIETGKNGAASVNSAGIFAQSVGGGGGNGGGAFSGGIGFSVAIG
FT                   GAGGSGGTSGAVEVLRDANDTAYSIITHGDQSDAVFAQSIGGGGGNGGFSVSGAVGVLA
FT                   LAMGGAAGNASDGNIVTVETAGSLTTYGQGSRGIFAQSIGGTGGNGGAAIAVAVNATGT
FT                   FAAAIGIGGNGGAGGASKLVTVSSLSDISTAGNNAGGIVAQSVGGGGGNGGYAIGGAIG
FT                   GAVGIAVNIGGKGAGGGAGADVIVGSSGSIHTKGNNSTGILAQSVGGGGGNGGFTISAA
FT                   LGGGAASVGLGGAGADGSNAGNVTVSADGAGHTVATTYTGTWNLVTEGKNAVGIQAESI
FT                   GGGGGNGGFSGSLAAGGLVGVGVSLGGTGGGGGDAGTATVNNGKKVGNTVTHNNILTIE
FT                   DNSTGILAQSIGGGGGNGGFAVTLSVSGSYEGAGGAAAVSVGGSGATGGVGKDVFVTSY
FT                   GNIATYGKQSDGILAQSIGGGGGNGGFSVAGTFTTGALGASVAVGGSGGSGQSAGEVTV
FT                   TSAGNIQTHGDQSIGIMAQSVGGGGGNGGFAGAGAITLQGVSAAVGLGGSGAGGGSAKT
FT                   VRVTSTGDITTYGDQAIGILAQSVGGGGGNGGSTVSLALAKDAGIGVALGGKGGAAGNG
FT                   LDVTVISTGNISTGAGFISGGVRGTGAAGILAQSVGGGGGNGGFAGTLGGGKSIAVGVA
FT                   FGGSGAGGGSADIVKVTSTGNISTNFDNSSGIIAQSIGGGGGNGGFSVAVTGALGDPDA
FT                   ATASVAIGGKGGVGGVGKDVTVTSTGTITTTGKFSNGILAQSIGGGGGNGGFAVAGSAT
FT                   TGNAGIGVGVGGTGATGSASGKVIVNSYSLVGANGQPVLLAPASNIVSIWTQGDNSSGI
FT                   FAQSVGGGGGSGGFAGSLGVGLGGGGLGVSIGGGAGSGSTAETVTVTSYNNILTGGKDS
FT                   FGIMAQSVGGGGGNGGFAIALAGSKDMAASVAVGGSGSSGGDAAVVTVTSHGNIETDGD
FT                   GSHAIFAQSVGGGGGNGGGAIAGTLTGEGTGSLAVGVGGSGDNGGNAKAVTVSSTGDLR
FT                   TEGLKADGILAQSIGGGGGNGGFSGALAITTGAGAIGVGVGGSGKGGGNADTVTVTSTG
FT                   NIVTLKNGSNGILAQSVGGGGGNGGAAVTIAGSGQKAAAAVSVGGSGAKGGTSQLVTVN
FT                   NIGTIDTTGDKANGILAQSIGGGGGTGGFAISGEMVVDGAGGAAVSVGGNGGTGQDGGR
FT                   VIVNSNIGTTLANNNATIHTVGGDSNGIFAQSVGGGGGDGGFSGAVSVTGQNAKAAIGV
FT                   SVGGSGAGSGDGKTVNVTSVDNILTGGNGANGILAQSVGGGGGNGGFSFAATIKGSLGK
FT                   NPSKNGAVSVSLGGGAGSGGDAEKVTVDSTGIIQTSGNKAFGVLAQSVGGGGGTGGLSV
FT                   AAALNLGEGGNQITAAVGGEGGGGGTGGEVLLTRHGSTITTGDQSVGLFAQSVGGSGGN
FT                   GGMAISGVIAGTDAKTLSASVGGFGGAGTNASKVTVDNTGAISTYGVESDAIQAQSIGG
FT                   GGGNGGMAVSAVIGSLGTGTNFNAGVTVGGFGGDAGFAGDVFVTNHGLLQTGLLAAGQT
FT                   TTNGDGAYGIFAQSVGGGGGSGGNAITGVLGLKGNNAGTQVNVSVAVGGSAGNGNTGGN
FT                   VTIRQYGGIETNGMGAFGILAQSIGGGGGTGGRANSISLQLGAKCTLPKVCEPAGGKPN
FT                   WNLQATVGGAGGTGNDAMTVDVGNYDFITTDGDKSSGIVAQSIGGGGGIGGDAYVGTGG
FT                   LLAIPYVPVDPTLLLKPLGTSSLTRSGTVAIGGNGAGGGNGGTVIVANEGVITTHGTKS
FT                   DGIHAQSIGGGGGDGGDGEAGALGTVGLGGQGKAAGNGGSVTVTNGKANLSQAGAAIIQ
FT                   TFGTSPTPPAEGAPSADPEQGYSAGIFAQSVGGGGGTGGGAGGLLSLGGSGKAGGTGGH
FT                   VTVNNYGGILTHADDSVGIFAQSIGGGGGAGGSLGISAIAVGGSGGASGSGGQVDVVNN
FT                   AMIETHGIDSYAIQAQSVGGGGGSGGGKNGGITGSIPALISIGGAGGSSGIGGIVNVTN
FT                   NNSLHTYGAGADGINAQSIGGGGGSGGRAIGFIAVGGKGGDVGNGTTAGSNGGGGAVTV
FT                   NNNANGTITVEGIGAHGIFAQSVGAGGGSGGGAFGVSIVPVAIGVGGGGGSSGDGGVVT
FT                   VNNHGDITTVSASSVAIFAESIGGGGGTGAMSVAASPAPGAFTFGIGGDGGANGKGGNV
FT                   NVTNFSDGIIHTQGFGSTGIMAQSVGGGGGAGGASYSVSGGPPGLAIALGGKGAAGGDG
FT                   GIVTVINNGAMQLDGDNSVAIFAQSVGGGGGSGGTAIAAAIGVPVFIGGDTGATGKGGD
FT                   VTVTNTGQIRLTGNGSVGIFAQSVGGGGGVVTAGTDGIVQAVAGGSGNGGVVTINSNVA
FT                   MLITGDNSVGVFGQSIGGGGGVGGFSGNYLGLDQVQSTSSKMAMAPQGFMGSAGGGGTG
FT                   GAITFTQTADLAVIGKNSFALMEQSAGGTGNISDNGDINVTIASGVTIIGGSGAGGGIG
FT                   YKDGKDNVLTNNGIVRSVLLIDGYAMRGGVGNETFDNMYLTVGSMDLGAGLNIFNNKTN
FT                   AVYLMGDTVYLDLAGQFDNDGFAAPGGLDRVMTTDVTGNWSQSLGGVYLLDLDLDPEAD
FT                   RINVSGTADVNGLVSINIMNPGAAKPGNQDYIILEAQGGVTDNGLKLDTIPSAVAQYAL
FT                   KYPNPEDIVLNVDINFARTGLTENQTAVGQAINAIQTDLTSPNFTKIANAIFYIPTLDQ
FT                   LGAVYDTISGEGISGFQQPEFDANSTFLAQMSRQADAWRMGIATDPMSQSLKAPEAAYA
FT                   EPPGKTNPFDALANGPNEQRWSYWATAGGNSGAVTGDPVVGSAALDYKSGNFAVGLDSQ
FT                   GDPDVLMGFALGGVAGSFAVPDRETSGNIIGGHAGAYGARKWGQFYINGSLAMDLYSNT
FT                   TDRFTSVPGAPNPLNPVPPITREHWTGDFMSAGFGTSLEAGWRRPFGAGAITPFAGLQF
FT                   QALAMQAFSEKSTSDGALGLDFDSRTVISLPVSLGLQLDTTMAIGESKTLQAWGRAAWL
FT                   HEFKPDRSVEPGFQAAPGYAFVVQGAGAAEDAITVNAGVKLNWSANTSVFATFDGKFAD
FT                   RVQTYGGNVGFRVNW"
FT   CDS_pept        complement(775569..775865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0951"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48428"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48428"
FT                   /db_xref="InterPro:IPR010385"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LN5"
FT                   /protein_id="BAB48428.1"
FT                   /translation="MDRLQFEVPVRIAQGPGLPVEEIYSVVQALDFLQDWPARRQGPVY
FT                   QKAFNACFGATVDVVKTEDACRAFMAFCRVTGLMASDMMAPRKRGGEASALQA"
FT   CDS_pept        complement(776050..776298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0952"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48429"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48429"
FT                   /db_xref="GOA:Q98LN4"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LN4"
FT                   /protein_id="BAB48429.1"
FT                   /translation="MIAMQQRIKTFKSLTRAASAASFLSVQAFICIGTVYWAVAETLYL
FT                   SGTVALVLGALFALPSAYVLLTVVRMAFDAETDPANQ"
FT   CDS_pept        777018..777845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0954"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48430"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48430"
FT                   /db_xref="GOA:Q98LN3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LN3"
FT                   /protein_id="BAB48430.1"
FT                   /translation="MVTYLDAATAPLRNTGQIRLYGEDGFAGMRKACDLTARCLDALVP
FT                   MVGPGVTTDAIDRFVFEFGMDHGALPATLNYRGYTKSSCTSINHVVCHGIPDNKPLKDG
FT                   DIVNIDVTYILDGWHGDSSRMYPVGTIKRAAERLLEVTHECLMRGIAAVRPGARTGAIG
FT                   AAIQTFAEAERCSVVRDFCGHGVGQLFHDAPNILHYGSANEGVEMRPGMIFTIEPMINL
FT                   GRPHVKVLSDGWTAVTRDRSLSAQYEHTIGVTDTGCEIFTLSPNNLDRPGLPA"
FT   CDS_pept        778023..778562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0956"
FT                   /product="DNA repair protein; RadC"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48431"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48431"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LN2"
FT                   /protein_id="BAB48431.1"
FT                   /translation="MRERFASAGADALPDYELLELLLFRLIPRADTKPAAKALLARFGT
FT                   LAEVLGAPVNLLQEVKGIGPAVALDLKVVAATAQRMAHGEVHGREVLSSWTQLLAYCRS
FT                   AMAFEAREQFRILFLDKKNALIADEVQQTGTVDHTPVYPREVVKRALELSATAIILVHN
FT                   HPTRLFLITHNHALAH"
FT   CDS_pept        778710..779963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0958"
FT                   /product="prbable integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48432"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48432"
FT                   /db_xref="GOA:Q98LN1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LN1"
FT                   /protein_id="BAB48432.1"
FT                   /translation="MPSLTDGEIRRALKQVEETGKQQNLVDGEGHGTGRLVLVIKPMPT
FT                   RVTADWMAQQWRDQKRLKKKFGSYPSMGLSQAREIFRRDFADMIQKGRSIKIAGDTRPG
FT                   TVADLFEAYVASLKADGKPSWKEAEKGLNKIADSLGRNRPARDIEPDEIRDIIRPIYQR
FT                   GKRSMADHVRSYIRSAYSWGLKSEHDYRSTSVRRFRLVYNPAAGIPTEPKNVGTRWLDE
FT                   EEFVRLYRWLEYPDAPVHPPYTRAVRILMLTGQRVEEIARLHVDQWDAAECIIDWSKTK
FT                   NGKPHAIPVPKIAAELIGSIKPNEFGWFFPSATDPSKPVSHGTLYSFMWRQRDREVIPV
FT                   VTNRDLRRTWKTLAGKAGLSKEIRDRLQNHTLQDVSSKSYDRWNYMPEKRAAMARWDKF
FT                   VRELVTKKKRKVALKEAA"
FT   CDS_pept        780135..780302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0959"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48433"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48433"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LN0"
FT                   /protein_id="BAB48433.1"
FT                   /translation="MPRYISASGEAVQLARLQIARDSFQIAQYGSDVWPREIGRIADVT
FT                   VRSDDHLQLG"
FT   CDS_pept        780697..780948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0960"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48434"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48434"
FT                   /db_xref="GOA:Q98LM9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LM9"
FT                   /protein_id="BAB48434.1"
FT                   /translation="MRPVVKTLGTLRHKSLITMLIAKREASGLTQTELAEKLGEYQSFV
FT                   ARLESGQRRVDVVEFIDLAKILGFDPSSAIKRLAAEPD"
FT   CDS_pept        781334..783352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0961"
FT                   /product="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48435"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48435"
FT                   /db_xref="GOA:Q98LM8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LM8"
FT                   /protein_id="BAB48435.1"
FT                   /translation="MAVRNIWLDAAKGVGILLVVAAHVAGEGPQQRDIIFANAVFLFHM
FT                   PLFFVISGYVYKPRDRQQLFWKKSASLAVPYISFLMVLTIAVVARRMLLGDPPAHWELR
FT                   AMAINEILGGMRLGRDFGVFWFVTCLFFTQLIYNDVARWAKNPGSRRMLAFVGFSMISG
FT                   YLIQAVLPLNQSPWALAAVPMALCCFWFGDLLRTFQFSRRIRWTFIAAVMALALIAWTS
FT                   GADIQFNMKYSIFGPPVVGLLIALGLSLAVLDLVREAAKIEKLAAPVAKLGEASLVIMF
FT                   LHQFFQFSFRDFGITNELVIMLAAVSGPLLIYQFLRRSALLAPWFLGTGDGAPGRLINW
FT                   LRNGLGWRIRNYREWLFELAKPYVAHLLIAVRWPLRRKGRPHGLPSDLVVSLTSYPARF
FT                   PTLHLTLRCLLSQTIAPDRVILWVTLEDAKHLPKSVNELKLHGLEIRFCKDIRSYKKIV
FT                   PALLAFPAAYIVTADDDVYYSKRWLEQLVEKAGERTVVCHRGHAVALNERGRIEPYSEW
FT                   SFDVAGQSEMLFPTGVGGVLYGPKSLSPEATDEETFTSLCPQGDDIWLFWMGRRAGSTY
FT                   VKTLNHWTELSWRGSQTSALHLTNVGTGRNDEQIRKITERYGLPAFAPLSSDKIRRLPF
FT                   TAEEMIARIQKALDAKGLLTAEESRSLWTKASQTKPD"
FT   CDS_pept        complement(783791..785098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0962"
FT                   /product="probable acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48436"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48436"
FT                   /db_xref="GOA:Q98LM7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LM7"
FT                   /protein_id="BAB48436.1"
FT                   /translation="MAPLMGQAARQRRRPVFALRRETRLLWCSATNSQCHAGGVLLQLQ
FT                   NIQERMDVTNNRPAGFDYLRLCLSLFVAVWHIPQIAYGDAGLGFWYNNHIWEVSRFVLP
FT                   MFFALSGFLVAGSLDRCLTLSAFLGLRVIRIFPALSVEVLLSALILGPLVTTVPLSQYF
FT                   SSGEFWRYLLNVTGEIHYTLPGVFKNAVAGNLVNAQLWTVPYELLCYIALSLLALVGAR
FT                   NSRALFLLSALSMPFVLVAWGLTHHWGAQMYAGVGTGLGHGLGLVNCFVAGVMIFFFKK
FT                   LLPWSIALFILMFAISCALLFTESPLSTFASIPVAYCTVFLGLTNPKRIFVLASADYSY
FT                   GIYLYHWPVFQFIGYNLGNSLVAIILIGLPLLVAFAAFSWHVIEKPALEFRKPIMRQDR
FT                   VGGGFALTASTVFCAALLTFVVCWKLIERIGYSVFL"
FT   CDS_pept        complement(785649..788696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0964"
FT                   /product="probable conjugal transfer protein; TraA"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48437"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48437"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR014136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LM6"
FT                   /protein_id="BAB48437.1"
FT                   /translation="MAIYHLHVKVIGRKAGSSAVASAAYRSASRLRDERIERTHDFSAK
FT                   RGVVHSEVMLPEDAPEAWRDRERLWNDVEAFEVRKDAQLAREVEFALPRELSQAQGIEL
FT                   ARDFVEAEFVSKGMAADLNVHWDRAEDGSPKPHAHVMLTMRAVDENGFGAKVRGWNATQ
FT                   LVERWRERWAELANERLADLDIDARIDHRSLEAQGIALEPQTQIGAPAQRIEGSGLAAG
FT                   DSEADRAELHREIARNNGARIIADPSVALDAITHQQSTFTRKDIAKFSHRHSDGMEQFN
FT                   AVVAAIGNAPHLVELGKDGRGEDRFTTRQMIDTEQRLHRAAERMDLDERHAVSDAYREA
FT                   VLARAAQRGLILSGEQTDALAHITDGRGLGVVVGFAGTGKSAMLGVARQAWAAAGYEVR
FT                   GAALSGIAAENLEGGSGIPSRTIASMEHSWGQGRDLLTARDVLVIDETGMVGTRQLERV
FT                   LSHAANVGAKVVLVGDPQQLQAIEAGAAFRSIHERHGGVEIGQVRRQREDWQRDATRDL
FT                   ATGRIGAAINAYDAQGMVHQAATRDDARSELVERWDRDRQAHPEASRIILTHTNDEVHA
FT                   LNQAARERMHAAGDLGDDVQVTVERGPRNFASGDRAMFLRNERALGVRNGTLGMIEQVS
FT                   TQSMTVRTDDGRLVRFDLKDYSHIDHGYAATIHKAQGMTVDRTHVLATPGMDAHGSYVA
FT                   LSRHRDAMDLHYGGDDFSTRDRLVRTLSRDRAKDMASDYEQIDPAQSYAERRGITFRER
FT                   VVEIVRRIVPEKLRDRIGGLIDGLRSPGDVEPGQDLGRRPARENVGAQIADDAATPERE
FT                   KPGPGAQRDTDLPMDPEAALRSARTKALVRHARALDAMSHNANADGRGSSDLMRELRDA
FT                   RNAFEKVRPYGWRDAEAAYVKNPELVREAGAGRVSRIVLALQLETEIRTGMDIDPGRRA
FT                   DRFVERWQKLDRTGQRQYQAGDMSGYKSTRSAMSDMAKSLERDPQLESLLANRKRELGI
FT                   KIDSGRRLGAELAFSHGIGKGRGLGL"
FT   CDS_pept        789197..789415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0965"
FT                   /product="probable conjugal transfer protein; TraD"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48438"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48438"
FT                   /db_xref="GOA:Q98LM5"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LM5"
FT                   /protein_id="BAB48438.1"
FT                   /translation="MRTWQVERRKRTRHLIELGGLVVKAGIVELTSDDRAIIYGAMLWI
FT                   AAKMQSHESEHARELWAAKGKQAFDAK"
FT   CDS_pept        789614..790879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0967"
FT                   /product="N-carbamyl-L-amino acid amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48439"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48439"
FT                   /db_xref="GOA:Q98LM4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LM4"
FT                   /protein_id="BAB48439.1"
FT                   /translation="MRSTELARSEHASRIGEIQIQRLIFDLGKFGAHSGTGVWRTVYSP
FT                   EWVAAADQFAEWCREAGLAVHSDAVGNVWGRLEGEEPGPSIVSGSHIDSQTPGGRYDGA
FT                   LGAIAALVAVDALAKQFGKPRRTLEVLALCEEEGSRFPAASLWGSRAITGCIDPREFDE
FT                   LVDGDGVSIGQAMKAVGLDTNDLGKAQRDDIGTFIELHIEQGPVLEAAGLGVGLVTAIN
FT                   GLRHYRVELAGEANHAGAFPMDARRDPMAGFAEIAGGLISTAERWGRPAVTTVGQVSVE
FT                   PNLPAIIPAKVTFMIDARHPDPDAVQRLYTLHENLIHEVADRRGLKVKITVVENQVPLI
FT                   CHPEIVTAIKATAEEQGIRLSNLSSGGSHDTQQMSRIARAGRIFVRSKDGRSHTPEEFS
FT                   SIDDIVDGIKVLAGTLYKLAYC"
FT   CDS_pept        complement(791636..791827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0968"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48440"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48440"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LM3"
FT                   /protein_id="BAB48440.1"
FT                   /translation="MVGSMAVIRYAERNGTRRTWLMQLMARRTTKVAAVALANKTARMV
FT                   WALMTNGGRYREPDIRIG"
FT   CDS_pept        complement(791850..792407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0969"
FT                   /product="probable transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48441"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48441"
FT                   /db_xref="GOA:Q98LM2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LM2"
FT                   /protein_id="BAB48441.1"
FT                   /translation="MMSNVMTIGLDIAKSVFQIHGVHAAGEVVVRRKLTRGRVLGFFER
FT                   LPRCLVGIEACSSSHYWARELIARGHDVRLLPAQYVKPYLKRQKNDAADAEAICEAVTR
FT                   PTMRFVPVKSPEQQSVMMLHRVRLMLNRPRGRSAAGERVHSDRRRSACVQVGTLSIGLD
FT                   RARSKAELERRQGEARQHLQGW"
FT   CDS_pept        793208..793738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0970"
FT                   /product="ubiquinol-cytochrome c reductase iron-sulfur
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48442"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48442"
FT                   /db_xref="GOA:Q98LM1"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LM1"
FT                   /protein_id="BAB48442.1"
FT                   /translation="MQSPRRLLFGNVGAAIMADILQRESGSAEHAVATEELTSVEVDVS
FT                   ALAPGTSVVVNWNGKPVVVRHRTEKERKDSEAVNLADLKDPIARNANLPADAPATDANR
FT                   AAPGKEAWIVIVQVCTHLGCIPSYKEGDFGGWLCPCHGSQYDSAGRVRKGPALENMAVP
FT                   EFQFISDTKIRIG"
FT   CDS_pept        793755..795035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0971"
FT                   /product="ubiquinol-cytochrome c reductase iron-sulfur
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48443"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48443"
FT                   /db_xref="GOA:Q98LM0"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LM0"
FT                   /protein_id="BAB48443.1"
FT                   /translation="MREGHSTYKPKTGIERWLDGRLPLPRVVHDSFIVYPVPRNLNFAY
FT                   TFGGILTMMLGLQVATGIVLAMHYAADTTLAFNTVEKIVRDVNSGWLLRSLHANGASFF
FT                   FIAVYVHIFRGLYYGSYKAPRELLWILGCLNVLLMMAIAFIGYVLPWGQMSFWGATVIT
FT                   NFFTAIPLVGGWIQKLLLGGFAVENPTLNRFFALHYLLPFLLIGNVTLHIWALHVVGQN
FT                   NPAGIDVQSSTDVVDFTPHATIKDIFGAVMFLIVFLYFVFYLPNYLGHPDNYSAADPLK
FT                   TPSHIVPEWYFLPFYAMLRAVNFNVGPIDSKLGGVLALFGAIVVLFFVPWLDRTSVRSA
FT                   VY