(data stored in SCRATCH3701 zone)

EMBL: BA000037

ID   BA000037; SV 2; circular; genomic DNA; STD; PRO; 3354505 BP.
XX
AC   BA000037; AP005330-AP005343;
XX
PR   Project:PRJNA1430;
XX
DT   26-OCT-2004 (Rel. 81, Created)
DT   10-OCT-2016 (Rel. 130, Last updated, Version 6)
XX
DE   Vibrio vulnificus YJ016 DNA, chromosome I, complete sequence.
XX
KW   .
XX
OS   Vibrio vulnificus YJ016
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales; Vibrionaceae;
OC   Vibrio.
XX
RN   [1]
RP   1-3354505
RA   Chen C.Y., Wu K.M., Tsai S.F.;
RT   ;
RL   Submitted (29-MAY-2002) to the INSDC.
RL   Contact:Shih Feng Tsai National Health Research Institutes, Division of
RL   Molecular and Genomic Medicine; 128, Yen-Chiu-Yuan Road, Sec 2, Taipei 115,
RL   Taiwan
XX
RN   [2]
RX   DOI; 10.1101/gr.1295503.
RX   PUBMED; 14656965.
RA   Chen C.Y., Wu K.M., Chang Y.C., Chang C.H., Tsai H.C., Liao T.L., Liu Y.M.,
RA   Chen H.J., Shen A.B., Li J.C., Su T.L., Shao C.P., Lee C.T., Hor L.I.,
RA   Tsai S.F.;
RT   "Comparative genome analysis of Vibrio vulnificus, a marine pathogen";
RL   Genome Res. 13(12):2577-2587(2003).
XX
DR   MD5; 0f45fb6264dacd896a42b98fe850f17d.
DR   BioSample; SAMD00061075.
DR   EnsemblGenomes-Gn; EBG00000036776.
DR   EnsemblGenomes-Gn; EBG00000036777.
DR   EnsemblGenomes-Gn; EBG00000036778.
DR   EnsemblGenomes-Gn; EBG00000036779.
DR   EnsemblGenomes-Gn; EBG00000036780.
DR   EnsemblGenomes-Gn; EBG00000036781.
DR   EnsemblGenomes-Gn; EBG00000036782.
DR   EnsemblGenomes-Gn; EBG00000036783.
DR   EnsemblGenomes-Gn; EBG00000036784.
DR   EnsemblGenomes-Gn; EBG00000036785.
DR   EnsemblGenomes-Gn; EBG00000036786.
DR   EnsemblGenomes-Gn; EBG00000036787.
DR   EnsemblGenomes-Gn; EBG00000036788.
DR   EnsemblGenomes-Gn; EBG00000036789.
DR   EnsemblGenomes-Gn; EBG00000036790.
DR   EnsemblGenomes-Gn; EBG00000036791.
DR   EnsemblGenomes-Gn; EBG00000036792.
DR   EnsemblGenomes-Gn; EBG00000036793.
DR   EnsemblGenomes-Gn; EBG00000036794.
DR   EnsemblGenomes-Gn; EBG00000036795.
DR   EnsemblGenomes-Gn; EBG00000036796.
DR   EnsemblGenomes-Gn; EBG00000036797.
DR   EnsemblGenomes-Gn; EBG00000036798.
DR   EnsemblGenomes-Gn; EBG00000036799.
DR   EnsemblGenomes-Gn; EBG00000036800.
DR   EnsemblGenomes-Gn; EBG00000036801.
DR   EnsemblGenomes-Gn; EBG00000036802.
DR   EnsemblGenomes-Gn; EBG00000036803.
DR   EnsemblGenomes-Gn; EBG00000036804.
DR   EnsemblGenomes-Gn; EBG00000036805.
DR   EnsemblGenomes-Gn; EBG00000036806.
DR   EnsemblGenomes-Gn; EBG00000036807.
DR   EnsemblGenomes-Gn; EBG00000036808.
DR   EnsemblGenomes-Gn; EBG00000036809.
DR   EnsemblGenomes-Gn; EBG00000036810.
DR   EnsemblGenomes-Gn; EBG00000036811.
DR   EnsemblGenomes-Gn; EBG00000036812.
DR   EnsemblGenomes-Gn; EBG00000036813.
DR   EnsemblGenomes-Gn; EBG00000036814.
DR   EnsemblGenomes-Gn; EBG00000036815.
DR   EnsemblGenomes-Gn; EBG00000036816.
DR   EnsemblGenomes-Gn; EBG00000036817.
DR   EnsemblGenomes-Gn; EBG00000036818.
DR   EnsemblGenomes-Gn; EBG00000036819.
DR   EnsemblGenomes-Gn; EBG00000036820.
DR   EnsemblGenomes-Gn; EBG00000036821.
DR   EnsemblGenomes-Gn; EBG00000036822.
DR   EnsemblGenomes-Gn; EBG00000036823.
DR   EnsemblGenomes-Gn; EBG00000036824.
DR   EnsemblGenomes-Gn; EBG00000036825.
DR   EnsemblGenomes-Gn; EBG00000036826.
DR   EnsemblGenomes-Gn; EBG00000036827.
DR   EnsemblGenomes-Gn; EBG00000036828.
DR   EnsemblGenomes-Gn; EBG00000036829.
DR   EnsemblGenomes-Gn; EBG00000036830.
DR   EnsemblGenomes-Gn; EBG00000036831.
DR   EnsemblGenomes-Gn; EBG00000036832.
DR   EnsemblGenomes-Gn; EBG00000036833.
DR   EnsemblGenomes-Gn; EBG00000036834.
DR   EnsemblGenomes-Gn; EBG00000036835.
DR   EnsemblGenomes-Gn; EBG00000036836.
DR   EnsemblGenomes-Gn; EBG00000036837.
DR   EnsemblGenomes-Gn; EBG00000036838.
DR   EnsemblGenomes-Gn; EBG00000036839.
DR   EnsemblGenomes-Gn; EBG00000036840.
DR   EnsemblGenomes-Gn; EBG00000036841.
DR   EnsemblGenomes-Gn; EBG00000036842.
DR   EnsemblGenomes-Gn; EBG00000036843.
DR   EnsemblGenomes-Gn; EBG00000036844.
DR   EnsemblGenomes-Gn; EBG00000036845.
DR   EnsemblGenomes-Gn; EBG00000036846.
DR   EnsemblGenomes-Gn; EBG00000036847.
DR   EnsemblGenomes-Gn; EBG00000036848.
DR   EnsemblGenomes-Gn; EBG00000036849.
DR   EnsemblGenomes-Gn; EBG00000036850.
DR   EnsemblGenomes-Gn; EBG00000036851.
DR   EnsemblGenomes-Gn; EBG00000036852.
DR   EnsemblGenomes-Gn; EBG00000036853.
DR   EnsemblGenomes-Gn; EBG00000036854.
DR   EnsemblGenomes-Gn; EBG00000036855.
DR   EnsemblGenomes-Gn; EBG00000036856.
DR   EnsemblGenomes-Gn; EBG00000036857.
DR   EnsemblGenomes-Gn; EBG00000036858.
DR   EnsemblGenomes-Gn; EBG00000036859.
DR   EnsemblGenomes-Gn; EBG00000036860.
DR   EnsemblGenomes-Gn; EBG00000036861.
DR   EnsemblGenomes-Gn; EBG00000036862.
DR   EnsemblGenomes-Gn; EBG00000036863.
DR   EnsemblGenomes-Gn; EBG00000036864.
DR   EnsemblGenomes-Gn; EBG00000036865.
DR   EnsemblGenomes-Gn; EBG00000036866.
DR   EnsemblGenomes-Gn; EBG00000036867.
DR   EnsemblGenomes-Gn; EBG00000036868.
DR   EnsemblGenomes-Gn; EBG00000036869.
DR   EnsemblGenomes-Gn; EBG00000036870.
DR   EnsemblGenomes-Gn; EBG00000036871.
DR   EnsemblGenomes-Gn; EBG00000036872.
DR   EnsemblGenomes-Gn; EBG00000036873.
DR   EnsemblGenomes-Gn; EBG00000036874.
DR   EnsemblGenomes-Gn; EBG00000036875.
DR   EnsemblGenomes-Gn; EBG00000036876.
DR   EnsemblGenomes-Gn; EBG00000036877.
DR   EnsemblGenomes-Gn; EBG00000036878.
DR   EnsemblGenomes-Gn; EBG00000036879.
DR   EnsemblGenomes-Gn; EBG00000036880.
DR   EnsemblGenomes-Gn; EBG00000036881.
DR   EnsemblGenomes-Gn; EBG00000036882.
DR   EnsemblGenomes-Gn; EBG00000036883.
DR   EnsemblGenomes-Gn; EBG00000036884.
DR   EnsemblGenomes-Gn; EBG00000036885.
DR   EnsemblGenomes-Gn; EBG00000036886.
DR   EnsemblGenomes-Gn; EBG00000036887.
DR   EnsemblGenomes-Gn; EBG00000036888.
DR   EnsemblGenomes-Gn; EBG00000036889.
DR   EnsemblGenomes-Gn; EBG00000036890.
DR   EnsemblGenomes-Gn; EBG00000036891.
DR   EnsemblGenomes-Gn; EBG00000036892.
DR   EnsemblGenomes-Gn; EBG00000036893.
DR   EnsemblGenomes-Gn; EBG00000036894.
DR   EnsemblGenomes-Gn; EBG00000036895.
DR   EnsemblGenomes-Gn; EBG00000036896.
DR   EnsemblGenomes-Gn; EBG00000036897.
DR   EnsemblGenomes-Gn; EBG00000036898.
DR   EnsemblGenomes-Gn; EBG00000036899.
DR   EnsemblGenomes-Gn; EBG00000036900.
DR   EnsemblGenomes-Gn; EBG00000036901.
DR   EnsemblGenomes-Gn; EBG00000036902.
DR   EnsemblGenomes-Gn; EBG00000622711.
DR   EnsemblGenomes-Gn; EBG00001026613.
DR   EnsemblGenomes-Gn; EBG00001026614.
DR   EnsemblGenomes-Gn; EBG00001026615.
DR   EnsemblGenomes-Gn; EBG00001026616.
DR   EnsemblGenomes-Gn; EBG00001026617.
DR   EnsemblGenomes-Gn; EBG00001026618.
DR   EnsemblGenomes-Gn; EBG00001026619.
DR   EnsemblGenomes-Gn; EBG00001026620.
DR   EnsemblGenomes-Gn; EBG00001026621.
DR   EnsemblGenomes-Gn; EBG00001026622.
DR   EnsemblGenomes-Gn; EBG00001026623.
DR   EnsemblGenomes-Gn; EBG00001026625.
DR   EnsemblGenomes-Gn; EBG00001026626.
DR   EnsemblGenomes-Gn; EBG00001026627.
DR   EnsemblGenomes-Gn; EBG00001026628.
DR   EnsemblGenomes-Gn; EBG00001026629.
DR   EnsemblGenomes-Gn; EBG00001026630.
DR   EnsemblGenomes-Gn; EBG00001026631.
DR   EnsemblGenomes-Gn; EBG00001026632.
DR   EnsemblGenomes-Gn; EBG00001026633.
DR   EnsemblGenomes-Gn; EBG00001026635.
DR   EnsemblGenomes-Gn; EBG00001026637.
DR   EnsemblGenomes-Gn; EBG00001026638.
DR   EnsemblGenomes-Gn; EBG00001026639.
DR   EnsemblGenomes-Gn; EBG00001026640.
DR   EnsemblGenomes-Gn; EBG00001026641.
DR   EnsemblGenomes-Gn; EBG00001026642.
DR   EnsemblGenomes-Gn; EBG00001026643.
DR   EnsemblGenomes-Gn; EBG00001026644.
DR   EnsemblGenomes-Gn; EBG00001026645.
DR   EnsemblGenomes-Gn; EBG00001026646.
DR   EnsemblGenomes-Gn; EBG00001026647.
DR   EnsemblGenomes-Gn; EBG00001026648.
DR   EnsemblGenomes-Gn; EBG00001026649.
DR   EnsemblGenomes-Gn; EBG00001026652.
DR   EnsemblGenomes-Gn; EBG00001026653.
DR   EnsemblGenomes-Gn; EBG00001026654.
DR   EnsemblGenomes-Gn; EBG00001026655.
DR   EnsemblGenomes-Gn; EBG00001026656.
DR   EnsemblGenomes-Gn; EBG00001026657.
DR   EnsemblGenomes-Gn; EBG00001026658.
DR   EnsemblGenomes-Gn; EBG00001026659.
DR   EnsemblGenomes-Gn; EBG00001026660.
DR   EnsemblGenomes-Gn; EBG00001026661.
DR   EnsemblGenomes-Gn; EBG00001026662.
DR   EnsemblGenomes-Gn; EBG00001026663.
DR   EnsemblGenomes-Gn; EBG00001026664.
DR   EnsemblGenomes-Gn; EBG00001026665.
DR   EnsemblGenomes-Gn; EBG00001026666.
DR   EnsemblGenomes-Gn; EBG00001026668.
DR   EnsemblGenomes-Gn; EBG00001026669.
DR   EnsemblGenomes-Gn; EBG00001026671.
DR   EnsemblGenomes-Gn; EBG00001026672.
DR   EnsemblGenomes-Gn; EBG00001026673.
DR   EnsemblGenomes-Gn; EBG00001026674.
DR   EnsemblGenomes-Gn; EBG00001026675.
DR   EnsemblGenomes-Gn; EBG00001026676.
DR   EnsemblGenomes-Gn; EBG00001026679.
DR   EnsemblGenomes-Gn; EBG00001026680.
DR   EnsemblGenomes-Gn; EBG00001026681.
DR   EnsemblGenomes-Gn; EBG00001026682.
DR   EnsemblGenomes-Gn; EBG00001026683.
DR   EnsemblGenomes-Gn; EBG00001026684.
DR   EnsemblGenomes-Gn; EBG00001026685.
DR   EnsemblGenomes-Gn; EBG00001026686.
DR   EnsemblGenomes-Gn; EBG00001026687.
DR   EnsemblGenomes-Gn; EBG00001026688.
DR   EnsemblGenomes-Gn; EBG00001026689.
DR   EnsemblGenomes-Gn; EBG00001026690.
DR   EnsemblGenomes-Gn; EBG00001026691.
DR   EnsemblGenomes-Gn; EBG00001026692.
DR   EnsemblGenomes-Gn; EBG00001026693.
DR   EnsemblGenomes-Gn; EBG00001026694.
DR   EnsemblGenomes-Gn; EBG00001026695.
DR   EnsemblGenomes-Gn; EBG00001026697.
DR   EnsemblGenomes-Gn; EBG00001026698.
DR   EnsemblGenomes-Gn; EBG00001026699.
DR   EnsemblGenomes-Gn; EBG00001026700.
DR   EnsemblGenomes-Gn; EBG00001026701.
DR   EnsemblGenomes-Gn; EBG00001026702.
DR   EnsemblGenomes-Gn; EBG00001026703.
DR   EnsemblGenomes-Gn; EBG00001026704.
DR   EnsemblGenomes-Gn; EBG00001026705.
DR   EnsemblGenomes-Gn; EBG00001026706.
DR   EnsemblGenomes-Gn; EBG00001026708.
DR   EnsemblGenomes-Gn; EBG00001026709.
DR   EnsemblGenomes-Gn; EBG00001026710.
DR   EnsemblGenomes-Gn; EBG00001026711.
DR   EnsemblGenomes-Gn; EBG00001026712.
DR   EnsemblGenomes-Gn; EBG00001026713.
DR   EnsemblGenomes-Gn; EBG00001026714.
DR   EnsemblGenomes-Gn; EBG00001026715.
DR   EnsemblGenomes-Gn; EBG00001026716.
DR   EnsemblGenomes-Gn; EBG00001026717.
DR   EnsemblGenomes-Gn; EBG00001026718.
DR   EnsemblGenomes-Gn; EBG00001026719.
DR   EnsemblGenomes-Gn; EBG00001026720.
DR   EnsemblGenomes-Gn; EBG00001026721.
DR   EnsemblGenomes-Gn; EBG00001026722.
DR   EnsemblGenomes-Gn; EBG00001026724.
DR   EnsemblGenomes-Gn; EBG00001026726.
DR   EnsemblGenomes-Gn; EBG00001026729.
DR   EnsemblGenomes-Gn; EBG00001026730.
DR   EnsemblGenomes-Gn; EBG00001026732.
DR   EnsemblGenomes-Gn; EBG00001026734.
DR   EnsemblGenomes-Gn; EBG00001026735.
DR   EnsemblGenomes-Gn; EBG00001026737.
DR   EnsemblGenomes-Gn; EBG00001026740.
DR   EnsemblGenomes-Gn; EBG00001026743.
DR   EnsemblGenomes-Gn; EBG00001026745.
DR   EnsemblGenomes-Gn; EBG00001026747.
DR   EnsemblGenomes-Gn; EBG00001026752.
DR   EnsemblGenomes-Gn; EBG00001026753.
DR   EnsemblGenomes-Gn; EBG00001026754.
DR   EnsemblGenomes-Gn; EBG00001026755.
DR   EnsemblGenomes-Gn; EBG00001026756.
DR   EnsemblGenomes-Gn; EBG00001026757.
DR   EnsemblGenomes-Gn; EBG00001026758.
DR   EnsemblGenomes-Gn; EBG00001026759.
DR   EnsemblGenomes-Gn; EBG00001026760.
DR   EnsemblGenomes-Gn; EBG00001026761.
DR   EnsemblGenomes-Gn; EBG00001026762.
DR   EnsemblGenomes-Gn; EBG00001026763.
DR   EnsemblGenomes-Gn; EBG00001026764.
DR   EnsemblGenomes-Gn; EBG00001026765.
DR   EnsemblGenomes-Gn; EBG00001026766.
DR   EnsemblGenomes-Gn; EBG00001026767.
DR   EnsemblGenomes-Gn; EBG00001026768.
DR   EnsemblGenomes-Gn; EBG00001026769.
DR   EnsemblGenomes-Gn; EBG00001026770.
DR   EnsemblGenomes-Gn; EBG00001026771.
DR   EnsemblGenomes-Gn; EBG00001026772.
DR   EnsemblGenomes-Gn; EBG00001026773.
DR   EnsemblGenomes-Gn; EBG00001026774.
DR   EnsemblGenomes-Gn; EBG00001026775.
DR   EnsemblGenomes-Gn; EBG00001026776.
DR   EnsemblGenomes-Gn; EBG00001026777.
DR   EnsemblGenomes-Gn; EBG00001026778.
DR   EnsemblGenomes-Gn; EBG00001026779.
DR   EnsemblGenomes-Gn; EBG00001026780.
DR   EnsemblGenomes-Gn; EBG00001026781.
DR   EnsemblGenomes-Gn; EBG00001026782.
DR   EnsemblGenomes-Gn; EBG00001026783.
DR   EnsemblGenomes-Gn; EBG00001026785.
DR   EnsemblGenomes-Gn; EBG00001026788.
DR   EnsemblGenomes-Gn; EBG00001026789.
DR   EnsemblGenomes-Gn; EBG00001026791.
DR   EnsemblGenomes-Gn; EBG00001026792.
DR   EnsemblGenomes-Gn; EBG00001026794.
DR   EnsemblGenomes-Gn; EBG00001026795.
DR   EnsemblGenomes-Gn; EBG00001026796.
DR   EnsemblGenomes-Gn; EBG00001026797.
DR   EnsemblGenomes-Gn; EBG00001026798.
DR   EnsemblGenomes-Gn; EBG00001026799.
DR   EnsemblGenomes-Gn; EBG00001026800.
DR   EnsemblGenomes-Gn; EBG00001026801.
DR   EnsemblGenomes-Gn; EBG00001026802.
DR   EnsemblGenomes-Gn; EBG00001026804.
DR   EnsemblGenomes-Gn; EBG00001026805.
DR   EnsemblGenomes-Gn; EBG00001026806.
DR   EnsemblGenomes-Gn; EBG00001026807.
DR   EnsemblGenomes-Tr; EBG00000036776-1.
DR   EnsemblGenomes-Tr; EBG00000036777-1.
DR   EnsemblGenomes-Tr; EBG00000036778-1.
DR   EnsemblGenomes-Tr; EBG00000036779-1.
DR   EnsemblGenomes-Tr; EBG00000036780-1.
DR   EnsemblGenomes-Tr; EBG00000036781-1.
DR   EnsemblGenomes-Tr; EBG00000036782-1.
DR   EnsemblGenomes-Tr; EBG00000036783-1.
DR   EnsemblGenomes-Tr; EBG00000036784-1.
DR   EnsemblGenomes-Tr; EBG00000036785-1.
DR   EnsemblGenomes-Tr; EBG00000036786-1.
DR   EnsemblGenomes-Tr; EBG00000036787-1.
DR   EnsemblGenomes-Tr; EBG00000036788-1.
DR   EnsemblGenomes-Tr; EBG00000036789-1.
DR   EnsemblGenomes-Tr; EBG00000036790-1.
DR   EnsemblGenomes-Tr; EBG00000036791-1.
DR   EnsemblGenomes-Tr; EBG00000036792-1.
DR   EnsemblGenomes-Tr; EBG00000036793-1.
DR   EnsemblGenomes-Tr; EBG00000036794-1.
DR   EnsemblGenomes-Tr; EBG00000036795-1.
DR   EnsemblGenomes-Tr; EBG00000036796-1.
DR   EnsemblGenomes-Tr; EBG00000036797-1.
DR   EnsemblGenomes-Tr; EBG00000036798-1.
DR   EnsemblGenomes-Tr; EBG00000036799-1.
DR   EnsemblGenomes-Tr; EBG00000036800-1.
DR   EnsemblGenomes-Tr; EBG00000036801-1.
DR   EnsemblGenomes-Tr; EBG00000036802-1.
DR   EnsemblGenomes-Tr; EBG00000036803-1.
DR   EnsemblGenomes-Tr; EBG00000036804-1.
DR   EnsemblGenomes-Tr; EBG00000036805-1.
DR   EnsemblGenomes-Tr; EBG00000036806-1.
DR   EnsemblGenomes-Tr; EBG00000036807-1.
DR   EnsemblGenomes-Tr; EBG00000036808-1.
DR   EnsemblGenomes-Tr; EBG00000036809-1.
DR   EnsemblGenomes-Tr; EBG00000036810-1.
DR   EnsemblGenomes-Tr; EBG00000036811-1.
DR   EnsemblGenomes-Tr; EBG00000036812-1.
DR   EnsemblGenomes-Tr; EBG00000036813-1.
DR   EnsemblGenomes-Tr; EBG00000036814-1.
DR   EnsemblGenomes-Tr; EBG00000036815-1.
DR   EnsemblGenomes-Tr; EBG00000036816-1.
DR   EnsemblGenomes-Tr; EBG00000036817-1.
DR   EnsemblGenomes-Tr; EBG00000036818-1.
DR   EnsemblGenomes-Tr; EBG00000036819-1.
DR   EnsemblGenomes-Tr; EBG00000036820-1.
DR   EnsemblGenomes-Tr; EBG00000036821-1.
DR   EnsemblGenomes-Tr; EBG00000036822-1.
DR   EnsemblGenomes-Tr; EBG00000036823-1.
DR   EnsemblGenomes-Tr; EBG00000036824-1.
DR   EnsemblGenomes-Tr; EBG00000036825-1.
DR   EnsemblGenomes-Tr; EBG00000036826-1.
DR   EnsemblGenomes-Tr; EBG00000036827-1.
DR   EnsemblGenomes-Tr; EBG00000036828-1.
DR   EnsemblGenomes-Tr; EBG00000036829-1.
DR   EnsemblGenomes-Tr; EBG00000036830-1.
DR   EnsemblGenomes-Tr; EBG00000036831-1.
DR   EnsemblGenomes-Tr; EBG00000036832-1.
DR   EnsemblGenomes-Tr; EBG00000036833-1.
DR   EnsemblGenomes-Tr; EBG00000036834-1.
DR   EnsemblGenomes-Tr; EBG00000036835-1.
DR   EnsemblGenomes-Tr; EBG00000036836-1.
DR   EnsemblGenomes-Tr; EBG00000036837-1.
DR   EnsemblGenomes-Tr; EBG00000036838-1.
DR   EnsemblGenomes-Tr; EBG00000036839-1.
DR   EnsemblGenomes-Tr; EBG00000036840-1.
DR   EnsemblGenomes-Tr; EBG00000036841-1.
DR   EnsemblGenomes-Tr; EBG00000036842-1.
DR   EnsemblGenomes-Tr; EBG00000036843-1.
DR   EnsemblGenomes-Tr; EBG00000036844-1.
DR   EnsemblGenomes-Tr; EBG00000036845-1.
DR   EnsemblGenomes-Tr; EBG00000036846-1.
DR   EnsemblGenomes-Tr; EBG00000036847-1.
DR   EnsemblGenomes-Tr; EBG00000036848-1.
DR   EnsemblGenomes-Tr; EBG00000036849-1.
DR   EnsemblGenomes-Tr; EBG00000036850-1.
DR   EnsemblGenomes-Tr; EBG00000036851-1.
DR   EnsemblGenomes-Tr; EBG00000036852-1.
DR   EnsemblGenomes-Tr; EBG00000036853-1.
DR   EnsemblGenomes-Tr; EBG00000036854-1.
DR   EnsemblGenomes-Tr; EBG00000036855-1.
DR   EnsemblGenomes-Tr; EBG00000036856-1.
DR   EnsemblGenomes-Tr; EBG00000036857-1.
DR   EnsemblGenomes-Tr; EBG00000036858-1.
DR   EnsemblGenomes-Tr; EBG00000036859-1.
DR   EnsemblGenomes-Tr; EBG00000036860-1.
DR   EnsemblGenomes-Tr; EBG00000036861-1.
DR   EnsemblGenomes-Tr; EBG00000036862-1.
DR   EnsemblGenomes-Tr; EBG00000036863-1.
DR   EnsemblGenomes-Tr; EBG00000036864-1.
DR   EnsemblGenomes-Tr; EBG00000036865-1.
DR   EnsemblGenomes-Tr; EBG00000036866-1.
DR   EnsemblGenomes-Tr; EBG00000036867-1.
DR   EnsemblGenomes-Tr; EBG00000036868-1.
DR   EnsemblGenomes-Tr; EBG00000036869-1.
DR   EnsemblGenomes-Tr; EBG00000036870-1.
DR   EnsemblGenomes-Tr; EBG00000036871-1.
DR   EnsemblGenomes-Tr; EBG00000036872-1.
DR   EnsemblGenomes-Tr; EBG00000036873-1.
DR   EnsemblGenomes-Tr; EBG00000036874-1.
DR   EnsemblGenomes-Tr; EBG00000036875-1.
DR   EnsemblGenomes-Tr; EBG00000036876-1.
DR   EnsemblGenomes-Tr; EBG00000036877-1.
DR   EnsemblGenomes-Tr; EBG00000036878-1.
DR   EnsemblGenomes-Tr; EBG00000036879-1.
DR   EnsemblGenomes-Tr; EBG00000036880-1.
DR   EnsemblGenomes-Tr; EBG00000036881-1.
DR   EnsemblGenomes-Tr; EBG00000036882-1.
DR   EnsemblGenomes-Tr; EBG00000036883-1.
DR   EnsemblGenomes-Tr; EBG00000036884-1.
DR   EnsemblGenomes-Tr; EBG00000036885-1.
DR   EnsemblGenomes-Tr; EBG00000036886-1.
DR   EnsemblGenomes-Tr; EBG00000036887-1.
DR   EnsemblGenomes-Tr; EBG00000036888-1.
DR   EnsemblGenomes-Tr; EBG00000036889-1.
DR   EnsemblGenomes-Tr; EBG00000036890-1.
DR   EnsemblGenomes-Tr; EBG00000036891-1.
DR   EnsemblGenomes-Tr; EBG00000036892-1.
DR   EnsemblGenomes-Tr; EBG00000036893-1.
DR   EnsemblGenomes-Tr; EBG00000036894-1.
DR   EnsemblGenomes-Tr; EBG00000036895-1.
DR   EnsemblGenomes-Tr; EBG00000036896-1.
DR   EnsemblGenomes-Tr; EBG00000036897-1.
DR   EnsemblGenomes-Tr; EBG00000036898-1.
DR   EnsemblGenomes-Tr; EBG00000036899-1.
DR   EnsemblGenomes-Tr; EBG00000036900-1.
DR   EnsemblGenomes-Tr; EBG00000036901-1.
DR   EnsemblGenomes-Tr; EBG00000036902-1.
DR   EnsemblGenomes-Tr; EBG00000622711-1.
DR   EnsemblGenomes-Tr; EBT00001628119.
DR   EnsemblGenomes-Tr; EBT00001628120.
DR   EnsemblGenomes-Tr; EBT00001628121.
DR   EnsemblGenomes-Tr; EBT00001628122.
DR   EnsemblGenomes-Tr; EBT00001628123.
DR   EnsemblGenomes-Tr; EBT00001628124.
DR   EnsemblGenomes-Tr; EBT00001628125.
DR   EnsemblGenomes-Tr; EBT00001628126.
DR   EnsemblGenomes-Tr; EBT00001628127.
DR   EnsemblGenomes-Tr; EBT00001628128.
DR   EnsemblGenomes-Tr; EBT00001628129.
DR   EnsemblGenomes-Tr; EBT00001628130.
DR   EnsemblGenomes-Tr; EBT00001628131.
DR   EnsemblGenomes-Tr; EBT00001628132.
DR   EnsemblGenomes-Tr; EBT00001628133.
DR   EnsemblGenomes-Tr; EBT00001628134.
DR   EnsemblGenomes-Tr; EBT00001628135.
DR   EnsemblGenomes-Tr; EBT00001628136.
DR   EnsemblGenomes-Tr; EBT00001628137.
DR   EnsemblGenomes-Tr; EBT00001628138.
DR   EnsemblGenomes-Tr; EBT00001628139.
DR   EnsemblGenomes-Tr; EBT00001628140.
DR   EnsemblGenomes-Tr; EBT00001628141.
DR   EnsemblGenomes-Tr; EBT00001628142.
DR   EnsemblGenomes-Tr; EBT00001628143.
DR   EnsemblGenomes-Tr; EBT00001628144.
DR   EnsemblGenomes-Tr; EBT00001628145.
DR   EnsemblGenomes-Tr; EBT00001628146.
DR   EnsemblGenomes-Tr; EBT00001628147.
DR   EnsemblGenomes-Tr; EBT00001628148.
DR   EnsemblGenomes-Tr; EBT00001628149.
DR   EnsemblGenomes-Tr; EBT00001628150.
DR   EnsemblGenomes-Tr; EBT00001628151.
DR   EnsemblGenomes-Tr; EBT00001628152.
DR   EnsemblGenomes-Tr; EBT00001628153.
DR   EnsemblGenomes-Tr; EBT00001628154.
DR   EnsemblGenomes-Tr; EBT00001628155.
DR   EnsemblGenomes-Tr; EBT00001628156.
DR   EnsemblGenomes-Tr; EBT00001628157.
DR   EnsemblGenomes-Tr; EBT00001628158.
DR   EnsemblGenomes-Tr; EBT00001628159.
DR   EnsemblGenomes-Tr; EBT00001628160.
DR   EnsemblGenomes-Tr; EBT00001628161.
DR   EnsemblGenomes-Tr; EBT00001628162.
DR   EnsemblGenomes-Tr; EBT00001628163.
DR   EnsemblGenomes-Tr; EBT00001628164.
DR   EnsemblGenomes-Tr; EBT00001628165.
DR   EnsemblGenomes-Tr; EBT00001628166.
DR   EnsemblGenomes-Tr; EBT00001628167.
DR   EnsemblGenomes-Tr; EBT00001628168.
DR   EnsemblGenomes-Tr; EBT00001628169.
DR   EnsemblGenomes-Tr; EBT00001628170.
DR   EnsemblGenomes-Tr; EBT00001628171.
DR   EnsemblGenomes-Tr; EBT00001628172.
DR   EnsemblGenomes-Tr; EBT00001628173.
DR   EnsemblGenomes-Tr; EBT00001628174.
DR   EnsemblGenomes-Tr; EBT00001628175.
DR   EnsemblGenomes-Tr; EBT00001628176.
DR   EnsemblGenomes-Tr; EBT00001628177.
DR   EnsemblGenomes-Tr; EBT00001628178.
DR   EnsemblGenomes-Tr; EBT00001628179.
DR   EnsemblGenomes-Tr; EBT00001628180.
DR   EnsemblGenomes-Tr; EBT00001628181.
DR   EnsemblGenomes-Tr; EBT00001628182.
DR   EnsemblGenomes-Tr; EBT00001628183.
DR   EnsemblGenomes-Tr; EBT00001628184.
DR   EnsemblGenomes-Tr; EBT00001628185.
DR   EnsemblGenomes-Tr; EBT00001628186.
DR   EnsemblGenomes-Tr; EBT00001628187.
DR   EnsemblGenomes-Tr; EBT00001628188.
DR   EnsemblGenomes-Tr; EBT00001628189.
DR   EnsemblGenomes-Tr; EBT00001628190.
DR   EnsemblGenomes-Tr; EBT00001628191.
DR   EnsemblGenomes-Tr; EBT00001628192.
DR   EnsemblGenomes-Tr; EBT00001628193.
DR   EnsemblGenomes-Tr; EBT00001628194.
DR   EnsemblGenomes-Tr; EBT00001628195.
DR   EnsemblGenomes-Tr; EBT00001628196.
DR   EnsemblGenomes-Tr; EBT00001628197.
DR   EnsemblGenomes-Tr; EBT00001628198.
DR   EnsemblGenomes-Tr; EBT00001628199.
DR   EnsemblGenomes-Tr; EBT00001628200.
DR   EnsemblGenomes-Tr; EBT00001628201.
DR   EnsemblGenomes-Tr; EBT00001628202.
DR   EnsemblGenomes-Tr; EBT00001628203.
DR   EnsemblGenomes-Tr; EBT00001628204.
DR   EnsemblGenomes-Tr; EBT00001628205.
DR   EnsemblGenomes-Tr; EBT00001628206.
DR   EnsemblGenomes-Tr; EBT00001628207.
DR   EnsemblGenomes-Tr; EBT00001628208.
DR   EnsemblGenomes-Tr; EBT00001628209.
DR   EnsemblGenomes-Tr; EBT00001628210.
DR   EnsemblGenomes-Tr; EBT00001628211.
DR   EnsemblGenomes-Tr; EBT00001628212.
DR   EnsemblGenomes-Tr; EBT00001628213.
DR   EnsemblGenomes-Tr; EBT00001628214.
DR   EnsemblGenomes-Tr; EBT00001628215.
DR   EnsemblGenomes-Tr; EBT00001628216.
DR   EnsemblGenomes-Tr; EBT00001628217.
DR   EnsemblGenomes-Tr; EBT00001628218.
DR   EnsemblGenomes-Tr; EBT00001628219.
DR   EnsemblGenomes-Tr; EBT00001628220.
DR   EnsemblGenomes-Tr; EBT00001628221.
DR   EnsemblGenomes-Tr; EBT00001628222.
DR   EnsemblGenomes-Tr; EBT00001628223.
DR   EnsemblGenomes-Tr; EBT00001628224.
DR   EnsemblGenomes-Tr; EBT00001628225.
DR   EnsemblGenomes-Tr; EBT00001628226.
DR   EnsemblGenomes-Tr; EBT00001628227.
DR   EnsemblGenomes-Tr; EBT00001628228.
DR   EnsemblGenomes-Tr; EBT00001628229.
DR   EnsemblGenomes-Tr; EBT00001628230.
DR   EnsemblGenomes-Tr; EBT00001628231.
DR   EnsemblGenomes-Tr; EBT00001628232.
DR   EnsemblGenomes-Tr; EBT00001628233.
DR   EnsemblGenomes-Tr; EBT00001628234.
DR   EnsemblGenomes-Tr; EBT00001628235.
DR   EnsemblGenomes-Tr; EBT00001628236.
DR   EnsemblGenomes-Tr; EBT00001628237.
DR   EnsemblGenomes-Tr; EBT00001628238.
DR   EnsemblGenomes-Tr; EBT00001628239.
DR   EnsemblGenomes-Tr; EBT00001628240.
DR   EnsemblGenomes-Tr; EBT00001628241.
DR   EnsemblGenomes-Tr; EBT00001628242.
DR   EnsemblGenomes-Tr; EBT00001628243.
DR   EnsemblGenomes-Tr; EBT00001628244.
DR   EnsemblGenomes-Tr; EBT00001628245.
DR   EnsemblGenomes-Tr; EBT00001628246.
DR   EnsemblGenomes-Tr; EBT00001628247.
DR   EnsemblGenomes-Tr; EBT00001628248.
DR   EnsemblGenomes-Tr; EBT00001628249.
DR   EnsemblGenomes-Tr; EBT00001628250.
DR   EnsemblGenomes-Tr; EBT00001628251.
DR   EnsemblGenomes-Tr; EBT00001628252.
DR   EnsemblGenomes-Tr; EBT00001628253.
DR   EnsemblGenomes-Tr; EBT00001628254.
DR   EnsemblGenomes-Tr; EBT00001628255.
DR   EnsemblGenomes-Tr; EBT00001628256.
DR   EnsemblGenomes-Tr; EBT00001628257.
DR   EnsemblGenomes-Tr; EBT00001628258.
DR   EnsemblGenomes-Tr; EBT00001628259.
DR   EnsemblGenomes-Tr; EBT00001628260.
DR   EnsemblGenomes-Tr; EBT00001628261.
DR   EnsemblGenomes-Tr; EBT00001628262.
DR   EnsemblGenomes-Tr; EBT00001628263.
DR   EnsemblGenomes-Tr; EBT00001628264.
DR   EnsemblGenomes-Tr; EBT00001628265.
DR   EnsemblGenomes-Tr; EBT00001628266.
DR   EnsemblGenomes-Tr; EBT00001628267.
DR   EnsemblGenomes-Tr; EBT00001628268.
DR   EnsemblGenomes-Tr; EBT00001628269.
DR   EnsemblGenomes-Tr; EBT00001628270.
DR   EnsemblGenomes-Tr; EBT00001628271.
DR   EnsemblGenomes-Tr; EBT00001628272.
DR   EnsemblGenomes-Tr; EBT00001628273.
DR   EnsemblGenomes-Tr; EBT00001628274.
DR   EnsemblGenomes-Tr; EBT00001628275.
DR   EnsemblGenomes-Tr; EBT00001628276.
DR   EnsemblGenomes-Tr; EBT00001628277.
DR   EnsemblGenomes-Tr; EBT00001628278.
DR   EnsemblGenomes-Tr; EBT00001628279.
DR   EuropePMC; PMC1064924; 15731039.
DR   EuropePMC; PMC1142405; 15933207.
DR   EuropePMC; PMC1195413; 16127079.
DR   EuropePMC; PMC1594942; 16988233.
DR   EuropePMC; PMC2228313; 17915007.
DR   EuropePMC; PMC2292876; 18227162.
DR   EuropePMC; PMC2553346; 18793444.
DR   EuropePMC; PMC2777879; 19860885.
DR   EuropePMC; PMC2807590; 19830476.
DR   EuropePMC; PMC2849579; 20107095.
DR   EuropePMC; PMC2925232; 20528940.
DR   EuropePMC; PMC3091676; 20863407.
DR   EuropePMC; PMC3133017; 21317338.
DR   EuropePMC; PMC3293253; 22212214.
DR   EuropePMC; PMC3360785; 22662170.
DR   EuropePMC; PMC3475379; 22791239.
DR   EuropePMC; PMC403799; 14656965.
DR   EuropePMC; PMC4627950; 26543262.
DR   EuropePMC; PMC4875751; 27206730.
DR   EuropePMC; PMC549560; 15698474.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00378; Qrr.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01456; VrrA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02100; tfoR.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02268; MtlS.
DR   SILVA-LSU; BA000037.
DR   SILVA-SSU; BA000037.
DR   StrainInfo; 379912; 0.
XX
CC   This sequence was determined by the Sequencing Core of the
CC   National Yang-Ming University Genome Research Center (YMGC;
CC   http://genome.ym.edu.tw)
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3354505
FT                   /organism="Vibrio vulnificus YJ016"
FT                   /chromosome="I"
FT                   /strain="YJ016"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:196600"
FT   CDS_pept        complement(353..787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0001"
FT                   /product="MioC protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92765"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92765"
FT                   /db_xref="GOA:Q7MQK7"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQK7"
FT                   /protein_id="BAC92765.1"
FT                   /translation="MIHIITGSTLGGAEYVGDHLSDLLQEAGFETTIHNHPQLNEIPNQ
FT                   GTWLIITSTHGAGEYPDNIQPFIHALQATPPKMSDVRYAVVAIGDSSYDTFCAAGLHAH
FT                   ALLTDIGASAITQCLTIDVLSHTVPEDAAEVWLKQHIEQF"
FT   CDS_pept        complement(835..2223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0002"
FT                   /product="thiophene and furan oxidation protein ThdF"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92766"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92766"
FT                   /db_xref="GOA:Q7MQK6"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQK6"
FT                   /protein_id="BAC92766.1"
FT                   /translation="MVVKTIGSFMTTDTIVAQATAPGRGGVGIIRVSGPQAAQVALEVT
FT                   GKTLKARYAEYLPFKAQDGSELDQGIALFFPNPHSFTGEDVLELQGHGGPVVMDMLIKR
FT                   ILTISGVRPARPGEFSERAFLNDKMDLTQAEAIADLIDASSEEAAKSALQSLQGQFSKR
FT                   IHTLVESLIHLRIYVEAAIDFPEEEIDFLADGKVAGDLQAIIDNLDAVRKEANQGAIMR
FT                   EGMKVVIAGRPNAGKSSLLNALSGKDSAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAG
FT                   LRDASDEVEKIGIERAWDEIRQADRVLFMVDGTTTDATDPKEIWPDFIDRLPEQIGITV
FT                   IRNKADQTQESLGICHVSQPTLIRLSAKTGQGVEALRNHLKECMGFSGNSEGGFMARRR
FT                   HLDALQRAAEHLLIGQEQLEGYMAGEILAEELRIAQQHLNEITGEFSSDDLLGRIFSSF
FT                   CIGK"
FT   CDS_pept        complement(2314..3933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0003"
FT                   /product="inner membrane protein, 60 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92767"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92767"
FT                   /db_xref="GOA:Q7MQK5"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQK5"
FT                   /protein_id="BAC92767.1"
FT                   /translation="MDSQRTLLVLLLALVSFLLFQQWQVAKNPAPQAVEQAQTSSTLPA
FT                   PSFADELDPAPAQQASAKLITVTTDVLTLSIDTVGGDVVAADLNQYSAELNSANAFELL
FT                   RDTQGHQFIAQSGLVGPQGIDLSSNNRPSYQVSADSFTLADDQNELRIPMTYQANGLEY
FT                   TKTFILKRGSYAIDVEFDVINKSGNNATLGMYAHLRQNLMDAGGSITMPTYRGGAYSTE
FT                   DTRYKKYSFEDMQDRNLSLTLTNGQGWAAMIQHYFAAAWIPRNEPGANLYTRVIGNMGD
FT                   IGVRMPNKTVADGDSAHFTATLWAGPKLQDQMAEVAPNLDLVVDYGWLWFIAKPLHWLL
FT                   SVIQSFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDRQR
FT                   MSQEMMELYKKEKVNPLGGCLPLILQMPIFIALYWALMESVELRHSPFILWIHDLSAQD
FT                   PYFILPLLMGGSMFLIQKMSPTTVTDPMQQKIMTFMPVMFTFFFLWFPSGLVLYWLVSN
FT                   IVTLIQQSLIYKALEKKGLHTK"
FT   CDS_pept        complement(4160..4516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0004"
FT                   /product="RNase P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92768"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92768"
FT                   /db_xref="GOA:Q7MQK4"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQK4"
FT                   /protein_id="BAC92768.1"
FT                   /translation="MNTYAFNRELRLLTPEHYQNVFQQAHRAGSPHFTIIARNNNLSHP
FT                   RLGLAVPKKQIKTAVGRNRFKRLARESFRNTQHQLPNKDFVVIAKKSAQDLSNEELFKL
FT                   FDKLWHRLSRPSRG"
FT   CDS_pept        complement(4530..4670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0005"
FT                   /product="ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92769"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92769"
FT                   /db_xref="GOA:Q7MQK3"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQK3"
FT                   /protein_id="BAC92769.1"
FT                   /translation="MATKRTFQPSVLKRKRTHGFRARMATKNGRKVINARRAKGRARLS
FT                   K"
FT   CDS_pept        complement(4898..5635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0006"
FT                   /product="ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92770"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92770"
FT                   /db_xref="GOA:Q7MQK2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQK2"
FT                   /protein_id="BAC92770.1"
FT                   /translation="MIKLDNIHKRFGDTEVLKGIDLTINQGEIIVIIGSSGTGKSTLLR
FT                   CVNFLEQADQGKITIDDISVDSQQHTKAEVLALRRRTGFVFQNYALFAHMTARQNIAEG
FT                   LITVRGWKKEDALKRAQQILDDIGLGEKGDSYPAALSGGQQQRVGIGRAMALQPELLLF
FT                   DEPTSALDPEWVGEVLSLMKKLANQHQTMLVVTHEMQFAREVADRVIFMAEGKIVEQGS
FT                   PQDIFGNPQDPRLQKFLRQVGME"
FT   CDS_pept        complement(5632..6342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0007"
FT                   /product="ABC-type amino acid transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92771"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92771"
FT                   /db_xref="GOA:Q7MQK1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQK1"
FT                   /protein_id="BAC92771.1"
FT                   /translation="MRFHLLFSLRVTGMGFDFNYMLELLPILLKYLGTTMEMAILGLVF
FT                   SLVLAVILANIRVFRVPILDPLSQLYISFFRGTPLLVQLFLLYYGLPQIFPIMVGLDAF
FT                   SAAVIGLTLHFAAYMAESIRAAIIGIDRSQMEASLSVGMTTSQAMRRVILPQATRVALP
FT                   SLMNYFIDMIKSTSLAFTLGVAEIMAKAQMEASSSFRFFEAFLAVALIYWGVVLVLTRV
FT                   QIWAENKLNKAYAR"
FT   CDS_pept        complement(6385..7137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0009"
FT                   /product="ABC-type amino acid transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92772"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92772"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQK0"
FT                   /protein_id="BAC92772.1"
FT                   /translation="MNNWIKASIAAIALSAATFQAVAEEVVKVGMSGRYFPFTFVKQDQ
FT                   LQGFEVDMWDEIGKRNGYKVEYVTANFSGLFGLLETGRIDTISNQITMTDARKAKYLFA
FT                   DPYVVDGAQITVRKGNDSIKGVADLAGKTVAVNLGSNFEQLLRDYDKDGKINIKTYDTG
FT                   IEHDVALGRADAFVMDRLSALELIKKTGLPLQLAGEPFETIANAWPFVNNERGVKLQGE
FT                   VNKALAEMRADGTVEQISIKWFGADITK"
FT   CDS_pept        6389..6661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0008"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92773"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92773"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQJ9"
FT                   /protein_id="BAC92773.1"
FT                   /translation="MVMSAPNHLIEICSTVPSARISARALLTSPCSFTPRSLFTNGHAL
FT                   AMVSNGSPANCSGKPVFLISSSADRRSITNASARPNATSCSMPVS"
FT   CDS_pept        7282..7404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0010"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92774"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92774"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQJ8"
FT                   /protein_id="BAC92774.1"
FT                   /translation="MGNHWARCIDPQKSSEIIVNNLDLIHWIVDQSLAILVINR"
FT   CDS_pept        7450..8856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0011"
FT                   /product="chromosomal DNA replication initiator DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92775"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92775"
FT                   /db_xref="GOA:Q7MQJ7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQJ7"
FT                   /protein_id="BAC92775.1"
FT                   /translation="MSSSLWLQCMQRLQEELPATEFSMWVRPLQAELNDNTLTLFAPNR
FT                   FVLDWVRDKYLNSINRLLQEYCGHDIPNLRFEVGSRPMAAPKPAPTRTPADVAAESSAP
FT                   AQLQARKPVHKTWDDDAQAIADINHRSNVNPKHKFNNFVEGKSNQLGLAAARQVADNPG
FT                   GAYNPLFLYGGTGLGKTHLLHAVGNAIVDNKPNAKVVYMHSERFVQDMVKALQNNAIEE
FT                   FKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVED
FT                   RLKSRFGWGLTVAIEPPELETRVAILMKKAEDHQIHLADEVAFFIAKRLRSNVRELEGA
FT                   LNRVIANANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKR
FT                   RSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKED
FT                   YSNLIRTLSS"
FT   CDS_pept        8917..10017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0012"
FT                   /product="DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92776"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92776"
FT                   /db_xref="GOA:Q7MQJ6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQJ6"
FT                   /protein_id="BAC92776.1"
FT                   /translation="MKFTIARSHFIKPLQQVSGALGGRPTLPILGNLLINVENGQLSMT
FT                   ATDLEVELISKVTLEGEFEAGSITVPSRKFLDICRGLPDDAVITFVLEGDRVQVRSGRS
FT                   RFSLATLPANDFPNIEDWQSEVEVSLTQGELRALIEKTQFSMANQDVRYYLNGMLFEID
FT                   GSTLRSVATDGHRMAVAQAPLSADFAQKQIIVPRKGVQELVKLLDTPEQPVTLQIGSSN
FT                   LRAEVNHFVFTSKLVDGRFPDYRRVLPQHTTKTLEASCDELRQAFSRAAILSNEKFRGV
FT                   RVNLAGSEMRITANNPEQEEAEEMLDVSFDGEAIEIGFNVSYVLDVLNTLRCEQVRISM
FT                   SDANASALVENVDDDSAMYVVMPIRL"
FT   CDS_pept        10027..11106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0013"
FT                   /product="Recombinational DNA repair ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92777"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92777"
FT                   /db_xref="GOA:Q7MQJ5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQJ5"
FT                   /protein_id="BAC92777.1"
FT                   /translation="MPLSRLIIQQFRNIKACDIALSPGFNFLIGPNGSGKTSVLEAIYL
FT                   LGHGRSFKSALTGRVIQNECDQLFVHGRFLNSDQFELPIGINKQRDGTTEVKIGGQSGQ
FT                   KLAQLAQVLPLQLIHPEGFDLLTDGPKHRRAFIDWGVFHTEPAFYDAWGRFKRLNKQRN
FT                   ALLKSAKSYQELSYWDKEMARLAELISQWRADYVAQMQSKAEQLCQEFLPEFHIQLKYY
FT                   RGWEKETPYQQILEENFERDQTLGYTVSGPNKADLRIKVNNTPVEDVLSRGQLKLMVCA
FT                   LRLAQGQHLTEKTGKQCVYLIDDFASELDSQRRKRLADCLKQTGAQVFVSSITENQISD
FT                   MRDDSGRLFNVEQGVIEQG"
FT   CDS_pept        11125..13542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0014"
FT                   /product="DNA gyrase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92778"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92778"
FT                   /db_xref="GOA:Q7MQJ4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQJ4"
FT                   /protein_id="BAC92778.1"
FT                   /translation="MSNNYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NSIDEALAGHCKDIVVTIHEDNSVSVSDDGRGIPTEMHPEENVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKVLLTIHRGGHTHSQTYRHGVPDAPLAIIGDTEKT
FT                   GTTVRFWPSAETFTNIEFHYDILAKRLRELSFLNSGVSIKLFDEREEDKKDHFMYEGGI
FT                   QAFVTHLNRNKTPIHEKVFHFNAEREDGIAVEVAMQWNDGFQENIYCFTNNIPQRDGGT
FT                   HLAGFRAALTRTLNSYMDKEGYSKKAKTATSGDDAREGLTAVVSVKVPDPKFSSQTKDK
FT                   LVSSEVKSAVESFMADKLNDFLAEHPSEAKTVCSKIIDAARAREAARKAREMTRRKGAL
FT                   DLAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHNIIIMTDADVDGSHIRTLLLTFFYR
FT                   QMPELIERGYVYIAQPPLYKVKKGKQEQYIKDEDAMNQYQISLALDNAALHVNPDAPAL
FT                   AGEALEKLVQQYNAAIKLVDRMSRRYPRALIHELIYVPRLSETQFADQAAMAAWTEQLV
FT                   TQLNAKEVGASQYSFEIEHDAERGLFSPKIVVRTHGVMHEYPLSVDLINSKEYQKLAEL
FT                   ADALDGLIEEGAYIQRGERTQPVNSFASALEWLIKESRRGLSLQRYKGLGEMNPDQLWE
FT                   TTMDPETRRMMRVTIEDAVGADELFTTLMGDQVEPRRNFIEENALKVANLDV"
FT   CDS_pept        13955..14389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0015"
FT                   /product="16 kDa heat shock protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92779"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92779"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQJ3"
FT                   /protein_id="BAC92779.1"
FT                   /translation="MRNVDFSPLYRNAIGFDRLFNLMEASAAKNSSGGYPPYNIEQKDE
FT                   HNYRITMAVAGFAEDQLDLTQNENMLIVKGERKAEEGKNYVYQGIAERDFERKFQLADY
FT                   VKVVGASMENGLLHIDLVREIPEAMQPRKIAIGGTKLLEN"
FT   CDS_pept        complement(14370..16631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0017"
FT                   /product="GGDEF family protein"
FT                   /note="with 3 transmembrane domains"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92780"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92780"
FT                   /db_xref="GOA:Q7MQJ2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQJ2"
FT                   /protein_id="BAC92780.1"
FT                   /translation="MKTGLLMFDEQIGFTFLLYFVWCAWMNTFLNIKHPLIATLLLFAS
FT                   ILSITLWIIHLVTDANLREKELLVSQVAMTQAKNLEKELHTALIASTQILAVEVIQNNG
FT                   NMENFEEYAQEIISLSEVISNLQLAPNGIIQSIYPLAGNEKAIGHNLLKDDARKKEALS
FT                   AVESGKLTLAGPFTLKQGGVGMVARRPVFLKLQDKSEFWGFVSALILLENLIASSDLQE
FT                   LQKDNLRFQLSRIHPDTNQVDVFYGESISQDWISSQVTIDVPNNQWTLIVGLPQSQQLF
FT                   ASALVQLAIALIVSGFASFCFFYYVTLPKKLQHAVEQKTFQLKKLANTDMLTGLDNRRK
FT                   FTDVLNQILQKPDALAHCHALLYLDIDNFKQINDQLGHYVGDQVLKVVAQRLCHHVSDA
FT                   QSITRISGDEFAVLLEYQEIDSLKARLSALIVALSQPSEHIPNSHRLTVSIGVVLIPQD
FT                   GQDLTLLMQHVDFAMYQAKSQGRNQYCFFDRLMKLRDDEKIQLIESLKIAIEQNQFVLH
FT                   YQPIYDIRSHQIHCYEALIRWQHPTKGLLFPASFIELAEQSGLINEIGDCVLAQACQFI
FT                   AQTAQEKPIVSINISASQLSDPQLFERFIGIIQQYGVDAHSLKFELTETTLMQNIQSCT
FT                   NILLKFKQLGIQIAIDDFGTGYSSLAVLKDVPANYLKIDKSFIDQINSNTGDQKVAQSI
FT                   ITLAHHLDMQVIAEGVEQIEQEELLAQFQCDFGQGYLFGRPAPVDSLLFNSTDINSRAV
FT                   "
FT   CDS_pept        15081..15242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0016"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92781"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92781"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQJ1"
FT                   /protein_id="BAC92781.1"
FT                   /translation="MKHKLILLNGDLQTFNELDFLIISELHEPIEKTILVATLALGLIH
FT                   RKIHVLHQ"
FT   CDS_pept        complement(16651..17907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0018"
FT                   /product="valine-pyruva_e aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92782"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92782"
FT                   /db_xref="GOA:Q7MQJ0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQJ0"
FT                   /protein_id="BAC92782.1"
FT                   /translation="MQFSKFGEKFNQYSGITQLMDDLNDGLRTPGAIMLGGGNPAAIPA
FT                   MLEYFHQASENMLSNGELLAALANYDGPQGKDVFVKALARLLKETYGWNISEKNISLTN
FT                   GSQSGFFYLFNLFAGQQPDGSHKKILLPLAPEYIGYADAGIDEDIFVSYRPEIELLDNG
FT                   LFKYHVDFEQLKVDESVAAICASRPTNPTGNVLTDEEIRKLDQLARDNQIPLIIDNAYG
FT                   LPFPNIIFEEVEPFWNENTILCMSLSKLGLPGVRCGIVIANEAVTQALTNMNGIISLAP
FT                   GSVGPALGHYMIEKKDLLHLSSEVIKPFYQQKSQRAVELLQAAMPDDRFRIHKPEGAIF
FT                   LWLWFDALPITTMELYQRLKARGVLIVPGEYFFIGQEDNWEHAHQCLRMNYVQDDELMQ
FT                   KGIAIIAEEVNRAYSERES"
FT   CDS_pept        18206..18568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0019"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92783"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92783"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQI9"
FT                   /protein_id="BAC92783.1"
FT                   /translation="MKMRKCLLLTMLAGLTACNTMNYQASAPTAAPELVAVLQDELKEI
FT                   QDLKVTDEGYIDYYVWVPEGYQWDTHAIKKGGYEWACEDMINALRQGFVVRMGFKGKGG
FT                   REEHYDFARCEQEATN"
FT   CDS_pept        complement(18651..20732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0020"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92784"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92784"
FT                   /db_xref="GOA:Q7MQI8"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQI8"
FT                   /protein_id="BAC92784.1"
FT                   /translation="MAKEFLIELGTEELPPTQLRTLAEAFAANFEAELKGAELTHEGVK
FT                   WYAAPRRLALKVTALAEHQADKIVEKRGPAVSAAFDAEGNATKAAQGWARGCGITVDQA
FT                   ERMITDKGEWLLFKQEVKGQPTADIVVELAAKALAGLPIAKPMRWGNKTTQFIRPVKTL
FT                   TMLMGSDLIQGEILGVASDRVIRGHRFMGEREFTIESAEQYPAILEERGKVMADYEMRK
FT                   AIILADAQKAAAAIGGIADLEDDLVEEVTSLVEWPVVLTAKFEEEFLKVPAEALVYTMK
FT                   GDQKYFPVYTEDKQLLPNFIFVSNIESKEPRYVIEGNEKVVRPRLADAEFFFNTDRKSK
FT                   LIDRLPMLENAIFQQQLGTIKDKTDRITELAGYIAEQIGADVEKSKRAGLLAKCDLMTS
FT                   MVFEFTDTQGVMGMHYARHDGEAEEVALALNEQYMPRFAGDDLPSNGVSAAVAMADKLD
FT                   TIVGIFGIGQAPKGSDPFALRRASLGVLRIIVEYGYNLDLVDLVAKAKSLFAQQDGTSR
FT                   LTNDNVEQEVIEFMLGRFRAWYQDEGFSVDIIQAVLARRPTKPADFDQRVKAVSHFREL
FT                   EAAEALAAANKRVGNILAKFDGELAAEIDLALLQEDAEKVLAENVEVMTEALEPAFATG
FT                   NYQEALSKLADLREPVDAFFDNVMVMADDEALKTNRLTLLNNLRNLFLQIADISLLQK"
FT   CDS_pept        complement(20746..21663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0021"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92785"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92785"
FT                   /db_xref="GOA:Q7MQI7"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQI7"
FT                   /protein_id="BAC92785.1"
FT                   /translation="MQKYDIKTFQGMILALQDYWAQNGCTIVQPLDMEVGAGTSHPMTC
FT                   LRALGPEPMSTAYVQPSRRPTDGRYGENPNRLQHYYQFQVALKPSPDNIQELYLGSLEV
FT                   LGIDPLVHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGIERLAMYIQEVDSVYDLTWNIAPDGSKVTYGDIFHQNEVEQSTYNFEHADVDFLFS
FT                   FFEQCEKECQQLLELEKPLPLPAYERILKAAHAFNLLDARKAISVTERQRYILRIRNLT
FT                   KSVAEAYYASREALGFPMCKKEQA"
FT   CDS_pept        22144..22698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0022"
FT                   /product="predicted membrane protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92786"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92786"
FT                   /db_xref="GOA:Q7MQI6"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQI6"
FT                   /protein_id="BAC92786.1"
FT                   /translation="MSVLAISITTVALAEIGDKTQLLSLLLASRYRKPIPIIAAIFFAT
FT                   IANHALAAWLGVVVADYLSPDVLKWVVVASFLAMAGWVLIPDKLDDEEEISNRGPFVAS
FT                   FIAFFIAEIGDKTQIATSILGAQYADALTWVVLGTTIGMLLANAPVVLIGKLSADKLPL
FT                   ALIRKVTAALFVALAAGAALF"
FT   CDS_pept        22858..23118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0023"
FT                   /product="NADH dehydrogenase subunit II-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92787"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92787"
FT                   /db_xref="GOA:Q7MQI5"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQI5"
FT                   /protein_id="BAC92787.1"
FT                   /translation="MLTRYMGMTPKSQSYLFTFGLALCLLAMVLTDMWLPIVAGSFILT
FT                   GLTVEAWIRVAHIIPMHEEMRSMKKQLNKLQSEIRTIEFDQ"
FT   CDS_pept        complement(23158..23403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0024"
FT                   /product="predicted redox protein"
FT                   /note="identified by Glimmer2"
FT                   /note="regulator of disulfide bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92788"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92788"
FT                   /db_xref="GOA:Q7MQI4"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQI4"
FT                   /protein_id="BAC92788.1"
FT                   /translation="MSFNPELATKTLEAEGLRCPEPVMMVRKTIRTMQDGEVLLVKADD
FT                   PSTTRDIPSFCRFMDHQLIAAQTDELPYQYLIKKGL"
FT   CDS_pept        23535..23720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92789"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92789"
FT                   /db_xref="GOA:Q7MQI3"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQI3"
FT                   /protein_id="BAC92789.1"
FT                   /translation="MLTALDRLTIYSVLCFISFCALVFRTPAETSLMPILGMSATIIGI
FT                   WIEMHRWSGASEEQEN"
FT   CDS_pept        23849..24814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0026"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92790"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92790"
FT                   /db_xref="GOA:Q7MQI2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQI2"
FT                   /protein_id="BAC92790.1"
FT                   /translation="MGVDRSFNVELEEIYRRDLNLLVALRVLIEESSVSKAAVRLNLSQ
FT                   SAMSRVLGRLRDLLGDPLFTREGQHLLPTEKALEIDRALGEPLESLRQLLSPSEFDPHL
FT                   CTQTFTIATTDYAMQTILPFALPRIYQEAPNVSFHFLPLQHDRLADQLTYEGADLAICR
FT                   PTGPVEPLRSEVLGRVGVLCLLSKQHPLAGKEMSLADYLYYPHAMIAISDGVKALIEQA
FT                   LVDQPQRKMVLRAYHLEAALAIVDTMPLIITVPADLAYLVAERYDLVVKALPFQFTPFD
FT                   YSMIWHPRCEHSPAQEWLRSVVREECSRLIAKRIEDMGLD"
FT   CDS_pept        complement(24886..25866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0027"
FT                   /product="Zn-binding alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92791"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92791"
FT                   /db_xref="GOA:Q7MQI1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQI1"
FT                   /protein_id="BAC92791.1"
FT                   /translation="MFHALVLNQEEKRTIATIEQMDESQLPEGNVLVAVDYSSLNFKDG
FT                   LAITGKGKIIRNFPMIPGIDLAGTVIESQDGRYQAGDQVVLTGWGVGENHWGGMAQRAR
FT                   LNADWLVPLPTGIDSKKAMMIGTAGFTAMLCVQALLDADIKPEAGEILVTGASGGVGSV
FT                   AVTLLAQLGYQVAAVTGRVEQNGPLLKQLGASRIIDRVEFEEPARPLEKQIWAGAIDTV
FT                   GSKVLAKVLAQMDYNSAVAACGLAGGFDLPTTVMPFILRNVRLQGIDSVMCPTEKRIAA
FT                   WEKLVALLPESYFEQACTEVELREAAKYAEDITNGQVTGRVVIKL"
FT   CDS_pept        complement(26027..27190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0028"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92792"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92792"
FT                   /db_xref="GOA:Q7MQI0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQI0"
FT                   /protein_id="BAC92792.1"
FT                   /translation="MKNVVIVDCLRTPMGRSKGGAFRHTRAEDLSAHLMKGILARNPQV
FT                   NPSEIEDIYWGCVQQTLEQGFNVARNAALLAGLPIEIGAVTVNRLCGSSMQALHDGARA
FT                   IMTGDAEICLIGGVEHMGHVPMNHGVDFHPGMSKHVAKAAGMMGLTAEMLGKLHGISRE
FT                   QQDEFAARSHARAHAATLEGRFKNEILPTEGHAADGTLFTLDHDEVIRPETTVEGLSQL
FT                   RPVFDPANGTVTAGTSSALSDGASAMLIMSEEKANELGVTIRARIKGMAIAGCDPSIMG
FT                   YGPVPATQKALKRAGLSIEDMDVIELNEAFAAQSLPCAKDLGLLDVMDEKVNLNGGAIA
FT                   LGHPLGCSGARISTTLINLMEAKDAKYGLATMCIGLGQGIATVFERP"
FT   CDS_pept        complement(27203..29374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0029"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92793"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92793"
FT                   /db_xref="GOA:Q7MQH9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQH9"
FT                   /protein_id="BAC92793.1"
FT                   /translation="MIYQAETLQVKEVQDGVAEILFCAQNSVNKLDLATLASLDKALDA
FT                   LTAHSGLKGVMLTSDKEAFIVGADITEFLGLFAKPEEELDQWLQFANSIFNKLEDLPVP
FT                   TVAVVKGHTLGGGCECVLATDLRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIGADSA
FT                   MEIITQGKACRAEEALKIGLLDAVVDSDRLYASALQTLTDAINEKIDWKARRQQKTSAL
FT                   TLSKLEAMMSFTMAKGLVAQVAGPHYPAPMTAVVTIEEGARFARNQALDIERKHFVKLA
FT                   KSEEAKALVGLFLNDQYIKGIAKKAAKSANKETQRAAVLGAGIMGGGIAYQSALKGVPV
FT                   IMKDIAQASLDLGMTEASKLLNKQLERGKIDGFKMAGILASITPSLHYAGIDNADIIVE
FT                   AVVENPKVKAAVLSEVEEQVSEETVLTSNTSTIPINLLAKSLKRPENFCGMHFFNPVHR
FT                   MPLVEIIRGEHTSDETINRVVAYAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRD
FT                   GADFTQIDKVMERKFGWPMGPAYLLDVVGIDTAHHAQAVMAQGFPERMGKQGRDAIDAL
FT                   FEANKYGQKNGSGFYTYTMDKKGKPKKAFSDEIVPILAPVCAAQQAFDDQTIIQRMMIP
FT                   MINEVVLCLQEGIIASAQEADMALVYGLGFPPFRGGVFRYLDSVGIANFVAMAQQHVEL
FT                   GAMYQVPQMLIDMAERGQTFYGAQQQGSI"
FT   CDS_pept        29622..30245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92794"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92794"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQH8"
FT                   /protein_id="BAC92794.1"
FT                   /translation="MNENPYLIPAQAIQFEEEIKKSLFITYLAHTPTIEAAKAFVERIK
FT                   TQHADARHNCWAFVAGRPEDSMKWGFSDDGEPSGTAGKPILAQLSGSGVGEITAVVTRY
FT                   YGGIRLGTGGLVKAYGGGVQQALKLLQTIEKKITTKLRLELDYAFVPIAQSIMQQFDAV
FT                   EVDAQYSESVVLVVELEVRNVEMFTQTMINKSSAKALVTPYIGK"
FT   CDS_pept        30291..31748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0031"
FT                   /product="Trk-type K+ transport system, membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92795"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92795"
FT                   /db_xref="GOA:Q7MQH7"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQH7"
FT                   /protein_id="BAC92795.1"
FT                   /translation="MQFRSIIRIVGLLLALFSVTMLAPALVALIYRDGAGVPFVTTFFV
FT                   LLFCGTVCWFPNRRHKHELKARDGFLIVVLFWTVLGSAGALPFLIADNPSISITDAFFE
FT                   SFSALTTTGATVIVGLDELPKAILFYRQILQWFGGMGIIVLAVAILPVLGIGGMQLYRA
FT                   EIPGPVKDSKMTPRIAETAKALWYIYLSLTIACAGAFWLAGMTPFDAISHSFSTIAIGG
FT                   FSTHDASMGYFDSYAINLITVIFLLISACNYSLHFAAFASGGVHPKYYWKDPEFRAFIF
FT                   IQALLFVICFLLLLAHHSYDSIYDAFDQALFQTVSISTTAGFTTTGFSDWPLFLPVLLL
FT                   FSSFIGGCAGSTGGGMKVIRILLLTLQGARELKRLVHPRAVYTIKVGGNALSQRVVDAV
FT                   WGFFSAYALVFVVCMLALIATGMDELTAFSAVAATLNNLGPGLGEVAVHFADVNDKAKW
FT                   VLVVSMLFGRLEIFTLLILLTPTFWRS"
FT   CDS_pept        31661..31792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0032"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92796"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92796"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQH6"
FT                   /protein_id="BAC92796.1"
FT                   /translation="MGFGGVYALWSFRNLYLTYIANPYVLAQLRRNDSESPISLFFP"
FT   CDS_pept        31755..32285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0033"
FT                   /product="protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92797"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92797"
FT                   /db_xref="GOA:Q7MQH5"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQH5"
FT                   /protein_id="BAC92797.1"
FT                   /translation="MIVKALFLYSSREGQTKKILQYIEEQLPSYQCDVKNLHDIDTVDF
FT                   SVYDKVLIGASIRYGHLNQKLYQFIQHNLTQLNEHKVAFFCVNLTARKEEQGKDTPEGS
FT                   AYIRTFLKKSPWQPNLIGVFAGALYYPRYNWFDRNMIKLIMTLTGGETDTSKEVEYTNW
FT                   KKVRQFSEKFARL"
FT   rRNA            32728..34262
FT                   /gene="rRNA-16Sa"
FT                   /product="16S ribosomal RNA"
FT   tRNA            34326..34402
FT                   /gene="tRNA-Ile-1"
FT                   /product="tRNA-Ile"
FT   tRNA            34413..34488
FT                   /gene="tRNA-Ala-1"
FT                   /product="tRNA-Ala"
FT   rRNA            34770..37657
FT                   /gene="rRNA-23Sa"
FT                   /product="23S ribosomal RNA"
FT   rRNA            37812..37929
FT                   /gene="rRNA-5Sa"
FT                   /product="5S ribosomal RNA"
FT   tRNA            38032..38122
FT                   /gene="tRNA-Ser-1"
FT                   /product="tRNA-Ser"
FT   CDS_pept        complement(38276..39199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0034"
FT                   /product="transcriptional activator IlvY"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92798"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92798"
FT                   /db_xref="GOA:Q7MQH4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQH4"
FT                   /protein_id="BAC92798.1"
FT                   /translation="MQIMQHGKTYTMNIKSLQLFIHLCDSKNFAKTAAAMHISPSALSR
FT                   QIQKLEEETSQQLFTRDNRSVEITPAGKKLMPVALKMLNEWQQYQLQNRYSETELKGEI
FT                   RLFCSVTASYSHLPELLSEFRLQHPFIEFKISTGDPAQAMDKILNGEADIAISAKPDTV
FT                   PAKVAFEPISEIPLSVIAPQGVSSFTDEMNRDKPNWSAIPYIVPEAGTARERANTWFKK
FT                   MKIKPNIYAQVSGHEAIVSMVALGCGIGIAPDVVINNSPVKEKIQRLKVAPIKPFELGV
FT                   CCIKSQLENPLIQALWKVAESKYIVI"
FT   CDS_pept        39308..40792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0035"
FT                   /product="ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92799"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92799"
FT                   /db_xref="GOA:Q7MQH3"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQH3"
FT                   /protein_id="BAC92799.1"
FT                   /translation="MANYFNTLNLREQLDQLGRCRFMDRSEFATEADYLKGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDVAYALRQAAIDEQRQSYKNAKENGFEVGSYETLIPQADLVVN
FT                   LTPDKQHTNVVETVMPLMKEGAALGYSHGFNVVEEGMQIRKDLTVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGEGWDIAKAWAAATGGHRAGCLESSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSIVCYEKMVAEGIDPGYAGKLLQYGWETITEALKFGGITHMMDRLSNPA
FT                   KIKAFELSEELKDLMRPLYNKHMDDIISGHFSSTMMADWANDDANLLGWRAETGETAFE
FT                   NYPSTDVEISEQEYFDNGILMVAMVRAGVELAFEAMTASGIIDESAYYESLHELPLIAN
FT                   TIARKRLYEMNVVISDTAEYGNYLFANVATPLLREKFMPSVGTDVIGKGLGETSNQVDN
FT                   ATLIAVNETIRNHPVEYIGEELRGYMTDMKRIAVGG"
FT   CDS_pept        complement(40988..41239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92800"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92800"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQH2"
FT                   /protein_id="BAC92800.1"
FT                   /translation="MFDPKKIEQIAKQIHDSMPQPVKDLGADVDQKIRQVIQGQLNKLD
FT                   VVSREEFDVQTQVLLRTRQKLSEMEKKLSELEAKLADK"
FT   CDS_pept        complement(41385..44504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0037"
FT                   /product="putative multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92801"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92801"
FT                   /db_xref="GOA:Q7MQH1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQH1"
FT                   /protein_id="BAC92801.1"
FT                   /translation="MRFTDVFIKRPVLAVSISFLIALLGLQAVFKMQVREYPEMTNTVV
FT                   TVTTSYYGASADLIQGFITQPLEQAVAQADNIDYMTSQSVLGKSTITVNMKLNTDPNAA
FT                   LADILAKTNSVRSQLPKEAEDPTVTMSTGSTTAVLYIGFTSDELSSSQITDYLERVINP
FT                   QLFTINGVSKVDLYGGLKYALRVWLDPAKMGALRLTATDVMGVLNANNYQSATGQVTGE
FT                   FVLYNGSADTQVSNVQELENLVVKSGDGEVIRLGDIAKVTLEKSHDVYRASANGQEAVV
FT                   AAINAAPSANPINIAADVLKLLPQLERNLPSNIKMNVMYDSTIAINESIHEVVKTIVEA
FT                   AVIVLVVITLFLGSFRAVIIPIVTIPLSLIGVAMVMQAMGFSWNLMTLLAMVLAIGLVV
FT                   DDAIVVLENVDRHIKEGESPFRAAIIGTREIAVPVIAMTLTLGAVYAPIALMGGITGSL
FT                   FKEFALTLAGSVFVSGIIALTLSPMMCSKMLKAHEKPSKFEEKVHHVLDGMTNRYEKML
FT                   KAVMDHRPVVIGFALIVFGTLPVLFKFIPSELAPSEDKGVVMLMGTGPSNANLDYLQNT
FT                   MNDVNKILSDQPEVEFAQVFTGVPNSNQAFGLATLKPWSQREASQAEITKRVGGLVSNV
FT                   PGMAVTAFQMPELPGAGSGLPIQFVITTPNSFESLYTIASDILTEVTSSPLFVYSDLDL
FT                   KYDSATMKIKIDKDKAGAYGVTMQDIGITLGTMMADGYVNRIDLNGRSYEVIPQVERKW
FT                   RLNPESMKNYYVRAADGKAVPLGSLITIDVIAEPRSLPHFNQLNSATVGAVPSPGTAMG
FT                   DAINWFENIASSKLPTGYNHDYMGEARQFVTEGSALYATFGLALAIIFLVLAIQFESIR
FT                   DPIVIMVSVPLAICGALIALAWGLATMNIYSQVGLITLVGLITKHGILICEVAKEEQLH
FT                   NKRSRIDAVMEAAKVRLRPILMTTAAMIAGLIPLMYATGAGAAQRFSIGIVIVAGLAIG
FT                   TLFTLFVLPVIYSYLAEKHKPLPVFVEDKDLEKLARVDEAKAAQRQIAEQ"
FT   CDS_pept        complement(44516..45622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0038"
FT                   /product="membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92802"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92802"
FT                   /db_xref="GOA:Q7MQH0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQH0"
FT                   /protein_id="BAC92802.1"
FT                   /translation="MKKWTFFMLLIAILLFGSVIGFNLFKQKKIAEYLANRPEPEFPVT
FT                   VTEVKPVDWVPVIEAIGFIEPNQGVTIANETSGVIKQIRFESGTQVKEGQPLVLLDSDV
FT                   EKANLKSSEAKLPAAEAKYKRYQGLFKKGSISKEAYDEAEANYYSLKADIESLKASIAR
FT                   REIKAPFSGVIGIRNVYLGQYLQAGSDIVRLEDTSVMRLRFTVPQNDISRINLGQEVDI
FT                   FVDAYPQNPFKGSITAIEPAVNIQSGLIQIQADIPNSDGKLRSGMFARANIILPKLEDQ
FT                   VTLPQTAITFTLYGDNVYILTEEDGVQRVKQHVVKVGERTGNIAHILDGVKVGDQVVTS
FT                   GQVRLSNDAKVRVVESDAITPPAETPML"
FT   CDS_pept        complement(45640..46221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0039"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92803"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92803"
FT                   /db_xref="GOA:Q7MQG9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQG9"
FT                   /protein_id="BAC92803.1"
FT                   /translation="MSSEEQNDKQQQILAAAEKLIAESGFQGLSMSKLAKEAGVAAGTI
FT                   YRYFDDKEHLLDELRLRITQRVATAIQANVTRDMPLKQQYRTMWLNTWNLAASNLSTLS
FT                   NRIQYESLPCSNSHKTRELEKKMFHQVALMFDMGKEQGVFKTLDNEILFGLSLETSVRL
FT                   AKKHALGFYQLDDKALDAAIDASWDAIINH"
FT   CDS_pept        46389..48407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0040"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92804"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92804"
FT                   /db_xref="GOA:Q7MQG8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQG8"
FT                   /protein_id="BAC92804.1"
FT                   /translation="MKLNPRQDEAVKYVSGPCLVLAGAGSGKTRVITNKIAYLVQQCGY
FT                   KARNIAAVTFTNKAAREMKERVGQTLGKGESKGLMVSTFHTLGLNIIKREYRHLGLKSG
FT                   FSLFDDQDQLALLKELTEKQLDGDKDLLRQLMSTISNWKNDMLSPEQAVARAQGEQQQL
FT                   FAFCFEMYQKQMKAYNALDFDDLILLPVLLLRGHDEVRHYWQNRIRYLLVDEYQDTNTS
FT                   QYELVKLLVGERGRLTVVGDDDQSIYSWRGAKPQNLVLLGQDYPNLRLIKLEQNYRSTS
FT                   RILRAANILIANNPHVYEKSLFSEIPDGEKLKVLLANNDEHEAERVTGEIIAHKFLNRT
FT                   DYRDYAILYRGNHQSRLIEKSLMQNRVPYRLSGGTSFFARAEIKDIMAYLRVLVNPDDD
FT                   NAFLRIVNTPKREIGPVTLEKLGSYANMRGKSLFEASFELGLEQHLTGRGLDNLRRFTH
FT                   WLVAIADQAERGDTVEAVRSLVRDIHYEDWLYETSASPKAAEMRMKNVSDLYSWIVADL
FT                   EGDNNDQEEKTLKEVVQRLTLRDMMERGEEDEDSDAVQLMTLHASKGLEFPYVYLIGTE
FT                   EGILPHQTSIDEDNVEEERRLMYVGITRAQRELTFVMCKERRQYGELIKPSQSRFLDEL
FT                   PFDDVEWEQTKKPVTQEERMAKGQAHIANLRAMFNKK"
FT   CDS_pept        complement(48469..48921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0041"
FT                   /product="cytochrome c5"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92805"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92805"
FT                   /db_xref="GOA:Q7MQG7"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQG7"
FT                   /protein_id="BAC92805.1"
FT                   /translation="MFGKPADLPWECKVSLMDMSRRMISVLFAALTFSTAAMATSTDHD
FT                   AIAERIKPVGDVYLAGSEPVKAEPTGPRDGATVYGTFCIACHSSGVNGAPKTGNAADWA
FT                   PRIAQGHDVLNKHAIEGFNAMPPRGTCMDCSDDEIIAAIDHMIKGL"
FT   tRNA            49176..49252
FT                   /gene="tRNA-Arg-1"
FT                   /product="tRNA-Arg"
FT   tRNA            49291..49366
FT                   /gene="tRNA-His-1"
FT                   /product="tRNA-His"
FT   tRNA            49393..49469
FT                   /gene="tRNA-Pro-1"
FT                   /product="tRNA-Pro"
FT   tRNA            49544..49619
FT                   /gene="tRNA-His-2"
FT                   /product="tRNA-His"
FT   tRNA            49644..49720
FT                   /gene="tRNA-Pro-2"
FT                   /product="tRNA-Pro"
FT   CDS_pept        complement(50663..50839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0042"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92806"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92806"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQG6"
FT                   /protein_id="BAC92806.1"
FT                   /translation="MIIQQTNESLLIAEYYSKNQVGTQFGKKHTKKQQLKFNGQQSVNF
FT                   KAKISNKYSLIDI"
FT   CDS_pept        50886..52601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0043"
FT                   /product="Peptide ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92807"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92807"
FT                   /db_xref="GOA:Q7MQG5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQG5"
FT                   /protein_id="BAC92807.1"
FT                   /translation="MSLLEVKNLRIEYPSRHGIHAAVKSLSFNIERGEIVGVVGESGAG
FT                   KSTVGNAVSDLLSPPGRIASGDVFLDGEKISGLSPEAMRKVRGSKIGFIFQDPMTSLNP
FT                   LFTVEQQLKETIHANMNVSDEEAYTRALSLMKQVGIPQPENRLKQYPHQFSGGMRQRVV
FT                   IAIALAGEPDLIIADEPTTALDVSIQDQILNLIRELCIKHNVGCMLVTHDMGVVSNVTD
FT                   RVAVMYRGDLVEFGPTAKVLGNPDHPYTRSLISAVPRSDRKLDRFPLVSYIEEASELQP
FT                   LDIKNHWLGQSEDQRKYTGPLLNVENVNLRFVTKDSLFESRREYVQASNNVSFQVHEGE
FT                   TFGLVGESGSGKSTIARVIAGLYAPNSGKVTFEGIDLTALTSEKARRPLRRQMQMVFQN
FT                   PYTSMNPRMKIFDIIAEPIRFHKLTNSEAETRQIVNDLLEHVGLGRMAGVKYPHEFSGG
FT                   QRQRISIARALATRPRLLICDEPTSALDVSVQAQILNLLKDLQSELNLTMLFISHDLPV
FT                   IRQMCDRVGVMQMGTLLEVAPTEQLFRSPQHEYSKHLISLMPEFTGLREEVKTA"
FT   CDS_pept        52677..54233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0044"
FT                   /product="Peptide ABC transporter, periplasmic
FT                   peptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92808"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92808"
FT                   /db_xref="GOA:Q7MQG4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQG4"
FT                   /protein_id="BAC92808.1"
FT                   /translation="MKTMKSKLTVALMAAGLSLSAAAADIKVAYDADPVSLDPHEQLSG
FT                   GTLQMSHMVFDPLVRYTQKLDFEPRLAEKWERVNDTTYRFQLRKGVKFHSGNELTADDV
FT                   VWTFDRLKDSPDFKAIFEPYEKMVKVDDYTVELVSKGAYPLVLQTATYIFPMDSKFYSG
FT                   TTADGKDKAEVVKHGNSFASTNVSGTGPFIVTSREQGVKVEFERFKDYWDKESKGNVDK
FT                   LTLVPIKEDATRVAALLSGGVDMIAPVAPNDHQRVKDAKGIDLVTLPGTRIITFQMNQN
FT                   SNEALKDVRVRQAIVHAINNQGIVDKIMKGFATAAGQQGPEGYAGYNAELVPRFDLKKA
FT                   KQLMKEAGYEKGFTLTMIAPNNRYVNDAKVAQAASAMLSKIGIKVDLKTMPKAQYWPEF
FT                   DKCAADMLMIGWHSDTEDSANFSEFLTMTRNEETGRGQYNCGHYSNPEVDKLVEAANVE
FT                   TDPAKRAAMLQKVETTLYNEAAFVPLHWQNLAWGAKSTLDIKPIVNAMDFPYFGDLVVK
FT                   E"
FT   CDS_pept        54385..55362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0045"
FT                   /product="peptide ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92809"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92809"
FT                   /db_xref="GOA:Q7MQG3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQG3"
FT                   /protein_id="BAC92809.1"
FT                   /translation="MFSFLVKRLFQALIVMFVISLVAFAIQDNLGDPLRELVGQSVSEA
FT                   ERQALRDELGLNDPFITKYTRFIGAALQGDLGTSYFFKRPAVDVILDKLVATLELVFGA
FT                   TVLIIVFSIPLGVYSAIHPKSFFTKVVMAGSSIGISIPVFLTAIMLMYVFSIELQWLPS
FT                   YGRGETYNLLGWESGFFTIDGLKHLVLPCIALASIMLPLFIRLVRSEMLEVLSSEYIKF
FT                   AKAKGLALNKIYYQHALKNTMLPVLTVGGVQIGTMVAYTILTETVFQWPGTGFLFLEAI
FT                   NRVDTPLITAYVIFVGLIFVVTNTIVDLLYGLINPTVNLTGKGA"
FT   CDS_pept        55365..56303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0046"
FT                   /product="peptide ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92810"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92810"
FT                   /db_xref="GOA:Q7MQG2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQG2"
FT                   /protein_id="BAC92810.1"
FT                   /translation="MEHVNKAPSAWERFKESDFLYYFKRDKVAMSSFAVFMLFLLLAIA
FT                   APLIAPSNPYDLSSIDIMDAELPPSWMEGGDENFVLGTDEQGRDILSTILYGSRLSLTI
FT                   GFLAVALQLFLGIVIGLSAGYFGGRIDNFLMRFADVQLSFSTMMVAIIVSAIFKASFGS
FT                   DFYSQYAVVMLVVIIGVAEWPQYARTIRASVLAEKKKEYVEAARVMGFRAPRIMFRHIL
FT                   PNCLSPILVISTVQVANAIMSEAALSFLGLGLPVDQPSLGALISIGFNYIFSGAWWITA
FT                   FPGIVLVTLVLVINLLGDWLRDVFNPKIYKG"
FT   CDS_pept        56374..56499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0047"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92811"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92811"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQG1"
FT                   /protein_id="BAC92811.1"
FT                   /translation="MLVIFYSPGRGKFLALQRVVGSSLSVTEQFIDETGRVKLWN"
FT   CDS_pept        56490..57434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92812"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92812"
FT                   /db_xref="GOA:Q7MQG0"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQG0"
FT                   /protein_id="BAC92812.1"
FT                   /translation="MELSKSARLPIFKPQRLWLMAALCFFGVATPAAAEGFLCEATQAS
FT                   TNELPMLDKACPIGDGVWGKKAPKSGKEDFFWIQCGILNQPMPLADAKPLYKQITTDVW
FT                   MKPENKTYRCLIGPYQSFAQASKDLKQVKKLGDYREAFIRVVKPHSAVKPVTASKEQKA
FT                   ITKPTAPKAQPKAPAAANKPMAAPAQATLATTPAKRSNDDSSSIDIRKSAELKGRTYAV
FT                   PYLMDDEHQFYMEHNQAWNRLDYGSAEVVCGDLHMRLLTEEEFFTLLDSKVMENQQWPM
FT                   QLPYWGRGKKGFFTDGRVTQVKGSSLLNVLCVK"
FT   CDS_pept        complement(57492..60218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0049"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92813"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92813"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF9"
FT                   /protein_id="BAC92813.1"
FT                   /translation="MKKVSLLAASVAIALTGCGGSDSGSGSNGNVAPGGIIVTGFDGYF
FT                   NQAVVFLDKDNNGKLDIGSDTIFGLTDKEGRRTIPAGTQGVLALQTLTPGGTVQTALTQ
FT                   YDADTYAGKYTIDMDHPTQAMAHEVVLRTLPGEKIISPLTDLVVVQAGANPTKEKIEEA
FT                   KAEVNETLGITGNIAFTDVIAAKNHALHKTAQILTESKVNAGVNYTAENAMKIAQEANK
FT                   IVTAPENQDKLDQPNFKPTVEVTPSGDVQVTVNNKLIVNKSVADNIRAQLNTPSTSHSL
FT                   DLTLDLAVGQDALFSDSDNNNIALDVQVIDPIDNQAVSGLIITANNGGSLTIKGELTPV
FT                   RQSYILQITGTDIDAEAAVVGKVSTLFTLTVETPNSAPTIVPKIAEDLQAWIGSIELTQ
FT                   GVAVTNEQYRIDNLFADADGDELIIDASSTIKELELSVIAVGGTKELKIAGTPTNTYPA
FT                   GETITISAFDGIERTSKSFVLKQVDAKPIASFEVNTNALANLQSEITSQLVDLKVNEPL
FT                   PSVQLSITLDDIFKAVNAHGPVEYFAGMKGENQDHNTSVAGIKVAVDNMGVLTISGTPL
FT                   EASTNGEFYIAAGIYPDAEDGVISEMKRIALPEVKAADTPPPVSLGFTKQHFNNQQWVM
FT                   GSFADRDGEIGYASLLNTNGTFEWCWGDQEREGYQVFKSNISDSNGAPDPINTLSTLNK
FT                   VSGYLESTNKDCWPVTLNNDGTLTAHHSDEGVDTNWNYEMLYQNSNNGHYQIIVKINNQ
FT                   ELFWLDSASTPLDQTLAVNTQIAEGKVEYYMSVEGDGQYHPELDGPKLSYSYGKREYQA
FT                   NNQYQDNSILPEGFDTPGIWQSVKDMDGLERAELEEEREDQKTRVRYVHRDFGDFYIGI
FT                   TWSKEVNGYESPAQYSLFSHNQEAMDKLVKAMPLMTN"
FT   CDS_pept        60471..61334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0050"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92814"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92814"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF8"
FT                   /protein_id="BAC92814.1"
FT                   /translation="MKQWARLITIGACLGSASAGAQATLDKSKYGYSYFTLGFENVVYE
FT                   ELFPGLDSDASVVSPVLNTGGLYHINTRFDFSIDALATFSPMSATEEWQKDGTLIQTNQ
FT                   FEYLKAATNILLHYKLQDNWRVLGGTSLTYQTYKRYGLKNHNGYVNDVFREGNTWEEKS
FT                   TDIFLDAGVAYDSGHLYGESDWRVSGRWIFGVPIWSVTENSRFEDIQFNDFGFRTNAEA
FT                   TLSYQIMPGLHLGWFVMLGYEKRFESDPQRVMYTTASGVEKQGQAWLPEAQTWTLNTGL
FT                   QALWNF"
FT   CDS_pept        complement(61356..62957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0051"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92815"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92815"
FT                   /db_xref="GOA:Q7MQF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF7"
FT                   /protein_id="BAC92815.1"
FT                   /translation="MAAITNGIIRIMTHRKPLFVVFAITFVTGMWFWLSSSQATSSVLS
FT                   EAETRVAAPHAKAISVESKVPNTATPTQNANLHVSPLFTQAAAILPSPPSEETGQTPTP
FT                   EEELEIALPSSASSTTVIVSDKELAKGVGANSKPRLNAEVARQIQSQIFGWELDQGAPI
FT                   HYALNIDQLFIDADDDFLTLTVRINVPGLKVRNLGTVQILGTATKAVAQPQLMIAARDD
FT                   HHGSDDQAWVKAYFDLPAIGETAAPFDHPLIGQTFYRLETTQTLAGIRYPYEVIYCQAW
FT                   KLINHQVYFAAARNRRQCPSDEELKLIGEFEQQDDKLILTSSQSAFDAKQTWMTRQSYP
FT                   SNLTEGLVNHLTTVHDGNQYETYTMVTDKAAMEARLNVETGRKLYEMTFFDYLFIDAEQ
FT                   NYLPAEVGNYIYERQAADPTVYQRFDSDLNIHRISGSFDCSTLLPYFELSVIAGRGDYE
FT                   DVISYSHNEDGVSSVACFVFPSGPNKRSLAINHDYRDDNDLQQGEIYSYILRPKPQFAH
FT                   LLEELKINLIYHHPQL"
FT   CDS_pept        complement(62933..63505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0052"
FT                   /product="putative RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92816"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92816"
FT                   /db_xref="GOA:Q7MQF6"
FT                   /db_xref="InterPro:IPR011517"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF6"
FT                   /protein_id="BAC92816.1"
FT                   /translation="MSAQSTSLTHIIQQWQAGDKEAESQLYQFAYLQLRKIAQQERERN
FT                   AEKYGLENEVLADSVNSTTALLHDAYLKLSTSDMSEISGKRDFFLMAAKVMRQILIDNA
FT                   RSLQAQKRQQVTQLPSEHQEKFEQLIIMDKALDNFSVRYPRQSNALKLKYLMGMKNQEI
FT                   SELLECSASLIEKDLKFSRSWLQSRMA"
FT   CDS_pept        complement(63502..64941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92817"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92817"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF5"
FT                   /protein_id="BAC92817.1"
FT                   /translation="MKLLHTLTLCLSLSAFYSQAATPKTGYFIDSPVTGLYYKTSSNLS
FT                   GTTHKGAFQYHPGDVVSFFLGNDDSGYLLTTLSGQEVITPTLASTKPSRSINMTRLLLS
FT                   LDSTPENRDEIVLLNKLLSDPKLQQQLQGLDLNFLDSSANQLDVELVSIKEAVEHLNQS
FT                   QRYIEQHFTSEEVIFSPLNVRLRNIIINKKDWQGRACALDLRHLDRPDYRTPVGVMSFE
FT                   VTHDSLIQYPSVGDYFNGCYLNRQHAYREKTVEPLSHFEQWEGVVGCASQGCTRHDLNG
FT                   FSLEDFDDEGDWKYRSVALNFDPQTQLLMGKMQGLGRKAQVAHSNKAESLWFTYPEAKG
FT                   QHIAYEGIWKETQYQEQTLTERCLNIVDGRVWLGPSNVSSCPLAASAYRQDVTQEYQDM
FT                   WWLRNASGHAQLEQMNVMVRWFPQPYPAQYTTWEYLPAGQNWDQGILYRYQQQVSPQRD
FT                   GSDRIDTYTISEFVKQQGEPS"
FT   CDS_pept        complement(64970..66304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92818"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92818"
FT                   /db_xref="GOA:Q7MQF4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF4"
FT                   /protein_id="BAC92818.1"
FT                   /translation="MQLGTSTTQVFYRLLDLNEEEKQQALQQLEQDAPEVYRALTPLMQ
FT                   PQESEPLTELLGFHAHHATDTSLDLAGQLIDKYQLTHELGRGGMGVVYAAYRADETFEQ
FT                   QLAIKFIQPSLTKVLGKKALFDEAQLLARLNHPCIAKVFDGGVYQDSVYIVMEQVDGVT
FT                   LDTYLKHHTLDQTAKLTLFLQLCQAVEHAHHNQVLHADLKPENILIDHAQRPKLLDFNL
FT                   TQKVSDQAKQQGKTGLVAFSEHYASPEQKSGGYLTQQSDLYSLGKILQLLFPHMKKRSD
FT                   LCFIAEKATQAIAEQRYLSVSELRVDIENMLACRPISLKQHIPLYTTKRLIQRRPMPTF
FT                   LLTLLVMTGVMFTSTLINKNRQLEQEKLIAEEMMYEVTRLMFHTKGNQLAQMSVSSMLE
FT                   ITRRRILSNPDIPKHIKQKMLLAMITPTPEKQVVEVDCQPNCQHP"
FT   CDS_pept        complement(66457..67254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92819"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92819"
FT                   /db_xref="GOA:Q7MQF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF3"
FT                   /protein_id="BAC92819.1"
FT                   /translation="MSFEFFDQSWDKELLLMLGINLGLLILLAWFVLLWLMLREFRKAM
FT                   RPASDTVTSDAASPATIAMCEESVNHAIDYSNENRDTLNALIQIQQALEKQVAEIRAAS
FT                   QNPSEHDLASIEALNQKLSKSQQLIRKLKGDLDKSVRGLRKAKAKLLEQNDTVDGLRKQ
FT                   KEDIEKQFEQLEREYIMISESGGFQDVEQGFQKEKDQLLATIENYKQQLANQASTSTSG
FT                   AASDELKQKLLAMQKQLMHVNKEKAFIEQKYLELTQKLENEDR"
FT   CDS_pept        67355..68251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0056"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92820"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92820"
FT                   /db_xref="GOA:Q7MQF2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF2"
FT                   /protein_id="BAC92820.1"
FT                   /translation="MKILIVDDSKATLEIVRKALLGFGYRRLSIEKTNCAREALEKMAH
FT                   WRPDIVLTDWHMPDMSGLELVQTVASRFPEVKIAMITTVDDDEQIAQAKAAGASFVLSK
FT                   PFDDDALHRKLLPLVQGAEESEKAFDELVEIQKELALPKLSQLEKLLRKVVHDEIALTN
FT                   IRLQQFDESKVPCMIAIYEDGETQKPRAVAVLDIYAVCVLASANAHITAEQLSQAIHKK
FT                   MVSKAILDTCQMVLDKSSLAFLDSLTRKSLRLKSVSFVPEAFDKLKVLFSKPADKRLDF
FT                   SCQLGEMAQGKITLVGF"
FT   CDS_pept        68267..69334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0057"
FT                   /product="gluconate utilization system Gnt-I
FT                   transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92821"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92821"
FT                   /db_xref="GOA:Q7MQF1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF1"
FT                   /protein_id="BAC92821.1"
FT                   /translation="MCEDRIGHNVTSNINDKNLFMAQHNKKPRTTLQDVADQVGVTKMT
FT                   VSRYMRNPDSVAEKTREKIATAIEQMGYIENRAPAMLSKSSSRAIGILLPSLSNQIFAS
FT                   FVQGIETVTKAHGYETLLAHFSYDELEEERKIASLLSYQVDGLILTESHHTERTLQMIK
FT                   NAGIPVVETMELPAQPIDMAVGLNHEDASYSVVKRMLASGKRTIVYFGARLDTRTKLRM
FT                   QGYDRAMREAGLEPKHVLTGEHSSFSLADELLERALVTYPEMDGVFCTNDDIAIGTLLC
FT                   AQQRGIEVPKQLAIVGYNALDIGQTIRPKLTSVDTPRFQIGEKSAELLLARLRGETLEQ
FT                   NVVDMGYRITAGESV"
FT   CDS_pept        complement(69026..69286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0058"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92822"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92822"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQF0"
FT                   /protein_id="BAC92822.1"
FT                   /translation="MFQRFTAQTGQQQLGTFLTNLKTRRIDTGQFRTNRLADIQGVVAH
FT                   NGQLLRHFNATLLRAQQGTDGDVIIGTKDPVHLWIRHQGTL"
FT   CDS_pept        complement(69385..71181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0059"
FT                   /product="phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92823"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92823"
FT                   /db_xref="GOA:Q7MQE9"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQE9"
FT                   /protein_id="BAC92823.1"
FT                   /translation="MTHPVILEVTQRLVERSQATRAAFVARTEEQAKAGKGRVGLSCGN
FT                   LAHAVAASCSAEKKNILDFTHANVALISAYNDMLSAHQPYQHYPEQIKRALAEYGHTAQ
FT                   VAGCVPAMCDGVTQGQAGMDMSLFSRDLIAQSTALSLSHNVFDATLLLGICDKIAPGQL
FT                   MGALAYAHLPTAFVPAGLMATGISNEEKVDVRQKYAAGEVGKDALLDMECRAYHSVGTC
FT                   TFYGTANTNQLVFEAMGLMLPGSAFIHPNSELRHALTEHAAIKMAAMTAGSAHFRSLAE
FT                   VVTEKSLINGIIALLASGGSTNHTIHMLAVARAAGIELTWQDISDLSDVVPLLARVYPN
FT                   GPADMNAFQQAGGVPALLHRLNESALLHRDVKPVFGEFDDQMSLPSLVDGKLVWTPCEG
FT                   TFDSHVIADKCCVFQSTGGTKVLTGNLGKAVVKVSAVKEDQRVIEAPALVFQCQHEVEA
FT                   AYQRGELNRDCIVVVTHNGPAANGMPELHKLMPILGNVQKAGFKVALVTDGRLSGASGK
FT                   IPSAIHVSPEAIRGGAIGLVRNGDVIRVDCQTGELNNLSDTTGRCVLEIDTEASQQTWG
FT                   RNLFSTLRQSVSSAEHGASFIV"
FT   CDS_pept        complement(71178..71699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0060"
FT                   /product="thermoresistant gluconokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92824"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92824"
FT                   /db_xref="GOA:Q7MQE8"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQE8"
FT                   /protein_id="BAC92824.1"
FT                   /translation="MAGSSVIVMGVCASGKTTIGELLAEKLGRKFIDGDDLHPRANIQK
FT                   MASGQPLNDHDRKPWLERIRDAAYSLESKNEHGIIVCSALKKSYRDQIRDGNNNVTFLF
FT                   LDGDKSLILERMRQRQGHFMKENMVNSQFETLERPDGEPRTLLVSIDTTIEDVVANAAE
FT                   LILEQDEAQA"
FT   CDS_pept        71813..73228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0061"
FT                   /product="putative gluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92825"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92825"
FT                   /db_xref="GOA:Q7MQE7"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQE7"
FT                   /protein_id="BAC92825.1"
FT                   /translation="MNHNTNNNSKGEIMEQLAHTPDPTYLLTIAALAIAALLVLIIKLK
FT                   VHAFASLTIVSLGTAIATGVTSDKVVPTMMGGFGGTLASVALLVGLGAMIGKILEVTGG
FT                   AKVLADTLIGRFGKDRAPFALGIASLLFGFPIFFDAGLVVMMPIIFSVAKRFGGSPIKY
FT                   ALPSAGAFAVMHAFVPPHPGPVAAAEFLGANIGLLLVVGILVAIPTWYLGAYLFGLYAG
FT                   KKFDIPLSKAFFNSDAIVDESKLPKFATVMIILVLPVLLICLDTGLNTLAVAGVIDGKT
FT                   ALVEFLRMLGKTPVALLITLIVCLVVFAKDYGMAKLEKLCGDSLAPICGVILVTGAGGM
FT                   FGGVLRASGIGNALADVLTDTGMPVIVAAFVISTCLRVAQGSATVALTTTAALIAPVVA
FT                   ATTGLSELDLCFIVIAIAGGATVLSHFNDSGFWLVSRLLEMDEKTTLKTWTVMETLLGG
FT                   IAFLIVAVLSFIL"
FT   CDS_pept        73238..73849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0062"
FT                   /product="2-keto-3-deoxy-6-phosphogluconate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92826"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92826"
FT                   /db_xref="GOA:Q7MQE6"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQE6"
FT                   /protein_id="BAC92826.1"
FT                   /translation="MTTLEQRLREIKIVPVIAINDVAHALPLAKVLVENGLPCAEVTFR
FT                   TEAAAESIRIMREAYPDLLIGAGTVLTTEQVDIAIEAGVDFIVSPGFNPTTVKYCQQRG
FT                   VTIVPGVNNPSLVEQAMEMGLRTLKFFPAEPSGGVNMLKALTAVYPVEFMPTGGVSPSN
FT                   VEDYLALKSVVACGGTWMVPTSMMDSGDWEGIAELVRAVK"
FT   CDS_pept        74322..74819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0063"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92827"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92827"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQE5"
FT                   /protein_id="BAC92827.1"
FT                   /translation="MIRTDPNGTSNKKINLALNRIVSIESQCVPILTNASFPLEQVPTE
FT                   IYTVAPRSFGSNRGARKYAGCDLYAKEGSRVFAMADGEISGRLADGVSIGAKIQQGQHI
FT                   AYVGKVVLKSGWTGEMLHLEIYDGSATGILRAPLSESPYQRRKDLINPTDIFNMAQKRL
FT                   PS"
FT   CDS_pept        74819..75349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0064"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92828"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92828"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQE4"
FT                   /protein_id="BAC92828.1"
FT                   /translation="MKLVFFLCGFALCFSQASFSKDNFLRNEYNLGEILDAIKFDANND
FT                   SIEDFILAANQITVENSDQTYVITSNLDEIQCKAHVNSDQKETKLLILHGQSREVHRLS
FT                   QAHLILPCVGDFHGVKYGMSFISQQALSKSLGYDLVSDPNQMLVVIPTEAGIDTYLYWT
FT                   GERYQLFYPPEEP"
FT   CDS_pept        complement(75517..76872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0065"
FT                   /product="glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92829"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92829"
FT                   /db_xref="GOA:Q7MQE3"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQE3"
FT                   /protein_id="BAC92829.1"
FT                   /translation="MATHFDYICIGGGSGGIASANRAAMYGAKVALIEAKDLGGTCVNV
FT                   GCVPKKVMWHGAQIAEAMSLYAPDYGFDVEVKGFDWSKLVESRQAYIGRIHQSYDRVLG
FT                   NNKVNVIKGFAKFVDEKTVEVNGEHYTADHILIAVGGRPTIPNIPGAEYGIDSNGFFDL
FT                   AEQPKRVAVVGAGYIAVEIAGVLNALGTETHLFCRKESPLRSFDPMIIDTLVEVMAAEG
FT                   PTLHTHSVPKEVVKEADGSLTLHLENGESQNVDQLIWAIGRHPATDAINLSATGVATNE
FT                   RGYIKVDEFQATNVAGIYCVGDIMEGGIELTPVAVKAGRQLSERLFNNKPNAKMDYDLV
FT                   PTVVFSHPPIGTIGLSEPEAIAQYGKENVKVYTSGFTAMYTAVTQHRQPCKMKLVCAGE
FT                   DEKVVGLHGIGFAVDEMIQGFGVAMKMGATKADFDSVVAIHPTGSEEFVTMR"
FT   CDS_pept        complement(77024..77863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92830"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92830"
FT                   /db_xref="GOA:Q7MQE2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQE2"
FT                   /protein_id="BAC92830.1"
FT                   /translation="MLSYRHSFHAGNHADVVKHIVQSLILDSLKQKDKPFVYHDTHSGV
FT                   GRYDLTHEWSEKTGEYKQGVARIWDRSDLPADIASYIDSIKALNNGDKLRYYPGSPRVA
FT                   RAQLRDQDRMVLTELHPSDYPLLEQEFHRDRQVSIYKEDGFQRLKASLPPQERRGLVLI
FT                   DPPYELAKEYRDVVQAIYQSHKRWATGIYAIWYPVVNRCDIDDMLEGLEGLGIRKILQI
FT                   ELGVSPDTNERGMTASGMIVINPPWKLESQMQQILPFLKEAIAPATGHWKVEWIVPE"
FT   CDS_pept        78071..80179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0067"
FT                   /product="Zn-dependent oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92831"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92831"
FT                   /db_xref="GOA:Q7MQE1"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQE1"
FT                   /protein_id="BAC92831.1"
FT                   /translation="MNKRAIDGQLATILKSQTKGIYMSNPLLTFTDLPPFSQIKPEHVF
FT                   PAVEQAIADCRAKIEQVLEGNNTPSWETVIAPIEEVDDRLSRIWSPVSHMNSVVNSDEL
FT                   RDAYESCLPMLSEYGTWVGQHKGLFEAYKAIKASEAFAKLTTAQQKTITDALRDFELSG
FT                   IGLPADEQKRYGEISKRMSELSSKFSNNTLDATMGWTKHITDEKELAGMPESALAAAKA
FT                   AAEAKELDGYLITLDVPSYLPVMTYCDNQALRREVYEAYVTRASDRGPNAGKWDNTEII
FT                   NEQLKLRHEIARMLGFNTYSEKSLATKMAENPAQVLGFLNDLATKAKPQGEREVAELRQ
FT                   FAEQEFGVSELNVWDIAYYSEKQKQHLFQISDEELRPYFPESKAVSGLFEVLKRVFGMS
FT                   VKEREGIDVWHNSVRFFDIFDAQGELRGSFYLDLYAREHKRGGAWMDECRVRRINAQGE
FT                   LQTPVAYLTCNFNRPIGDKPALFTHDEVVTLFHEFGHGIHHMLTQVTTGAVSGINGVPW
FT                   DAVELPSQFLENWCWEEEALAFISGHYETGEPLPKAMLEKMLAAKNFQSAMGILRQLEF
FT                   GLFDFTLHTEFDPEIGPRVLETLAQVKQKVAVLPAVEWARFSHSFGHIFAGGYCAGYYS
FT                   YLWAEVLSSDAFSRFEEEGIFNAETGQSFLNHILEMGGSEEPMELFKRFRGREPQIDAL
FT                   LRHSGIAA"
FT   CDS_pept        80227..80757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0068"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92832"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92832"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQE0"
FT                   /protein_id="BAC92832.1"
FT                   /translation="MFFCGTLSLLSQVKFCRDLSFCCGLRVDVAIDRVLQRNQRFGRLY
FT                   FVDRLQFVDQHKLQLFNRLTHQFDEDVVRARGVIRFHHFIQCVEFFQRGMIVARRIEVD
FT                   ADKTAHVVAEFFGVDHHFGTFNDLRRFHLFDAHVNGGRTDVELFSHLCIRRFRVRHQRF
FT                   QYSAIQIINLGIG"
FT   CDS_pept        complement(80299..80763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0069"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92833"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92833"
FT                   /db_xref="GOA:Q7MQD9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQD9"
FT                   /protein_id="BAC92833.1"
FT                   /translation="MHSANAKIDDLDRAILKTLMADAKTPYAEMAKQFNVSPATIHVRI
FT                   EKMKAAEIIEGTEVVVNTKKLGYDVCCFIGINLNAARDYHSALEKLNALDEVVEAYYTT
FT                   GAYNIFVKLMCKSIEELQFVLIDKLQAIDEVQSTETLISLQNPINRNVNP"
FT   CDS_pept        80872..84018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0070"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92834"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92834"
FT                   /db_xref="GOA:Q7MQD8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQD8"
FT                   /protein_id="BAC92834.1"
FT                   /translation="MRFCFSMLIMLCSFWASAHEKNILVVHSYHQGFFWTDSFQLGLAQ
FT                   TLGERDIALRVLYLDTKRNQSASFLNQLYFLYKTKVEQERFDAIVVSDNVALQLMQRLA
FT                   EPLAGTPVIFGGINNYTPEMHAGLNATGVIEDIDLLSNVSLIERLQPQAQQIFVVTDHS
FT                   ITGVALRAQVDKFLSRYPEYQQKVQHLVPNTVAELIERVQTLDLDSAVLFWAYYRDADG
FT                   TLSDDDDWQELNRVSRAPIYMVHDLGLGHGAVGGVIQSGYKQGFATGEVLNQVLDSPAS
FT                   PLPKVKVVEPDIKLDYQAVARWKLGVEGEPASVLVNKPEPFSVRYAQEIRLYSAVFVML
FT                   VLVIVLLVYYLRRIQQSETLARESQSMLESIFDQSLQYIGILDRNGCLVSSNAQLQDLL
FT                   FFQGVPLDRPLWQHQHWEDASATRLADYFSATEAQLSTFEAEIWSRNLGAMMLEVSLKP
FT                   LHSVGEQRGQYLFEARDITSRKLMEEKLYKRESNLRNYYEQQPVMMVTLDKNNRIQQVN
FT                   RFAQQLLGYQPLEMLGHLLQEFYCDAQAMTPRQMLLQPTPALQGVWRREIEYRHQDGSA
FT                   VWIRENIRPLTESGQILIVGEDISHNKQLARQLEYQAKYDLLTDTFNRNQFDIELKRAL
FT                   REVESHRRVHAMLYIDLDQLKVLNDTAGHDAGDGAIQFCASMLEEVLPHTAILARLGGD
FT                   EFAVLLKDSNEHTAIGVAKTIIATLSSQPFIWEKVQINLTCSIGIRMIDHTAESPQMVH
FT                   AQADTACHAAKEQGRNRFKLFSLDSEELQRRQQEMESVNLVHDALANDRLELFAQRIIP
FT                   LSKECDKMHFEILTRIRDKQGEYLSPAIFMPASERYNIAHLIDEQVVTKTLDWLEAHPD
FT                   ALHQLGRCSINLSGHSMGNPEFMAFLLDRLTNSVIPCHKLCLEITETAAMKNVALAMDF
FT                   FAQVKALGCLIALDDFGSGLSSFGYLKQLPVDVVKIDGIFVQDMHRNESDHIMVRAINE
FT                   LAQQMGKQTVAEFVENSEIIALLTELGVDYAQGYVIGYPTPLAELVAQWQDEFTSRSGS
FT                   "
FT   CDS_pept        84128..84907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0071"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92835"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92835"
FT                   /db_xref="GOA:Q7MQD7"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQD7"
FT                   /protein_id="BAC92835.1"
FT                   /translation="MQLQLICEDAALQPYLDAIASKWQLTHDAHSHFALVLTFERLELR
FT                   KLDEPKLGAIYVDLAGGAVAHRRKFGGGKGQAIAKAAGLNKGATPTVLDGTAGLGRDAF
FT                   VLASLGCKVQMVERNPVVAALLDDGLTRAKKDDEIGAWVSERMSLLHASSHDALAALAS
FT                   DAEFVHPDVVYLDPMYPHPENKKKTALVKKEMRVFQSLVGADTDADALLTPALALATKR
FT                   VVVKRPDYAEWLDGVKPSMAIETKKNRFDVYVNASMS"
FT   CDS_pept        85067..85558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0072"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92836"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92836"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQD6"
FT                   /protein_id="BAC92836.1"
FT                   /translation="MTKRFCKMDRREIASQLGEIHQLVAAPKYLCRSCARASSSKSSLC
FT                   KPQAIPSLKSKAKPMAVKAAALPEPIAEGQRPQTLLTAESVSAFDINLPSLGKKQLKQA
FT                   KQALKKQRKYHKKLAKLAKKKVKQLQKREKLEGKLNKYNGILRVLSHKQVLQGSADQVH
FT                   "
FT   CDS_pept        complement(85662..86552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0073"
FT                   /product="madN protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92837"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92837"
FT                   /db_xref="GOA:Q7MQD5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQD5"
FT                   /protein_id="BAC92837.1"
FT                   /translation="MFYLSAVTLLWAFSFSLIGVYLAGQVDSWFSVLMRVALASVVFVP
FT                   FLKFKGVSKRLIGKLMVVGGFQLGLMYCFYYQSFLLLSVPEVLLFTVFTPIYVTLIYDL
FT                   LHGRFSPWYLVTAIIAVLGAVFIKFATINPNFLLGFLVVQGANLCFAIGQVGYKYIMEK
FT                   EQLELPQHTVFGYFYLGALCVALVAFALMGNPSKLPTTELQWGILIYLGLIASGLGYFA
FT                   WNKGATLVNAGALAVMNNALVPAGLIVNIVIWNRDVDLLRLTLGGGGILFSLWLNETWV
FT                   KAKVERDFARKASQD"
FT   CDS_pept        complement(86618..87148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0075"
FT                   /product="universal stress protein UspA"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92838"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92838"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQD4"
FT                   /protein_id="BAC92838.1"
FT                   /translation="MLHGIGSEIPLAKNSSPKCYVLTIPEGENDKGEHTMSYQHILVAV
FT                   DLSDDSKLLIDKAVSLAKALEAKVSFIHIDVNYAELYTGLIDINMAEAQHQAMEASRTQ
FT                   LANLAEYANFPITHTLVGSGDLSNELCDTIGEYQVDLLVCGHHQDFWSKLLSSTRQLIN
FT                   CSPVDMLVVPLKE"
FT   CDS_pept        87100..87738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0074"
FT                   /product="ferritin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92839"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92839"
FT                   /db_xref="GOA:Q7MQD3"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQD3"
FT                   /protein_id="BAC92839.1"
FT                   /translation="MKSFLPKGSQIQSHVTKSYRIFRGIVAQNGYKQSGVLMLSQTMVE
FT                   QLNAQINLEFFSSNLYLQMSAWCEDKGFDGAAQFLRVHAVEEMQHMQRLFTYVSETGAL
FT                   PILGAIAAPKHDFASLGEVFRETYEHEQMITQQINKLAHVAFTSQDYSTFNFLQWYVAE
FT                   QHEEEKLFKGILDKIELVGEDGKALFFIDKDLAQMAKEGSSSIMDAPAA"
FT   CDS_pept        87825..88148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92840"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92840"
FT                   /db_xref="GOA:Q7MQD2"
FT                   /db_xref="InterPro:IPR019598"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQD2"
FT                   /protein_id="BAC92840.1"
FT                   /translation="MINGDIILFALMVVTGVNLARYLTALRSLIYIMREAHPLLYQQVD
FT                   GNGFFTTHGNVTKQVRLYHYLKSKEYHHHHDEVFTGKCDRVRELFVLSVSLTGVTLLAA
FT                   FLL"
FT   CDS_pept        88206..89438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0077"
FT                   /product="predicted flavoprotein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92841"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92841"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQD1"
FT                   /protein_id="BAC92841.1"
FT                   /translation="MPTAHPFLLSERFSSMSNKFDVVVIGAGAAGLMCAAEAGRRGRKV
FT                   LVLDHAKKPGRKILISGGGRCNFTNNEVSAKNYLCRNPHFVKSALSQYSNWDFISMIYK
FT                   YGIEFEERDHGQLFCLDSAKEIVNMLLSECDQPNIAQRYQVLLTEIEKTEQGFVLRAGA
FT                   EAFECQSLVVATGGLSMPKLGATPFGYKIAEQFGIPVVPTTAGLVPFTLHKQDKEDFAE
FT                   LSGIAIPAEITAEDGTLFKEALLFTHRGLSGPAVLQISSYWKAGQAVSINLVPEVDVLE
FT                   LLQRNLEKHPNQSMKNTLAKVLPKRLVEVLIERNELTDKPLKQYNGKELQEIVEYLEHW
FT                   KIAPNGTEGYRTAEVTLGGVDTDYLSSKTMECKTVPGLYFIGEVMDVTGWLGGYNFQWC
FT                   WSSGFVAGQWV"
FT   CDS_pept        complement(89512..90693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0078"
FT                   /product="uncharacterized enzyme of heme biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92842"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92842"
FT                   /db_xref="GOA:Q7MQD0"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQD0"
FT                   /protein_id="BAC92842.1"
FT                   /translation="MIRLIFLFVVLGAGLFVGTQFSGQQGYVLISIANTTIEMSVTTLV
FT                   IFIVAALAGLFGLEYLVKKVLYTGFTTWNWFSVRKMRRSRRYTNEGIIKLLEGDWKGAE
FT                   KKVTRWASHHDMPLLCYLVASEAADGQGDKAKRDHYLALAAEQENAYLAVELTRSKQLV
FT                   REGEFAQAFDSLQSLKGRYPNNPIVLNLLKTTYLELKLWQPLIDLLPTLNKQALISPED
FT                   AEQMHQRAQCGLLADVAGQQGSEGLIKHWNTLPRKVKQDPHLVACFAKQLIARKADHEA
FT                   LTVIKEALKKSPSPELYALLPQLNLSDVHPVIVMLEQNVKNDNHNAEAHSALAQLYFRE
FT                   GKWPQAQSHFETALKVRSSVSDYAFLADALEKQNLNKAAHEVSRKALTLIQSH"
FT   CDS_pept        complement(90690..91901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0079"
FT                   /product="uncharacterized enzyme of heme biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92843"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92843"
FT                   /db_xref="GOA:Q7MQC9"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQC9"
FT                   /protein_id="BAC92843.1"
FT                   /translation="MTSKKNNEPNKPEETTSQPITSDASTPETSNTESTASVSADEPTV
FT                   TPTTPPPAAAAKKEDKKPSQKLSILAIIIALLGTGGVAFQLQQQNSQYQAQIAALQNQL
FT                   QQTQSAMSTELNQVKQETVAKATEVTHKAEVVLAQQQKSIESLQLAMADVKGRRPNDWL
FT                   LAEADYLVKLAGRKLFLEHDVVSATSLMESADQRIAALNDPSLVPLRKAMAKDITDLKT
FT                   IPLIDRDGLVLRLTALQQQVDQLPLANAILPEAKTVEKQQVSDDINNWQNNLMASLKAF
FT                   SENFITFRTRDGNVIPLLSPEQHFYLKENIKAKIETAIKAVYQEQGEVYTTSLTTAEAW
FT                   SQAFFNQDNNTVKEFTQSLKQLSEQKIQVQYPVKLQTQNQLADVIRERLRREVTSMTST
FT                   EAQQ"
FT   CDS_pept        complement(91916..92698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0080"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92844"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92844"
FT                   /db_xref="GOA:Q7MQC8"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQC8"
FT                   /protein_id="BAC92844.1"
FT                   /translation="MRVPERSSPSCTKTTNNMAVLVTRPAEQGQALCQLLQQAGVPALQ
FT                   QPLIDIVANSSLNTLANDLKQSDVIIAVSQHAVQCAEHILKAQQQNWPQNALYLAVGQK
FT                   TAHYLSKVTHQDVNYPTVSDSEHLLQLPEFNRIAGKRVLILRGNGGRELIHQALSQRGA
FT                   DVRYCETYQRELIPFDAVSSLTLWRDQGVDTLIVTSAEQLDYLHAQMSDEGKFWLYQQR
FT                   LLVPSERIAAIANRLGFTQVCNVGSASNKDLLAALQPK"
FT   CDS_pept        complement(92649..93587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0081"
FT                   /product="porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92845"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92845"
FT                   /db_xref="GOA:Q7MQC7"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQC7"
FT                   /protein_id="BAC92845.1"
FT                   /translation="MTHSTPIRIATRKSPLALWQAYYVKDALQKAHPGLEVELVTMVTK
FT                   GDVILDTPLAKVGGKGLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICERED
FT                   PRDAFVSNTYHHVDELPQGAVVGTCSLRRQCQLKAYRPDLVIKELRGNVGTRLSKLDAG
FT                   EYDAIILAAAGLKRLELEERIRSFIEPEQSLPAVGQGAVGIECRTNDERILKLLEPLNH
FT                   ADTADRVKCERAMNLTLEGGCQVPIGSYALLEGDEIWLRALVGEPDGSEIVRGEIRGPR
FT                   AQAEQLGVQLANQLLDEGAREILTKLYQDHE"
FT   CDS_pept        93713..93880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0082"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92846"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92846"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQC6"
FT                   /protein_id="BAC92846.1"
FT                   /translation="MIGFSFGGWTIISYKDYKRHLAAEFEAVLCLSPMRFVVVKNAAHL
FT                   SLPTRMEVLN"
FT   CDS_pept        93951..96485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0083"
FT                   /product="adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92847"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92847"
FT                   /db_xref="GOA:Q7MQC5"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQC5"
FT                   /protein_id="BAC92847.1"
FT                   /translation="MQAYTEKLIQRLDTLNRQRIERALALMDLQSQQVFHLIPVLLHFN
FT                   HPAIPGYFDADVPFGVHGLKLNDIQQQFVDDTELTLGQSLPRAPHAQILGLYTMGSTSS
FT                   IGQSTSSDLDIWVCIPTQMGHDERESLANKCLLITDWAQMHGVEANFFLMDEDRFRSNR
FT                   SEEMTGDNCGSSQHMLLLDEFYRSAVRLAGQRLLWQIVPPEMEECYEQYVAELCNGGHI
FT                   NCNEWIDFGQLSRIPAEEYFGSNLWQLYKSIDSPYKSVLKAILLEAYSWEYPHTQLLSI
FT                   DSKRRFFAHEPDLYGMDAYYLMLEKVTRYLERINDHTRLDLVRRCFYLKTHEKLSREPG
FT                   VGSVAWRREALRELTSQWQWSQEVIVELDNRRNWKVEQVKVVHHALLDALMQSYRNLIQ
FT                   FARRNDITSAISPQDISILARKLYAAFEVLPGKVTLLNPQISPDLHEPDLSFIEVREGR
FT                   INKSGWYLYKQPLIAHRILGQPYLEHHEYLSKLVAWAFFNGLITESTRLHAVVREAQLD
FT                   IDKFYQMVSDLRNTFSLRKRRPTMQALASPCEISQLAMFINFENDPTAELSGRSLKVDL
FT                   KNADIFSFGTEQKCLIGSVDLVYRNSWHEVRTLHFRGETAMLDALKTVLGKMHQDAIPP
FT                   ESVDVFCYSKNLRGVMRNMVYQLLAECIDLRLKPVEQEKRRRFKAIRLAAQTFGLFFER
FT                   RGVSVQKLENSVDFYRSISTNKLKGSPLLMLDREDDYHLPPVVDGFASEGLIQFFFEDT
FT                   EKGFNIYVLDEANQVEVYHQFSGSKDEMIASVNSFYTAVKDDKHVASKCINFNLPQYYQ
FT                   IIHPQEEGQESYIIPYRNDACTQTKMSKAVNV"
FT   CDS_pept        complement(96618..96932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0085"
FT                   /product="frataxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92848"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92848"
FT                   /db_xref="GOA:Q7MQC4"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQC4"
FT                   /protein_id="BAC92848.1"
FT                   /translation="MNNTEFHQLVDNELQLIEEAIDESGADIDYETTGNVMTLEFDDRS
FT                   QIIINRQEPMQEIWLASKSGGFHFQYKAGQWICSKTGVEFAHMVKQECEKHAGESIDWA
FT                   "
FT   CDS_pept        96909..97124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0084"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92849"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92849"
FT                   /db_xref="GOA:Q7MQC3"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQC3"
FT                   /protein_id="BAC92849.1"
FT                   /translation="MMKFSIVHPIYPIAFPECGAIIGGIESIITICKMKKILTVLLTLS
FT                   VALLAGCGQSGALYIPDDAQQSEQSQ"
FT   CDS_pept        97173..98426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0086"
FT                   /product="diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92850"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92850"
FT                   /db_xref="GOA:Q7MQC2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQC2"
FT                   /protein_id="BAC92850.1"
FT                   /translation="MDYFNYQDDGQLWAEEVSLTSLAEQYGTPLYVYSRATLERHWHAF
FT                   DRSVEGHPHLVCYAVKANSNLGVLNTLARLGSGFDIVSGGELERVLAAGGDPRKVVFSG
FT                   VGKTEAEMRRALELNIKCFNVESEPELERLNRVAGELGVKAPISLRINPDVDAQTHPYI
FT                   STGLRDNKFGIAFDRAPAVYQFAQSLANLNVQGIDCHIGSQLTAIEPFIDATDRLLALI
FT                   DDLKEQGINIRHLDVGGGLGVVYRNELPPQPSEYAKALLGRLENHQDLELIFEPGRAIA
FT                   ANAGVLLTKVEFLKHTEHKNFAIIDAAMNDLMRPALYQAWQDIVPVQPRQGEAVTYDLV
FT                   GPICETGDFLGKDRSLVLAENDLLAVRSAGAYGFVMSSNYNTRARAAEVMVDGKQHYLV
FT                   RQREELRSLWELEHILPE"
FT   CDS_pept        98437..99267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0087"
FT                   /product="diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92851"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92851"
FT                   /db_xref="GOA:Q7MQC1"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQC1"
FT                   /protein_id="BAC92851.1"
FT                   /translation="MHFHFSKMHGLGNDFMVVDCITQNVYFSQELIRRLADRHTGVGFD
FT                   QLLVVEAPYDPETDFHYRIFNADGSEVEQCGNGARCFARFVRMKGLTNKYSISVSTKKG
FT                   KMILDVEEDDQITVNMGVPEFEPNKIPFRAKQKEKTYIMRVGEKTLFCGAVSMGNPHVV
FT                   TVVDDVDSAEVETLGPLLESHERFPERVNAGFMQVVNREQIRLRVYERGAGETQACGSG
FT                   ACGAVAVGILQGLLDENVTVSLPGGDLHIHWQGPGKPLYMTGPATHVFDGQLSC"
FT   CDS_pept        99310..100011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92852"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92852"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQC0"
FT                   /protein_id="BAC92852.1"
FT                   /translation="MSYPEADALTAEVVAEYLQDHADFFVHRPELVDRLNFPHPEQGTV
FT                   SLVHIQLNRQRQRIEALEEEITTLMSLAANNDRTFYEFMDLQEQILRCRDFQQVIKAIE
FT                   QKAHELGLVAYVRLLNQCEAKHQLSMENYQRFATNHLNGKSAYLGRLRNADREALFGDL
FT                   PVPEMGSYVVLPLVKQHPLGLLAFSSADGGHFQPEMDTLFLRHLSLVVAHLAQTLAWQL
FT                   QHDDSVKHTTA"
FT   CDS_pept        99962..100930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0089"
FT                   /product="site-specific recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92853"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92853"
FT                   /db_xref="GOA:Q7MQB9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQB9"
FT                   /protein_id="BAC92853.1"
FT                   /translation="MPGNCSMTTASNTPLPSGLRKPLDQFYEYLRAEKGLSLHTQRNYK
FT                   QQLETMAEHLHSMGLKAWPQVDAGWVRQLAGKGMREGMKASSIATRLSSLRSFFDFLIL
FT                   RGILTANPAKGVSAPRKKRPLPKNLDVDEVNQLLEVNEDDPLAIRDRAIMELMYGAGLR
FT                   LAELVDIDVRDVHLRSGEIRVIGKGNKERKVPFAGMAVEWVGKWLKVRSGLADPSEPAL
FT                   FVSKLGTRISHRSVQKRMAEWGQKQAVASHITPHKLRHSFATHILESSNNLRAVQELLG
FT                   HENISTTQIYTHLDFQHLADVYDQAHPRARKKSSQHKEEDE"
FT   CDS_pept        100927..101643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0090"
FT                   /product="predicted hydrolase"
FT                   /note="HAD superfamily"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92854"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92854"
FT                   /db_xref="GOA:Q7MQB8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQB8"
FT                   /protein_id="BAC92854.1"
FT                   /translation="MKHYRPLQPIAAMTFDLDDTLYDNRPVIERLEREVLAWLAAQHPA
FT                   TQVMSHSDWSQLKREVAASSPQLRSDVTQLRHQQLTQAFLRLGYDVAAAQQAADEGVAV
FT                   ALYWRSQLVVPSETHRVMRLLADKLPLVAITNGNVDVAAIGLDGYFQAILKAGPDGVAK
FT                   PASDLFQRAEQILQLPAQRILHVGDHLLSDVHGANLHGFMSCWINPKQINLRQQAKAKT
FT                   LPNLEINELSQLLLLL"
FT   CDS_pept        101773..104262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0091"
FT                   /product="GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92855"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92855"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQB7"
FT                   /protein_id="BAC92855.1"
FT                   /translation="MQTFSFWVEDLTQLQAMTADYRWDAHNTYLVQIFSTQTASITQGY
FT                   VRHLLAHLPNVDIIGHSTQHTIYGGEILTGGCLVVIAEFCHTTLTSAVVAYSGSADLDG
FT                   YDLCQALQLTPTSRAVISFSVQVERQDYPLYGAFNDGIATPVCGGLAQSGADGCWVLHQ
FT                   DQLYTQAAVAVALHSEQLKVWTSAYSEWNPVGMYHAVTAAEGQRLISLGNKPAYEVYKR
FT                   YLADGHELSASHLLNFPLYRERGKHKEVCAVREIHHDGSISFDKTWSIGDQVRFCYNHP
FT                   SLTLEQIKHGVVELALHQPETVFIYNCASRLDFIDGCQEVAPFHQITTSHGSYCMGELY
FT                   HDGLQQEILHHSLTYLAMRESDEVTELKLPADDVDSTISPLFCLIRNAIADLDQVQSRM
FT                   EYQLERQTLKLQESYRRDSRTGLQNRIALKEYLSAIRDDEHLLTLKLLNFSHINEKYGY
FT                   QVGDELLRMLSVSFLTRLRRRLGKQADMQLYSIGVGEWAFVFRAEICGETIKQQFTRFA
FT                   DVIEQTNFEPSGLEQVDYLSISLCGGLASRRDFPQASGDELLLKAIEARRAGVRSNTHI
FT                   CNAKDIQVSDERRKEQLAWLSCVSRAILQQNIVTYAQPLFHADGTTPYSQECLVRIVEN
FT                   DGRIILPGQFLPIIADTHLYTRLSRHMIQSTLNYMRERDGMFSINLSPQDLMSDKTMLL
FT                   LETAIRQLNDPSRIGLEVLESEQIKDYGRMIEVCSHFRQLGARIIVDDFGSGYSNIDEI
FT                   IKLEPDIIKLDGSLIRNIDQDSKQRKIASQLVRLCQVLEAKTVAEFVHNQQVCEIAQDM
FT                   GVDYLQGYYLGQPSRLF"
FT   CDS_pept        complement(104312..104917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92856"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92856"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQB6"
FT                   /protein_id="BAC92856.1"
FT                   /translation="MKPQACPQCGLRYQCLCDQFPSLQSEVALVLLMHPNEVERETNTG
FT                   KLLHWCRLPVRQFVWRRTAPPPALLDLLSDAQFMPVVLYPSEQSITLTQIKERAQQTQR
FT                   QPLFIILDATWQEARKMLNKSEWLKALPQLALHGDSASNYQLRRNQQQGNLCTLEIAAE
FT                   LVKQLGEAHNATSMTELLHHYLAAFHADRSGHALKSEP"
FT   CDS_pept        complement(104914..106464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0093"
FT                   /product="predicted membrane protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92857"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92857"
FT                   /db_xref="InterPro:IPR014540"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQB5"
FT                   /protein_id="BAC92857.1"
FT                   /translation="MKAFKNPVALSTLLLLQACSTSAPVATQSAPVLPTANLSQPESVV
FT                   AQSFMLSGSLVVGHEAQYITPCGSTQQYWLQLSAQQRQQLMALTSLPYQSMYGEVIGHL
FT                   KTTGDEGFASEYDALFVVEQLNLVDASNPTRCEQAARPTQAFGNEPNWRIDFAANQLTI
FT                   KQLSKQEQTRVISRSQLSPRKREYQFDDGQLLLTENLCKDTMSNSLYGWKATLDWQDTQ
FT                   LSGCATTSNIDATLGWGGLYTATSTQSSGFSVHMQLNADHSAETRYLYANEERPLVEKG
FT                   YWQQLNPNQIQVVMTHHQGQKLVTERIFTRTGSQLKADKEKVGKVVYPIAQGGLILYPA
FT                   AAGEMMSDAPITTQTAVPTDTRNVTSSAEFRRDVDQAIREYFRLHKTDPSNNQYRWLTY
FT                   DLNGDGKEELLAQLDWCGSGGCTLLIFENHQETWRFNSRITLVNTPIYLGNQRNHGWQD
FT                   LIFNVSGGGAKAQSHLMQYDGISYPLNPSVAPVALGEQISPVELFADGISPAREGVKL"
FT   CDS_pept        106494..106976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92858"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92858"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQB4"
FT                   /protein_id="BAC92858.1"
FT                   /translation="MDRIMAYWLFKTEPDTFSIDTLRVQKVSCWEGVRNYQARNMLRDE
FT                   VKEGDWVMIYHSSCKQVGVAGIAKVVREAYPDHFQFDANSDYYDAKSTPENPRWIMVDV
FT                   EFVRKTERVIPLAVLKAMPELENMPLVKKGNRLSVMPVTEQEWQAILTKEKLPSRR"
FT   CDS_pept        complement(107074..107904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0095"
FT                   /product="predicted hydrolase"
FT                   /note="HAD superfamily"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92859"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92859"
FT                   /db_xref="GOA:Q7MQB3"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQB3"
FT                   /protein_id="BAC92859.1"
FT                   /translation="MTASLPNKEITKIVASDLDGTLLAPNHQLSEFSKQTLKALHEQGY
FT                   TFIFATGRHHVDVAGIRAQVGIPAYMITSNGARVHDQHDQLMYSKNVPAELVQPVIDIV
FT                   KQDPEIFVHLYQNEDWRLNREDEVMRKFHEETGFTYKVYDIDNAPTDGIAKIFFTHPEQ
FT                   DHEHLVGFENQLREAFGDQLNIAFSTPWCLEVMAAEVSKGDALKAVAESLGLTLENCVA
FT                   FGDGMNDVEMLSMAGKGLVMETSHEKVKKALPDNEIIGSNADDAVAHYLQKHLL"
FT   CDS_pept        complement(108085..109083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0096"
FT                   /product="lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92860"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92860"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQB2"
FT                   /protein_id="BAC92860.1"
FT                   /translation="MVNNSSPLSYTQEALFEQAIGGPIAALWQQRQEGFLKTRDKMQLY
FT                   WCKLTNPQHKKAVLVVNGRIESAWKYQELLFDLYRQGYDVYSYDHRGQGLSDRLVKDSD
FT                   IGHVYEFDDYILDMEAVIAHFDFSPYQQRHIVSHSMGGAVATRYLQTHPQHGFDKLVLS
FT                   APMFGIDLPWYLSPVAMAVSQILTAVYPTPTYAPGHKSYYEKPFEDNPLSQSQARYQWF
FT                   RQLYRDKPELQVGGPSTRWVWQGLMAAKQCILLTRQLTIPVLLLQAGGDRIVSNQAQSQ
FT                   FFKKLHKTNKRSEMVTIEGAQHELLFEKDHYRNQALSAMFRFLQKEESNQA"
FT   CDS_pept        109141..109764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0097"
FT                   /product="putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92861"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92861"
FT                   /db_xref="GOA:Q7MQB1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQB1"
FT                   /protein_id="BAC92861.1"
FT                   /translation="MQMDTHVWLAYVVTAIVFSLAPGSGTVNSISNGLSYGTRKSLASI
FT                   VGLQIGLAVHIVLVGAGIGALVAQSATAFTVIKWVGAVYLVWLGIQKWRDTSSLATASQ
FT                   QHAISSTALLRKAVLINLTNPKSIVFLVALFPQFIDPSQDQVTQLAVLGITTVVIDAFV
FT                   MLGYTTLASQLGRFIRSEKVMGKINKVFGSMFMGCGALLAAAKS"
FT   CDS_pept        109818..111041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0098"
FT                   /product="predicted signal transduction protein"
FT                   /note="containing EAL and modified HD-GYP domains"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92862"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92862"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014408"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQB0"
FT                   /protein_id="BAC92862.1"
FT                   /translation="MNTTYVARQPIFNRKKHTLGYELLFRDGESNAYPVHIESNRATYR
FT                   LIVENFLSVGTNPAIASSRCFINFPYQTLIRRLPLSLPKNKVVIEVLETCQPTDELLDA
FT                   IRDLYREGYVIALDDFTLTPEWRRFLPYVHIVKLDVMDLGMEKACELVKEHLARRVKYH
FT                   FLAEKVETAEEFELAKEAGFKFFQGYFFSKPEVVQTRYVSPEQTVALELFREVCKSEPD
FT                   FGRIEQIISQDVALSYKLLRFVNTQSTRLEVTISSFRQALIYLGQDKLKMFVSLVVASY
FT                   VSTNKPRELYNLSLQRAQFCELMSRRHPFSKHNEQGFMIGLLSILDAMMDLSVESLVNH
FT                   LPLSEIAKQALLCRGGAYGALIALEECFEQADWRGIEQWCEQLGLSIEEVRYELVEAQR
FT                   WSQEFALI"
FT   CDS_pept        111148..111483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0099"
FT                   /product="predicted transcriptional regulator"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92863"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92863"
FT                   /db_xref="GOA:Q7MQA9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQA9"
FT                   /protein_id="BAC92863.1"
FT                   /translation="MLPHQFFKLLSDETRVRCLMLVAREGKICVGELTYALQESQPKVS
FT                   RHLAQLRASGLLVDERQGQWVFYRLSEQLPGWMKKMVDDLIASNCLKQVYQQDIARLHQ
FT                   QDRVACC"
FT   CDS_pept        111513..112514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0100"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92864"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92864"
FT                   /db_xref="GOA:Q7MQA8"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQA8"
FT                   /protein_id="BAC92864.1"
FT                   /translation="MTIKVGINGFGRIGRLAMRAAFDWPELEFVLINDVAGDATTLGHL
FT                   LEFDSVQGRWHHEVTVQGQQLHINGHVIETTQQRDISAVDWSGCDVVIEATGVHRKSRF
FT                   LNQYLEQGVKRVVVSAPVKEEGIANIVVGVNDEIFNPEQHRIVTAASCTTNCIAPVVKV
FT                   IHEKLGIEQASFTTIHDLTNTQTILDAPHKDLRRARACGMSLIPTTTGSATAIVEIFPE
FT                   LKDRINGHAVRVPLANASLTDIIFDVKRDTTAEEVNALLKEASQGELNGILGFEERPLV
FT                   SIDYRGDQRSTIVDALSTMVVGTRMVKIYAWYDNEMGYATRTAELVRKVGAA"
FT   CDS_pept        112514..113023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0101"
FT                   /product="predicted protein-tyrosine phosphatase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92865"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92865"
FT                   /db_xref="GOA:Q7MQA7"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR022778"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQA7"
FT                   /protein_id="BAC92865.1"
FT                   /translation="METSITNHPVWQLDLPSGALVLTPCPGTKGVDLRSSLQQLADIGV
FT                   QAVVTALGDAELASKEVAELGPLVVELGMRWYQIEIEDDCAPDETFAVHWQQASPELQA
FT                   ILRDGGKVALHCMGGSGRTGLFAAHLLLEQGWALDDIIREVQALRPGAFTREVQLSYIE
FT                   SVANAQ"
FT   CDS_pept        113088..114308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0102"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92866"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92866"
FT                   /db_xref="GOA:Q7MQA6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQA6"
FT                   /protein_id="BAC92866.1"
FT                   /translation="MMIAQLSKSVRQYMLVTFNYWNFTLTDGALRMLVVLYFHDLGYSA
FT                   LAIASLFLFYEFFGVVTNLIGGWLGARLGLNKTMNIGLAMQIIALLMLAVPAAWLTIPW
FT                   VMAAQALSGIAKDLNKMSAKSAIKTLVPDEQQGALFKWVAILTGSKNALKGAGFFLGGL
FT                   LLAVLGFQYAVLVMAGVLTLVLIGSLLSLESEMGKAKNKPKFNEIFSKSAPVNILSAAR
FT                   LFLFGARDVWFVVALPVYLGSVFGWDHLWVGGFLALWVMGYGVVQGIAPRITGKAQGRV
FT                   PDGHSAFYWAALLALLTGVIAYAVQQAWHPQQVIVIGLLLFGAVFAINSSLHSYLIVSY
FT                   AKGDGVSLDVGFYYMANAMGRLIGTLLSGWIYQEFGLAACLWVSCFFLALTTLISIKLP
FT                   RFAAKTA"
FT   CDS_pept        114408..115421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92867"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92867"
FT                   /db_xref="GOA:Q7MQA5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQA5"
FT                   /protein_id="BAC92867.1"
FT                   /translation="MRERVQFFDLLRCVAAVAVIAIHVLAPYRHELGVIPFDQWVTAVG
FT                   INGISRWAVPVFILITGALMLSDTRPFDLPYYARRRLGKVLIPFLFWSLFYALLSGLSA
FT                   SGFDSSKVTEVLSNSPEHATYYHLGFFYYFIPLYFVIPMFQWLVRQQRQDILYLFTALW
FT                   LFTTVLYLAGIDGPWSYELWLYSGYLPLGYLLFSKVPNQRSVVVGSVLLGGMALAATVI
FT                   MVVSNSLAAGEYTVGRWLSYKTINVVLAASMVFVLCRSVGERLSAQWQKWVALISRHSL
FT                   GIYLLHPIFLWPMKELGWYQGHPAWVIPLWVVLSGAGALALSYLFSLSAKTRWLLP"
FT   CDS_pept        complement(115418..115912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92868"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92868"
FT                   /db_xref="GOA:Q7MQA4"
FT                   /db_xref="InterPro:IPR019635"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQA4"
FT                   /protein_id="BAC92868.1"
FT                   /translation="MSRIDSKLCSHTHIECDMRRKFYRLLSLDHDSLLATPCLATRFCK
FT                   MRLSFRLEVIMPISFVFAVLALIAIGGWLFVRFYRTHIQGNNAPEQKVQVTVLDKQVIP
FT                   IADAQPGEDDQEYWIYVQRGALGPKREFQVGVHYFHALNPGDKGELTYKGDKFLHFALK
FT                   R"
FT   CDS_pept        115950..116351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92869"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92869"
FT                   /db_xref="GOA:Q7MQA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQA3"
FT                   /protein_id="BAC92869.1"
FT                   /translation="MKQTLERKEGTMSEIEQVVTRTRRLETLLRTQYHAEGKGLHQLVT
FT                   SCEERLPHDVIGKLRFIATVRNKVVHEDNYQLDDKQRFLAACDECEKELTPRSGRFIWR
FT                   VAILLMLSMTLGAMAFYYANWDVLSQHFK"
FT   CDS_pept        116846..116980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0106"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92870"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92870"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQA2"
FT                   /protein_id="BAC92870.1"
FT                   /translation="MSGVGGSYCSFGLIVVFFDGADLKFKKVNRGCMGDLSLDEKTMM"
FT   CDS_pept        117383..118003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0107"
FT                   /product="predicted membrane protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92871"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92871"
FT                   /db_xref="GOA:Q7MQA1"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQA1"
FT                   /protein_id="BAC92871.1"
FT                   /translation="MWSWLAIGLSGMTSVLGARQASPFQSLFFKVFTLVLLLILVLTQG
FT                   PDSGHSYWIAAGLLVSIFADTLHSLKSKKTLYFSGFLLAQLCYSKSFWLQLNGDIVWWL
FT                   LALLLAASIVAFFLLLPQLDSLVFPVVIMGIMLVQLAWAAGEVWLQASNFSNAIGFTGT
FT                   LVMIYSALAYAIHGYRKPMKRAYVWVSGSYFVAHALIVASIIY"
FT   CDS_pept        118080..118301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0108"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92872"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92872"
FT                   /db_xref="InterPro:IPR019620"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQA0"
FT                   /protein_id="BAC92872.1"
FT                   /translation="MNDIHAHNLLHLLKEQPMDRAELLAHFGGDTRFHTCKLQGLDLDS
FT                   LLSFLLEREKISEQQGKFCVNLARICNH"
FT   CDS_pept        118370..119086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0109"
FT                   /product="multiple antibiotic transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92873"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92873"
FT                   /db_xref="GOA:Q7MQ99"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ99"
FT                   /protein_id="BAC92873.1"
FT                   /translation="MITAILIKSFCLPASLSAFVRACLPTPFGIYSRHCCILRAPMDIL
FT                   AAATMLFLIMDPLGNLPIVLSILKHIDAKRRRKVLIRELLFALLILMLFLFAGQSIMKF
FT                   LQVEPETLSISGGIILFIIAIKMIFPSAGSITGLAAGEEPFIVPMAIPMIAGPSVIAAL
FT                   LLLSSQHPNNLTDLSIAVLIAWFATFIILMFYSFFHRILGERGLKAVERLMGLLLVMIS
FT                   TQMFLNGVKSYMGAVS"
FT   CDS_pept        complement(119152..119418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0110"
FT                   /product="predicted membrane protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92874"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92874"
FT                   /db_xref="GOA:Q7MQ98"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ98"
FT                   /protein_id="BAC92874.1"
FT                   /translation="MKALLFLAKAAISFVWLILLFNIFSPFPGNAAIVLYIMTAFLFIM
FT                   HGLQMLIFVGAFGDKITMTRWEKNSILIFGIFALLDIRRKYMM"
FT   CDS_pept        complement(119437..120030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0111"
FT                   /product="N6-adenine-specific methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92875"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92875"
FT                   /db_xref="GOA:Q7MQ97"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ97"
FT                   /protein_id="BAC92875.1"
FT                   /translation="MVRRRQQNTSQNKPTTGCVRIISGLWRGRKLPVHDAEGLRPTTDR
FT                   VKETLFNWLAQDIPRARCLDLFAGSGGLGFEAASRQAEQVTMLELNPKAFAQLQQNVTA
FT                   LKANNIKVIQGDALQFLKQQGTPHHVVFIDPPFRQGLLAEAVTLLEQNGWLAEDAMIYI
FT                   ETEKELQVEALPASWHLHREKTAGQVSYRLYERQ"
FT   CDS_pept        120110..121423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0112"
FT                   /product="signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92876"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92876"
FT                   /db_xref="GOA:Q7MQ96"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ96"
FT                   /protein_id="BAC92876.1"
FT                   /translation="MTKCTIIPPRKTDHMRIPVAIVSLPAHQQRFNPVYKKPGYLPMTE
FT                   KKKRGLLSWLGFGDDDQVKQPEPAQSEEVISESDEKTVESVEPIASQEVVEEAAAEPIS
FT                   EPAAEEPVEATPVVVEAPRVQEQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKID
FT                   DDLFEELEEQLLVADVGMDTTLKIIENLTEKASRRDLKDGEALYGLLKEEMAEILSKVE
FT                   QPLQVDSSKTPYVILMVGVNGVGKTTTIGKLAKQFQNQGKKVMLAAGDTFRAAAVEQLQ
FT                   VWGERNNVPVIAQHTGADSASVIYDAIEAAKARGVDVVIADTAGRLQNKSNLMEELRKI
FT                   VRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFA
FT                   IADQFNIPIRYIGVGEGIEDLRPFETQEFIDALFSREE"
FT   CDS_pept        121444..122121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0113"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92877"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92877"
FT                   /db_xref="GOA:Q7MQ95"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ95"
FT                   /protein_id="BAC92877.1"
FT                   /translation="MIRFQQVSKAYRGGRQALQKVDFHLRRGEMAFLGGHSGAGKSTLL
FT                   KLICAIERPTDGRISFNGHDITRIPNKDVPFLRRNIGIVFQDHRLLMDRSVYDNVALPM
FT                   RIESISENEIKRRVSAALDKTGLLDKARCLPSQLSGGEQQRVGIARAVVNRPTLLLADE
FT                   PTGNLDPELSNRVLRLFEEFNRAGVTILLATHDINLVNSRPQYRHFELNQGFLSEVEDY
FT                   GRE"
FT   CDS_pept        122108..123076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0114"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92878"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92878"
FT                   /db_xref="GOA:Q7MQ94"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ94"
FT                   /protein_id="BAC92878.1"
FT                   /translation="MAANKRLKKPASKSTSNRPKTDGFVSIHIKQAKASFKAIWHRPLG
FT                   NILTLAVISMALAMPACLYLLGKNIAVATSHVTSPAQVSAYLREGVPEARVMVLKDELE
FT                   TQQDVELVEYISPQQGLEHLSQYSGFDQALSLLEDYALPGVLVITPAVEENNAIKALAQ
FT                   QLRQEEDITDVRLDEDWLTRLDAIKTVATIIVMTLTLLMLGAVFLIVGNTLRFNVLANK
FT                   EEIQTMKLIGATDNFILRPYLYSGMWFGLLGAVSAWCFTALITVLLNGAVADLAALYDS
FT                   QFRLIGLSWDESLLLVMTGTFLGCVAAKVSAQRHLKEIEPV"
FT   CDS_pept        123253..124110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0115"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92879"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92879"
FT                   /db_xref="GOA:Q7MQ93"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ93"
FT                   /protein_id="BAC92879.1"
FT                   /translation="MTTQAYPMALVTQDSLDGYIRSVNSYPMLTADEERDLAERLHYKG
FT                   EIEAAKGLILSHLRFVVHVARGYSGYGLPMADLVQEGNIGLMKAVKRFNPEVGVRLVSF
FT                   AVHWIKAEIHEYVLRNWRIVKIATTKAQRKLFFNLRKSKKRLGWFNNGEVETVARELGV
FT                   EPAEVREMESRLAAVDSTFDLPNEEDDSSSVSTAPVLYLEDKSSDVADNLEAQNWEAHT
FT                   NNRLAMALASLDERSQHIVRSRWLDDDKATLQDLAEMYGVSAERIRQLEKNAMKKLKMA
FT                   VGEI"
FT   CDS_pept        complement(124135..124281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0116"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92880"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92880"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ92"
FT                   /protein_id="BAC92880.1"
FT                   /translation="MINNYFTELFTGLTSFRDHFRHSISIKNTRHDVVTGNKKAEIIDL
FT                   GFC"
FT   CDS_pept        124456..124866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0117"
FT                   /product="rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92881"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92881"
FT                   /db_xref="GOA:Q7MQ91"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ91"
FT                   /protein_id="BAC92881.1"
FT                   /translation="MSKTRRTVCLSLALDRLQSQQNQITKMRKYMEQFKHIDVQGAHAL
FT                   ISRGEARLVDIRDPQSFAVAHAQSAFHLTNDSIVNFMQQVEFEQPVLVMCYHGISSQGA
FT                   AQYLVNQGFEEVYSVDGGFEAWHRASLPVEAS"
FT   CDS_pept        124951..125793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0118"
FT                   /product="uncharacterized membrane protein"
FT                   /note="homolog of Drosophila rhomboid"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92882"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92882"
FT                   /db_xref="GOA:Q7MQ90"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ90"
FT                   /protein_id="BAC92882.1"
FT                   /translation="MQRLIVLNNPRMAQAFIDYMASRQIDLRMMPEGEGQFALWLMDDQ
FT                   HWVETEAELKQFLANPGDSKYSAASWDMAETRKTQFSYRSPSLLAMVKAKAGPVTMAVM
FT                   VACVAVYVLMMFGWESALLSAMHFPAEAAQQWQLWRWVSHALLHFSVTHIVFNLLWWWQ
FT                   FGGDIEQRLGSGKLLQIFVISAALSGAGQFWVEGANFGGLSGVVYALLGYAWILGYRVP
FT                   HLGLSVPRPVVAFMLVWLILGYVQPFMAIANTAHLVGLLSGMGLAYLDSTKQKHQKAA"
FT   CDS_pept        complement(125842..126252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0119"
FT                   /product="flagellar basal body-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92883"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92883"
FT                   /db_xref="GOA:Q7MQ89"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ89"
FT                   /protein_id="BAC92883.1"
FT                   /translation="MYKRYIAQIIIAFSLLFSLPLHAEEEQTGPQLAYFTLEPDLTTNF
FT                   YTKGKKLGYIQVRIDIMVMSNADLALVEHHQPLIRDAVVELLGQQSEDTVKSLAGREDL
FT                   RKHLVEKLNEILLPETGKTVIADLLFTKYLYQ"
FT   CDS_pept        126413..126964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0120"
FT                   /product="chorismate-pyruvate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92884"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92884"
FT                   /db_xref="GOA:Q7MQ88"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ88"
FT                   /protein_id="BAC92884.1"
FT                   /translation="MNTSMNQPNSLYLALLIEAKWQNPEDFHFSSDFAKHWLLEQGSLS
FT                   RRLARHCQHLTVELMRNEKSGVGQLTMQETQGLSPEICLIREVVLSGDQTPWVLGRTLI
FT                   PETTLADQPYDLATLGDIPLGLTVFSAEQVERDALQVAWIETPQGRLLARRSRLWMNHK
FT                   PMLVAELFLPDAPIYSRESV"
FT   CDS_pept        126965..127819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0121"
FT                   /product="4-hydroxybenzoate polyprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92885"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92885"
FT                   /db_xref="GOA:Q7MQ87"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ87"
FT                   /protein_id="BAC92885.1"
FT                   /translation="MSVEKAKAYWQLMRMDRPIGTLLLLWPTLWALIIAAEGTPDWHVL
FT                   LVFVLGVVLMRSAGCVINDFADRKVDGHVKRTQQRPLPSGRVTAKEAVILFLLLGISSF
FT                   LLVLTMNPLTIQLSFAGIVLAFIYPFMKRYTHLPQLFLGLAFSWAIPMAWAAQANELPW
FT                   VVWFVFAINALWTIAYDTQYAMVDRDDDIQIGVKSTAILFGRHDKLIIGLLQLLTLVML
FT                   VWLGLHYQLGQSFYWSVLAAGALFVYQQHLIRHRQRELCFQAFLNNNYVGMVLALGLFV
FT                   AFW"
FT   CDS_pept        complement(128033..130462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0122"
FT                   /product="glycerol-3-phosphate O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92886"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92886"
FT                   /db_xref="GOA:Q7MQ86"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ86"
FT                   /protein_id="BAC92886.1"
FT                   /translation="MSSGQSFSHSLLKLPLSALVKGTAIPSNPIDDHHIDINKPIVYAL
FT                   PFRSAVDLLTLQKHALELGLPDPLSPLEIHGKSLKRYVFIASRPTLVQSDNDVPSDSIA
FT                   LFSDLLALHAEDSELDVQVIPATVLWGRKPGKEGNNKPYLQAMNGLQKAKAVITAGRDC
FT                   LVRFSPVVSLRYMAQSHGTDSSIAHKLARVARIHFSRQKLAASGPDLPSRQVLFARLMK
FT                   SPAIEQAIEEEAKSKNISMEKARKEAQDIMDEIAADFSYSLVKQGDRLLGWLWNKLYQG
FT                   LNINNAATVRRLAQDGHEIVYVPCHRSHMDYLLLSYVLYHEGMVPPHIAAGINLNFFPA
FT                   GPIFRRGGAFFIRRSFKGNRLYSTIFREYLAELFAKGYSVEYFSEGGRSRTGRLLPAKT
FT                   GMLAMTIQAMLRGLNRPVTLVPVYIGYEHVMEVATYAKELRGKRKEKENAGLVLRTLRK
FT                   LRNFGLGYVNFGEPIPLNQYLNEHAPEWTKDIDPMGASRPQWINPVVNQLANKMMTHIN
FT                   DAAAANALTLCATALLASRQRALSKDSLIHQIECYLQLLKNVPYSKTYTVPSESAEALV
FT                   EHAISLDKFVIETDTMGDIISLDRNQSILMTYYRNNIIHLFALPSLIAQMIIRQENLTV
FT                   SQIQQQVAEIYPFLKAELFLSHKEEELDELVVKVLNELVSQDLISLKADKVAKNQANTL
FT                   TLVLLGRTISETLQRYSIAFNLLVSNPELAKADLEQKSQDIAQRLTRLHGINAPEYFDK
FT                   GVFASLFSTLKQQGYLDSDGNCDSEKTAQFATLLYALLYPEVKLTIEESVFQLKSA"
FT   CDS_pept        130780..131403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0123"
FT                   /product="SOS-response transcriptional repressor"
FT                   /note="RecA-mediated autopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92887"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92887"
FT                   /db_xref="GOA:Q7MQ85"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ85"
FT                   /protein_id="BAC92887.1"
FT                   /translation="MKPLTPRQQQVFDLIKSKIEVTGMPPTRAEIARELGFRSANAAEE
FT                   HLKALARKQVIEIVPGASRGIRILLEEEAANDEPGLPLIGRVAAGEPILAQEHVEMHYQ
FT                   VDPSMFRPQADFLLRVHGESMKDIGIMDGDLLAVHKTQDVRNGQVVVARVEDDVTVKRL
FT                   ERKGSTVLLHAENEEFAPIEVDLTSQQLTIEGIAVGIIRNTDWM"
FT   CDS_pept        131588..132403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0124"
FT                   /product="O-methyltransferase-related protein"
FT                   /note="involved in polyketide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92888"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92888"
FT                   /db_xref="GOA:Q7MQ84"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR016874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ84"
FT                   /protein_id="BAC92888.1"
FT                   /translation="MMSSIKQSSEKGYPVPARLLQPLWLRSRESLVDGGLIYDPIAAKA
FT                   CLSCQLAPECLSGDVAQKQLLHATLAQQCDQQVSQFLQQHPEGWIINVGAGLDTRFYRL
FT                   DNGRCHWVELDVTENLLWRQRLFHKNERYQQQHGSVDDLSCLEQLAINDKTPVLIVCEL
FT                   ALLDCPLTQVANFVQLLGRRFVSAQVCMVLAGDLTDSSLGQKLGSDRYAHAMTAPAEQV
FT                   LQWLPWAQWVKVFSPFDRFCARWKTWQRWLSKIPMLKHRLTPVVVHMKW"
FT   CDS_pept        complement(132453..133853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0126"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase,
FT                   class I"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92889"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92889"
FT                   /db_xref="GOA:Q7MQ83"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR022962"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ83"
FT                   /protein_id="BAC92889.1"
FT                   /translation="MAHANHFDVIVIGSGPGGEGAAMGLTKAGLKVAVVEKESSVGGGC
FT                   THWGTIPSKALRHAVSRIIEFNSNPLFCKNNSSLHATFSTILGHAKSVIDKQTRLRQGF
FT                   YDRNQCQLIFGTARFTDAHTISVTQNDGTEEVYTADKFVIATGSRPYQPADVDFNHERI
FT                   YDSDSILSLKHDPRHIIIYGAGVIGCEYASIFRGLGVKTDLINTRDRLLAFLDNEVSDA
FT                   LSYHFWNSGVVIRNDETYERIEGTEDGVIVHLQSGKKMKADCLLYANGRTGNTDKLNLP
FT                   AVGLQGDSRGQLKVDGNYQTEVEHVYAVGDVIGYPSLASAAYDQGRFVAQAITKGKADG
FT                   YLIDDIPTGIYTIPEISSVGKTEQELTAAKVPYEVGRSSFKHLARAQIAGKDIGSLKIL
FT                   FHRETKEILGIHCFGERAAEIIHIGQAIMEQKGEANTIEYFVNTTFNYPTMAEAYRVAA
FT                   LNGLNRLF"
FT   CDS_pept        133485..133604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0125"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92890"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ82"
FT                   /protein_id="BAC92890.1"
FT                   /translation="MRIGKAGSAENQLALIAVIKALAQASLLVDNGFRVAENG"
FT   CDS_pept        133943..134779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0127"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92891"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92891"
FT                   /db_xref="GOA:Q7MQ81"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ81"
FT                   /protein_id="BAC92891.1"
FT                   /translation="MEVITHISRKPINGMADVDKLSTKDCITALASSNVLAMAHHRLSL
FT                   AAIRAIVTAGSQFKIRANIIMKSMGIRAQQKEKTRRSLIDAAFSQLSADRSFSNLSLRE
FT                   VAREAGIAPTSFYRHFKDMDELGLTMVDEGGLLLRQLMRQARQRIVKEGSVIRTSVETF
FT                   MEFIESSPNVFRLLLRERSGTSAEFRAAVAREMQHFAAELTEYLISTGMNREEALAQAE
FT                   ASVILVFSSGAEALDLDRRERDELAERLIMQLRMVAKGAYWYRKERERNRLKGEIE"
FT   CDS_pept        134779..135159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92892"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92892"
FT                   /db_xref="GOA:Q7MQ80"
FT                   /db_xref="InterPro:IPR009867"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ80"
FT                   /protein_id="BAC92892.1"
FT                   /translation="MSNDTENNVNRSSERKTLVLALITGMCGDAILSWLTMSEVSFSIF
FT                   PIIALVLAVQALYREYLNHPVSEEIPLVGLACFFVGAFGHSAFIKAQHPEAGSNFFAIM
FT                   VVLLLLAWIGSKLGYIRRPSAD"
FT   CDS_pept        complement(135217..136326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0129"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92893"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92893"
FT                   /db_xref="GOA:Q7MQ79"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ79"
FT                   /protein_id="BAC92893.1"
FT                   /translation="MATLDVNPQRYQQQLAEKVQRLTDMFAPYQAPELEVFESPEQHYR
FT                   MRAEFRVWHEGEEMYYIMFNQETREKYRVDQFPAASRLINDLMPLLIDAMKDNESLRRK
FT                   LFQVDFLSTLSGEILVSLLYHRQLDDAWIENAKALKQRLNDEGFDLNLIGRARKMKIVL
FT                   DRDYVVEKLDVNGKPYVYQQVENSFTQPNGKVAEKMLEWAVDCTQESQGDLLELYCGNG
FT                   NFSLALAQNFERVLATELAKPSVESAQYNIAANKIENVQIIRMSAEEFTEAMEGKREFR
FT                   RLKDNGIDLKSYNCNTIFVDPPRSGMDVDTCKMVQGYERILYISCNPETLKENLDILSE
FT                   THHITRFALFDQFPYTHHMEAGVMLERKA"
FT   CDS_pept        136670..138076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0130"
FT                   /product="MutL protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92894"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92894"
FT                   /db_xref="GOA:Q7MQ78"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ78"
FT                   /protein_id="BAC92894.1"
FT                   /translation="MIEQSEVFPEDYGIDYCLMWINTDKYPSFTSRAAPDSGEIIHEVN
FT                   DNSKPFIYKLPILVDPDGINVVPVNLYLHSLLSNPDISSVDTIESHANALLSFYRWMSM
FT                   EIPEHTDKRTGVLIEEKLPLTIFDCTEKVEESPVVRYRDYLLENLYTEDENGKIGGSPN
FT                   TASSYVLKVVAYYTYLHRQRIVPLSKTFRPFEFSAKKVRIQNKNKRAQHDMLSHLNSYR
FT                   GDITVYTTGLTKPFKNRQKPQNADIRELRPLREDEKQAFYRYIDVENSSDTKDLMLYTA
FT                   TEVGVRLEELITFPASVVDRPKSKVMKVLIGERINGCLTKYRKERTIEIPDYVMDLLYE
FT                   YKLSKARKEAIDSGLLRHNHLFVQSNGSIYAPNTIQKHVEAVRNDMILSGLDIYFVTHD
FT                   LRATFATDWLYKRHIETGKPFEALISELAYLMGHENTGTTQKYINYLNDDKTWFEFSQR
FT                   KNQFAQEVLR"
FT   CDS_pept        138081..140549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0131"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92895"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92895"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ77"
FT                   /protein_id="BAC92895.1"
FT                   /translation="MAKSRLAASRNKKKLITQPKAKDNVTSLDLSFKLHRKENAYGYQF
FT                   NLLDWCHEQCDPQRPLVKPSRLKIMQKLRYWVDQEKKNNSSEGSIFARLSILKQYLVFC
FT                   DFKKNSPFCQAGYLSYVGNAGELWRLVHEGCEQKKYSFQYYDGEEAGILESTACRRKMF
FT                   LDNLLSVLGVDISEWQATLKPFSTMKDEPSTQPYISSEWYGLVRRTQLFFFSLATQLIA
FT                   LKEENPEVLPPRCLEGIVVDRVNGCDITIELGGGDVKDGAGSPFNQCMAAAYTLFAYYT
FT                   AFNDTPIKEVRHPIKVVVSKVENRTSKTAQVRAYKGRASKDVKALFSGTEENLHPEASE
FT                   KSAGFIVANINKRDSVGKADGITFLQTFELLSKTFSDDPFDTLIYCLNSQGEKAKTDLA
FT                   QALVALSRNLNLLSSDRGELADHLVKTYTDIVENQKMTTFNWVQREDNAWVMDRQVIEL
FT                   GKIVVTQRAIPIAYAAISCMTDVSLRNVLMPLRYSDKDIDGNITISFKYLDGSKGDFTV
FT                   DSKYRRFLQLVERYAATRNPIPGITRVGLSNRRSGGTKPPFLLPLGKQNHTYQWSEGKV
FT                   PISSYLLNLCGIDHGDYFLNINSSRIRVTHSDLEYKPEERGLTAQKILQHSIETADRRY
FT                   RNGHPVSNSKQISQGMMVLSHIAAGKTRNEAIETVEQELKIPVLEYEIWKKRNRPTNPN
FT                   GVDCDGKVDLSSEKDWHYAARKFAEEKGIIEEGQDITCYQYDLCPFCKSAKLVDDPYAI
FT                   YKLLSFLDALSEGIDQYPERASIIQSKIERFQVHLDDVPLETIEQAEDLFEEKGRYLLF
FT                   NSLSSVTQYL"
FT   CDS_pept        140561..142738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92896"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92896"
FT                   /db_xref="GOA:Q7MQ76"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ76"
FT                   /protein_id="BAC92896.1"
FT                   /translation="MLSFDNSQDLELTLDAMRSIGGQKDYLQQVLFPALLRGNWEELDK
FT                   MVVYQDERKTILFGEDAWMFAQSAYKGKNKSNIYFNIELEQGENVIVFRQNERHLVNQV
FT                   KCIAVANMWFSGQHIELGSLSSKIGLLRNYIVKLFKRGITSFEELNQEHLDILVEDGFF
FT                   DMSNSKVFTGLNYLPALKGLLPFTVNFNRLTHKMFNARPDDTEGTLVIPPRIYFAALTE
FT                   YSEGIAKAYGLRDEIEQAVEQMLFFYKYEEKRRLLDIRNGEIYKPIKGYEKNWERFTQA
FT                   LENEGVALVDKGKNPRWMEIFTSLKTRILLKDSQFHRFNVYIGDTFYDWGEFRRYLVSL
FT                   SAKASWLCLALSGMRIDELYRISPVYGAQEKKFDKNGDESGTGKEQIYFLTTRQSKITL
FT                   NSQTKNDVFVTTETGWKAFHVLNAIHTPYRNRFAGNDSHRMFANLQKVTYFKSVGKSAL
FT                   GKGVINNFNKNNVDFILTLDDMGYLQTSDPTQTSFKLGDKFHFTCHQLRRSLAYYLIGY
FT                   ELCSFPALKQQLSHLSMAMTRWYARNAFSFEKIYSEIQKERVTQQAKIFARIYQKMANR
FT                   ERIAGGKGQAISREGESYFEDGVNKRKLSKEYWIDLLTNGKAHLHAVAPGMYCTNTQCS
FT                   MRINIDLTECVDCEYDFIENAVYAEVSRMDAMRNIEFLKENNELNSSAATKYYMQVKAA
FT                   EEIMDDLVFEHDKYEFEEDVLSLVIPTKTVA"
FT   CDS_pept        142742..143287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0133"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92897"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92897"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ75"
FT                   /protein_id="BAC92897.1"
FT                   /translation="MTDETGLSPTERQLRDALARLVAKRPIHRELKQKLKANKLKITVS
FT                   SVEKEAGLSNGVVKPERYPKLKEDILSAEAARKYGPVKDVSDEDIHRHPLYIKAKNDLD
FT                   KAKAEIKMIKAELTSKNSKLESYKERIKEQAVRMHQMNVAMWGQIPDEKKYVELMIDVQ
FT                   DMGMNSNVLDFKTREKLD"
FT   CDS_pept        complement(143514..144077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0134"
FT                   /product="predicted acetyltransferase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92898"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92898"
FT                   /db_xref="GOA:Q7MQ74"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ74"
FT                   /protein_id="BAC92898.1"
FT                   /translation="MQTRDRDMKYALYKQEQTQEVITLFKDTFSDSEGKEEGALIAKLV
FT                   EDFLTLPTKDEDLYVFIAQDESERIVGSIIFSRLSFPNGENIFLLAPVAVATDCHGQGV
FT                   GQGLIKFGLATLKEKGVTVAITYGDINFYSKTGFATISQDVIQAPLDLSYPEGWIAQSL
FT                   VGEAVPHVVCKPTCLKAIDNPSYW"
FT   CDS_pept        complement(144067..145311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0135"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92899"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92899"
FT                   /db_xref="GOA:Q7MQ73"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ73"
FT                   /protein_id="BAC92899.1"
FT                   /translation="MTCLLLYSSYYPNTKNTWVKSHMYLISELAAKAGISRTTLLYYEK
FT                   LGLINGQRLDNGYRYYSENDLQRLLLIQQLQSAGLSLKECEQCLDAKLSRSLLENRLTQ
FT                   LNHDIDKKIHARELLLALLGERPQRELHHSLSQSAPNAYLNWLSTQGYSEKEALRLKWL
FT                   SKDMNEHESYMKDFMTVFATLERWGPGSHKDSLKAISLMSPQTMTDILDIGCGTGTSTL
FT                   LLADNSIAHITAVDNEPIAIEQLNKKIQNAQLHERISPVCASMTELPFQAKSFDAIWAE
FT                   GCVYIMGMENALKQWKPLLKDNGVLMVSDLVWLTDSPDEETKQFWLADYPDIQSIPKRL
FT                   TLFKKHGYDVIEHFSLGVDAWQNYWQPLQSRVEELQAVMPASQALLDIKKEISVYERSA
FT                   AKDFTYQHFILKLAN"
FT   CDS_pept        complement(146363..147403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0136"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92900"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92900"
FT                   /db_xref="GOA:Q7MQ72"
FT                   /db_xref="InterPro:IPR022604"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ72"
FT                   /protein_id="BAC92900.1"
FT                   /translation="MRDYKICGSGHGVISAMYHSAANPIIRVAVFPVLLLFWQYVYGTD
FT                   LPLLAPAMCAVFLTTTHEPPPVIMVFVMGGILFITAWFQALMSELLIDYVHVYYLFLFG
FT                   IFYWCMERTKKNPQDVFAILLIVSTAMIAVFTQQKGISVEQIPMALLKNIFIAGFTAYL
FT                   AYLLFPRGEPLAISMPPVNSTTKYLLDWQTLLKASIVMTMMVCTIQLDLEQSTIITIIV
FT                   ALMIKDPDPSIGKDYGLRRLLTTYASVLYAIPPLIMSLLQVNLVGTVGVAVISALFMGI
FT                   HAVTKKASYNSIQLMYSSYVVLVFYGITSTSISAISDDLVRFTSVFAAVLIGIMSLITL
FT                   YPRTRT"
FT   CDS_pept        complement(147345..148451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0137"
FT                   /product="multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92901"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92901"
FT                   /db_xref="GOA:Q7MQ71"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ71"
FT                   /protein_id="BAC92901.1"
FT                   /translation="MSDNNVQTSAEQSDKKISQARSFTYYIFALVAALWLYTLWADRMT
FT                   PMTDQARVNGQLIRISPEVSGPISQVLITNNSIVKAGDELVTIDPRPFELAVKAAKFDL
FT                   QQAAQSYEADSAAISVAQANEVAARVKVNNAKKNVERNRVLANKGTISQAVMDNIIAEL
FT                   ETAQAGLAQASSALEKAKQEFGPRGIDNPEIQSVLNRQEQALLNLNHTKLTAPANGVIT
FT                   NMDVAVGDYAAAGQPLLTFINNNNLWLTAMVRENSLAHLKPGDKVKIVFDANPGEVYEG
FT                   KISSIGWGSSGNGSLAQDASNGLMTSPTSSSKAQRFPVNIEFMELPADLNLRYGGRAVV
FT                   GFYPDESYLGERLQDLWIWAWSYISYVS"
FT   CDS_pept        complement(148471..148980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0138"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92902"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92902"
FT                   /db_xref="GOA:Q7MQ70"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ70"
FT                   /protein_id="BAC92902.1"
FT                   /translation="MKVLDVDIKVKDSLIGGVINGVINGYIASHHFKGMDSVPMSLNVI
FT                   TNSEVTVWGQAVSLTFGLGIILSLITSKLFIHQLNKSHPQHISQLQSGFWSHLVPIAVT
FT                   HAAALFGWFVAIAVIWTKYAGEVMVSSSSAVALVGLFAFIITIAVEVRTKKSIIYKKIN
FT                   LLEQPQ"
FT   CDS_pept        149112..149792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92903"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92903"
FT                   /db_xref="GOA:Q7MQ69"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ69"
FT                   /protein_id="BAC92903.1"
FT                   /translation="MKLDKALSNISEKNNFIYLTLALIMLLIAAALVQLLQDNVIEYVI
FT                   QGIMVVIFIVCFVSLRFDRKWTHFLRGLAVVWIAAIAAKHLFHIKEMSILMLSLTFVFF
FT                   YGTFQSLVRKILFSGQIDTNKLIGSVALFLLLGLMWAVAYLLLLELDPFAFRGLEAIPW
FT                   EDNFSNSAYFSFVTLTTLGYGDISPVTPIAKTLVYLESVVGVFYMAVVVSSLVSSNLGR
FT                   NTPR"
FT   CDS_pept        150095..150301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0140"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92904"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92904"
FT                   /db_xref="GOA:Q7MQ68"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ68"
FT                   /protein_id="BAC92904.1"
FT                   /translation="MRKLASGKCSGIKRPFKLEEIWRIRTRLELENDLMQLALLNLAID
FT                   SKLRASDLLKLHVYDVSSQGVIY"
FT   CDS_pept        151234..153030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0141"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92905"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92905"
FT                   /db_xref="GOA:Q7MQ67"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ67"
FT                   /protein_id="BAC92905.1"
FT                   /translation="MNYKYSQKFNVMEALIALAIGITLSFFFSFKTQNSLLEATESSIV
FT                   AHSASLVHMRSYIHLTQREDGDHKINKLLSEIQKLTSELNTLKEASNDINVRFPQMIWV
FT                   GNPLPSVVEEYVKTADKQLVFLDKMLKAKQQIVPEVSLIELERQVFSEEMDEAAEHVHE
FT                   RLMDNIFLTSKAAVYTLILFIILIFSAVFLYLNHYIIELKKTKLALQVAVNKAEEANLA
FT                   KSMFLATMSHEIRTPMNGVIGMTQLLISDNKDPSIQTHLDTLLESGEHLMVVINEILDF
FT                   SNLEQGSLVFVQEEFELSKLLVPIKNSFQPQASEKKLQLIFDTNSLPEDLILVGDKTRI
FT                   RQVIYNLVGNAIKFTSDGQVKVVLKYESDKNELCIQVSDTGIGIPSHRLKGIFNAFEQA
FT                   DVRTMHDFGGTGLGLSIVKKICLSMGGDITVTSELGSGSCFVAKVISPRVTTLRDQRTL
FT                   SGEKDFSGKSVLIVEDNRVNQLVAQRLCQKLGFTTYIASNGIEAVKRVRECSFDVILMD
FT                   HQMPQMGGIEATKLIRNEHAFQGIILGCTADVTKDTAIAFVDAGANGVITKPLQLDSLG
FT                   ELIARSVTLACNASRDHHVVLE"
FT   CDS_pept        complement(153557..153763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0142"
FT                   /product="predicted transcriptional regulator"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92906"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92906"
FT                   /db_xref="GOA:Q7MQ66"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ66"
FT                   /protein_id="BAC92906.1"
FT                   /translation="MKDLAKRFGDNLRRERKLKGISQDKLAISADIDRSYVGRIERGEV
FT                   NITLEKAYQLASILGCDVRDLLP"
FT   CDS_pept        153856..154398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92907"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92907"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ65"
FT                   /protein_id="BAC92907.1"
FT                   /translation="MTKKTAINEYIFTLFIEKGLDGLTVPALRDELLTITGEFEDITEA
FT                   RKFLYRQLLPLEKKGLLWTNGQGRTRTYHKSEQFKETVFKPKKRKQQKLKTVVKNSDEA
FT                   LTLDELTLERRKYEAELAIALAEIEEFQLLSERLPLQKSSLLKLSEETRERSVRYLAKI
FT                   NVLNHALKLSNCGEVKC"
FT   CDS_pept        154392..155774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92908"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92908"
FT                   /db_xref="GOA:Q7MQ64"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ64"
FT                   /protein_id="BAC92908.1"
FT                   /translation="MLRLWQEECVGSALEKYLAGHSHFQVQATPGAGKTVAAAEIAKRL
FT                   YDLDKIDLVLCFSPSLTIADGIKNTFSWRLGCSFSGGLGSIGASFTYQSMKYLRDSFWE
FT                   TIKKHRVLVVFDEIHHCSGDEIENANVWGEQILRQIQGIAAFTLSLSGTPWRSDLLPIT
FT                   LAQYSDAEGRIHCDYQYGLKQAIIDKVCRSPKIVLIDNDRLSISESGQSKSFSSIPDLL
FT                   KQSATPYQSILQNIDAMTYVLGLGCKKLADIRMDNPNAGGLVVASSVGHAIEIQKVLTE
FT                   TYEQSTEIVTYYHENPLEKINGYRNGTTQWIISVGMISEGTDIPRLQVCCHLSFVKTEL
FT                   YFRQVLGRILRTHESSNQQAWLYTFAEESLVSFAEQIEQDIPDSCLFIKPDNWQDRPQA
FT                   SVSLNRAYFSDQQKKKTDIGKTQLSWDKERLEKPSIITAYSASSGQLNLGNFRERVIAA
FT                   FQ"
FT   CDS_pept        155818..156123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0145"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92909"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92909"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ63"
FT                   /protein_id="BAC92909.1"
FT                   /translation="MFYIGVSHYYATGEGLTMYVASGSEESIRAAIPEYFHLGLTILTP
FT                   SEWLKAAAGDCEDEYHQSEAEDLKAYLPLLWKQIEERALERGCHLDFFMKHHFNYA"
FT   CDS_pept        156143..156667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0146"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92910"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92910"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ62"
FT                   /protein_id="BAC92910.1"
FT                   /translation="MKVLYFDTLSLLYSNEYFQRNASVHTKYKEWFHTRTKTLLEMVEP
FT                   DFQAIAKLKNAASESGLLLYPLGIFYDRSYLIEHGVFSADELAPDTELPFRMQMDDNDP
FT                   VRRMIAHAHGLNAQWYACGEIGSEELLQPYPERHLRSEFGKGVTSELLAQILRLKATNM
FT                   PNLTDNILRDK"
FT   CDS_pept        157067..158050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0147"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92911"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92911"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ61"
FT                   /protein_id="BAC92911.1"
FT                   /translation="MLGNSSKNSAMKKNIMISALTLAISGCASTPNESIESQGKYADDY
FT                   ALNVEEFSEATRFYYPLRWIEPGRNANNLDKFYYDTNSHKELANTSSVATVVAAGLGSI
FT                   TSFDAVMGLLAQQGSRSGYDSLLGEQYLYTIIQVDNNKDLDTQAQYVNRIAVDTIKMAM
FT                   GSEAKEEYQKVGSEGFYFLDRIKVTSTSDESCTAVYSPCYSLTARIPMLIRDNNGYISL
FT                   VPQGGDYMAAKTYLPIGFPIEQIKFANVAGVEQFLYVPAVKMNGHKDLWRKENLSYFTG
FT                   WYNQQRISINPYIKRLSDDTVFYFNPKITAKQRDRYSLYRVFNLSD"
FT   CDS_pept        158152..158283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0148"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92912"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92912"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ60"
FT                   /protein_id="BAC92912.1"
FT                   /translation="MNVIYEKAGVVCNWAVYIGSQWMLNNEREKSSNVFGGTLCSSQ"
FT   CDS_pept        158255..159031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0149"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92913"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92913"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ59"
FT                   /protein_id="BAC92913.1"
FT                   /translation="MGEPCVQANDNTSPKPIFYVNDKEEKFTHFDDGSISSHTLENGLY
FT                   RLSEYFNRDGSLQTRNARFVDPERGSLNQKPTGRQLKFNGDGFVASAKYGYNLEFNRPT
FT                   QLDSFWMKESHSFYPAFSANDDLIAILYANRENQYTDYGVRFGVVNLEKPTCELGKLRS
FT                   QAYGKVGDKHITFSRKCMKIGNKVALVYKPASKSDAQKMIDAIVMPIARSKAVVGAKLG
FT                   YLHIDIQGKQVPFDTRGWDDYYLKNSELNVSPYRLF"
FT   CDS_pept        complement(159261..159428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0150"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92914"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92914"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ58"
FT                   /protein_id="BAC92914.1"
FT                   /translation="MKVYLDDERPTPEGWHRVYWPEEAIAILKQGHVTEISLDHDLGND
FT                   EHGTGYDVVL"
FT   CDS_pept        complement(159543..159731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0151"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92915"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92915"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ57"
FT                   /protein_id="BAC92915.1"
FT                   /translation="MPKLHYKTTNWKQYNKALINHGSLTFWIDEEAIRQWKQSKQDKRG
FT                   RPRQFSDLADISRRMCS"
FT   CDS_pept        159838..160227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0152"
FT                   /product="transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92916"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92916"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ56"
FT                   /protein_id="BAC92916.1"
FT                   /translation="MTETYDTINSESIVRFFWKLKKEHYPLEQKVHLVLDGAAYHQSEM
FT                   VRNAAKVLNIELHYLPPYSPNLNPIERLWKVMNEYVRNNIYFSSKAEFTTAINEFFNVT
FT                   LPKVAGSLVSRITDNFQILRPASSS"
FT   CDS_pept        160328..161071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0153"
FT                   /product="putative hydroxyacylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92917"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92917"
FT                   /db_xref="GOA:Q7MQ55"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ55"
FT                   /protein_id="BAC92917.1"
FT                   /translation="MSLSITHEKSLIDNYIWILFDKSKAIVIDPGESEKIINFLDKNNL
FT                   TLEFIFLTHGHCDHTKGVFSLKEKFPNASLFVPIGLELGLGESIIKEGDELNLLNSTFN
FT                   VLELPGHTDNHIGIMYKDNLFCGDVLFSAGCGRVGSNYKDMYLSLKKIKSMDDKTKIYF
FT                   SHEYTLDNLKFAHYIDPKNKNIINYIEVFKEKPDTVSAPTTLLLEKEINPFLRLSENID
FT                   IKNKINNEFDAFVYLRKLKDKFNSI"
FT   CDS_pept        161096..161881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0154"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92918"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92918"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ54"
FT                   /protein_id="BAC92918.1"
FT                   /translation="MKLKTIILIIGFLSSPSIAFANENKVDVYDLVSTSSNVPTLDTVK
FT                   LITADGVLNKELKEFMLKKHNKQVLKDKKIAILATDGVEELEILVPLNYLREVGANVTI
FT                   VAPRKKIYPETLGLKIPENRRTHIMTVRLMENSGWLKIDKYIDEVSFDDFDGLVLPGGA
FT                   WNPDFLRTDVEAQNLVREIVNSNKPLATICHGPLVLINSGLVKDRKITGYWAIMKDLEN
FT                   AGAKVYDQPVVIDGNLISSRFPYDLPRLMNSFTEKLLNN"
FT   CDS_pept        162336..162731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0155"
FT                   /product="lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92919"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92919"
FT                   /db_xref="GOA:Q7MQ53"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ53"
FT                   /protein_id="BAC92919.1"
FT                   /translation="MVKMIHTMIRVSDLECSLKFYRDILELEIKDQYIFDGFSLIYLGN
FT                   SETGFELELTHNHDQSEPYTHGSGYGHLAVNVEDIEAVHRRLTSLDIEVSDIKVFNYQQ
FT                   KHLATFFFVTDPDGYKIEFLQRQGRYL"
FT   CDS_pept        162757..163041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92920"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92920"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ52"
FT                   /protein_id="BAC92920.1"
FT                   /translation="MINLTAAFHAKPEHTSTLKQALEAMLVPTRNEKGCVRYQLFQDKN
FT                   DICQFLFQEQFADQAAFDQHCNTEHFQALLSTIDGLLVSEPQITFFEEL"
FT   CDS_pept        complement(163257..163403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0157"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92921"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92921"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ51"
FT                   /protein_id="BAC92921.1"
FT                   /translation="MKLLSNGHELVKRKIDAGFGMLKTLTISALLLKPFDISFFLPMTS
FT                   TFT"
FT   CDS_pept        163739..164827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0158"
FT                   /product="glycerol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92922"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92922"
FT                   /db_xref="GOA:Q7MQ50"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ50"
FT                   /protein_id="BAC92922.1"
FT                   /translation="MLTTTIFPGRYVQGKDARKQLGVELNRFGKKGLMICDSFVYDTLF
FT                   SEFEPYLETVEVEVIRFASECCDEEITRLTAMLKNFEGEFVVGLGGGKTIDTAKATSYE
FT                   ARVPVAIVPTLAASDAPCSALSVIYTQEGEFKRYLFLPQNPNLVLVDTQIIAKAPVRFL
FT                   IAGIGDALATWFEAESCQQSFASNMTGYMGSLSAYALARLCYDTLLEYGVIAKTSNEQG
FT                   VVTPALERVVEANTLLSGLGFESGGLAASHAIHNGLTVLEPTHVFLHGEKVAFGLLSSL
FT                   FLTDKPAQTIATVYDFCEKVGLPTTLSQIGLENVSDEDLLAVAEASCAEGETIHNEPRT
FT                   VTPDMVFAAMKAANVEGLRRKS"
FT   CDS_pept        164990..166798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0159"
FT                   /product="bacterial surface protein"
FT                   /note="containing Ig-like domains"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92923"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92923"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ49"
FT                   /protein_id="BAC92923.1"
FT                   /translation="MPIKKRYVFLIFISLIINGCNSEDNSLNNVKENEIRSIQITFSPK
FT                   TKGISSYSIAKGNCIKFIATAIYLDNSSVDVTKDVIWKSEASNVLAIDSKGEAKGKDIG
FT                   SSKIQASIGNVHSNAVNIEVTDAIITSIQITPSAASLAKGQTQPLTATAIFSDDTSFPV
FT                   TESVTWKSEDTNIATVTNKGVLNAINSGIVEIFANKDGVTSNAVNIEVTDAIITSIQIT
FT                   PSAASLAKGQTQPLTATAIFSDDTSFPVTESVTWKSEDTNIATVTNKGVLNAINSGIVE
FT                   IFANKDGVASNAVNIEVTDAIITSIQITPSAASLAKGQTQTLTATAIFSDDTSFPVTES
FT                   VTWKSEDTNIATVTNKGVLNAINSGIVEIFANKDGVTSNAVNIEVTDFLSKHFSIDVYD
FT                   TNNNTFSSREITQSNNNKFNGNGFSIALLGNEFKVIPISDQRIISERSQSIYDEDNSII
FT                   GFIAEVAVSSEIDDPSIDYTYISIYENRTSQNKLNGIYSGKYYFRRTPGARASIIDISF
FT                   DLNNETCFVDYGGFPFLKCSDVYITNGQLTAVLESIDNGSKLFYGKIQANIYGKNNNNI
FT                   SGFVIDKNVGNGGVYSSDILILNKNR"
FT   CDS_pept        complement(167166..167717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0160"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92924"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92924"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ48"
FT                   /protein_id="BAC92924.1"
FT                   /translation="MRYSFISTLILTIFSLSANATTNKHIIGTNIGYGGVNYGAPTSEE
FT                   SGDMFLGEIYYRYMTMHNFGIEAGYKGAIDGIGSAIVNQISQISDASFSGLRLSGYGSY
FT                   PLSSGFELYGKAGVTYYTLEYTYKVNDQTKNIDHATIGGEVAGGIGWSYRYFGLNVEYV
FT                   YSKNSDFDSSGLMFGAQFRF"
FT   CDS_pept        complement(168142..169062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0161"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92925"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92925"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ47"
FT                   /protein_id="BAC92925.1"
FT                   /translation="MPKPRYKTTNWKQYNKALINRGSLTFWIDEEAIRQWKQSKQDKRG
FT                   RPRQFSDLAITTALMVKRVFSMPLRALQGFIDSVFSLANVPIVCPHYSCISRRAKQVEV
FT                   SFKPKSRGAIQHLAIDATGLKVYGEGEWKVKKHATDGKRRVWRKLHLAVDTSTHEIVAA
FT                   ELSLSNVTDAEVLPNLLKQTRRRIIEISGDGAYDTRDCYDAIRFKRAVPLIPPREGAAF
FT                   WENGHPRNLAVGCKKLYGSNNKWKKRYGYHKRSLSETAMHRVKQLLGGRLSLRNYNAQV
FT                   GKTYAMIKALNKLTGLGMPETQCIV"
FT   CDS_pept        169206..169421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0162"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92926"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92926"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ46"
FT                   /protein_id="BAC92926.1"
FT                   /translation="MLKTIQETVRASQAKVSEEEAVMLWPRIKAFSKEHQREPSLTASD
FT                   PIEVRYAEVLAYIRKMKQQRMAKQEG"
FT   CDS_pept        169425..170546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92927"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92927"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ45"
FT                   /protein_id="BAC92927.1"
FT                   /translation="MICLRSSKKTPKRDLDDIFPEDDDLGLLDVAPLKAKAPAGNLIAS
FT                   QFEEITTFFEKNGRIPASDADSFDEKRLARRLKAFKSNGEKRESLKEFDSYGLLADESS
FT                   YIPSIESVGSSTYEVQESTPSSEIDKSELVTSLDDIFDDDDDLLEFDAPDIFTIRHELK
FT                   IQVGDFFILNGLMGYVHSAGERLEGYSSYNARLHLVFENGTELHMLFQSLTHGLVRDDH
FT                   GCKVNREGVLLEPDSNPVPTGLVYVLATKSSDSVLATYKANLYKIGFTEGSVEDRIKHA
FT                   EKDRTFLEAPVRVVMTTECYNIDAHKLETLVHGFLGYQRLNITLKGHDGQGYKPREWFN
FT                   VPLATVVEVIKHILDGTISQYRMDNTSGKVMKK"
FT   CDS_pept        170672..171766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92928"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92928"
FT                   /db_xref="GOA:Q7MQ44"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ44"
FT                   /protein_id="BAC92928.1"
FT                   /translation="MAITIHRAVVHELIKEKNEEPQPLHYRQSLLPVDNESVQNVIAGV
FT                   VNIYGRKNNSARYGVFRDDEASGSVPDSFYEYSELEDVSDEDFMVLSKSVMQELFREAT
FT                   GVAFATGGHILFSDYESDGVRFYLAAMIKQKSGFAFSDTLGVEDLEYIDLSKLHQAIKI
FT                   NFSKYNAYQNTDDIERQDSTYLSFVSPQTSQSAAGYFIQAMGCKAGAPSAKATQAAVDE
FT                   SVGFFESKEDLKAHAPNLKRALTVYLEQKAESNEPATLPDIEGIARRFFPTDDEEQADR
FT                   YADEFVTYLNREESGVPPEFPVNKTKLKTMTHLVYKGDDLHLEFDKEDIGGNPSARVYF
FT                   DGAKVIIKDLPQDLIDKLNQQING"
FT   CDS_pept        171773..172972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0165"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92929"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92929"
FT                   /db_xref="GOA:Q7MQ43"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ43"
FT                   /protein_id="BAC92929.1"
FT                   /translation="MSFYPLVQLRRAASQHSFNRPVFSCSVHVTEGIAEILEQCEYLRE
FT                   INGSDIDGNLVNFNDYIDQEIELTFRTPRTNESQFYQNLNAFLDNLTFSYSEDVELPEF
FT                   YLFDEDLYYSTNSIESDYDDIFSRLKLLIRSVAKLENLAHYHDEKMGDSRTLVYLSGEH
FT                   RTPIVLSVSISENLLSKDINFSLLNELTSAESELNMHYSDKLSVFYASLHEFLGGGYAP
FT                   DEAFNKLIDSWGAFVALYQNNLSTYLSGFSFHKAKKEVAEAEIELSEKLTNLTSDIVFK
FT                   LFSVPASVMALAAIMQKGQLDALVFVLLVIGVIVTILLMYGLLKSQKNKYESLEKAKDL
FT                   VFSSIDGKEAEYPDELNTEIIAMKSRLNKHFKSTDKWLGYYKVAIFSPLIALILFIIIA
FT                   "
FT   CDS_pept        173539..175380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0166"
FT                   /product="outer membrane cobalamin receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92930"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92930"
FT                   /db_xref="GOA:Q7MQ42"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010101"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ42"
FT                   /protein_id="BAC92930.1"
FT                   /translation="MQKSLLAIAMASLLTPISYLHAQEVQTNDTVVVTANRFEQVESSV
FT                   LASISVVTKAEIEQLNVTTALDILKTLPGVEVNSQGGKGQISSIFLRGTSSKHTLVLVD
FT                   GVKINSATAGGASLGLIPAFAIEQIEVVRGPRAAIYGSDAIGGVIHIKTIPANRQTKHD
FT                   ANLGYGNDDHSSLAWRSSGQLNDSTQASFVFSDEKSDGYRVNEVAPSGDSHGYQSQTLF
FT                   GSLRHEIDDAWSVQFNGYQLSSDVEYANQFSGVKNESNTDFYSIAGSLNFHKDNYSSQL
FT                   MVSRSDNESWDGVASGMVAKTALFSSRNSVSWLNHWVVVPALTLAAGVDYDQENARQGG
FT                   ANATNYSKTEKDNKAAYVTAHFSKNIVTAEASIRSDDDSAFGKHNTWNLGLGIAPSDYV
FT                   EFIASTGTGFKAPTFNDLYWPSSGNPNLKPETSKSSEVGIRSYLPFVQIDISAYRNEIE
FT                   DMIDWAPTGPGGAWTPSNIDNAKIEGIEIEALFETGVIEHRVSAEWKDPRDKSDDSFLI
FT                   RRARENFSWVSTYSADRFGFSAVANYVGDRKDSTGKTMDAYTLLDISANYKMTEALTLG
FT                   ARVGNLFDKEYQTAHSSGGKYYVGEGRNWFATVNYRF"
FT   CDS_pept        175350..176108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0167"
FT                   /product="predicted ATPase"
FT                   /note="PP-loop superfamily"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92931"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92931"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ41"
FT                   /protein_id="BAC92931.1"
FT                   /translation="MVCNGQLPFLMFKNRLRAVYFSEYVMKKKVVISWSSGKDSTLTLL
FT                   RLMEHPGYQVVGLYTTYVDNEVPFQATPLAVVEMQAQLLNLPLIKIALPQVFPSNEVYQ
FT                   QTIVHALQASAIELDAVAFGDMFCNGIADYRRSYIEPAGWECVFPLIGESSLELAHEII
FT                   ARGIKTILVTTDGHALKPDWCGRWYNRELLASLPADVDPCGEDGEFHTLVVKAPGFAGE
FT                   IRLQLTVQETDGRFTYQRYNATLLNQHERV"
FT   CDS_pept        176142..176933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0168"
FT                   /product="glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92932"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92932"
FT                   /db_xref="GOA:Q7MQ40"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ40"
FT                   /protein_id="BAC92932.1"
FT                   /translation="MESSNQPNVLIFDSGVGGLSVFQEINKRLPEVNYYYLFDNQAYPY
FT                   GELSQETLLARVEALVVKMTQQFAIDLVVIACNTASTIVLPALRAKLPIPVVGVVPAIK
FT                   PASLLANRAVGLIATPATVTRQYTHDLIRDFAHEKEVELLGSTRLVDIAEEKLRGRQVD
FT                   QQELAMILKPMKHKVDVAVLGCTHFPLLKEEIQQVLGDEIILVDSGEAIARRVQSLLHQ
FT                   LSPQSTKTPWRIFSTAQPWDEAALNGSLKTMGFNAIELYPL"
FT   CDS_pept        complement(176911..177357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0169"
FT                   /product="RNA-binding protein"
FT                   /note="containing a RRM domain"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92933"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92933"
FT                   /db_xref="GOA:Q7MQ39"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ39"
FT                   /protein_id="BAC92933.1"
FT                   /translation="MTFKKVIASAALAILGGFIFSQLDIYPAISFVIGVVLTTLLLSFF
FT                   PHTPTLTDSDSSLPTKTLYVGNLPYKANETHVRELFAQHGQVYGVRLMKDKRTGKRRGF
FT                   GFVVMASGDAENAINALNEKEYAQRTLKVRIANEMKHPIEDKVL"
FT   rRNA            177895..179429
FT                   /gene="rRNA-16Sb"
FT                   /product="16S ribosomal RNA"
FT   tRNA            179498..179573
FT                   /gene="tRNA-Glu-1"
FT                   /product="tRNA-Glu"
FT   tRNA            179575..179650
FT                   /gene="tRNA-Lys-1"
FT                   /product="tRNA-Lys"
FT   tRNA            179665..179740
FT                   /gene="tRNA-Ala-2"
FT                   /product="tRNA-Ala"
FT   tRNA            179755..179830
FT                   /gene="tRNA-Val-1"
FT                   /product="tRNA-Val"
FT   CDS_pept        complement(179801..179941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0170"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92934"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92934"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M7C2"
FT                   /protein_id="BAC92934.1"
FT                   /translation="MQFSTRNTLFKDSQRRKINHKHKEGGFHQETLKIFKEWWAIPGSN
FT                   Q"
FT   rRNA            180171..183058
FT                   /gene="rRNA-23Sb"
FT                   /product="23S ribosomal RNA"
FT   CDS_pept        complement(183051..183209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0171"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92935"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92935"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M7F8"
FT                   /protein_id="BAC92935.1"
FT                   /translation="MGPKRYGRQANSVFVFTFSKKVKAKNLESCLCSLHIQCSYIESIK
FT                   TLWVLYG"
FT   rRNA            183180..183297
FT                   /gene="rRNA-5Sb"
FT                   /product="5S ribosomal RNA"
FT   tRNA            183328..183404
FT                   /gene="tRNA-Asp-1"
FT                   /product="tRNA-Asp"
FT   CDS_pept        183740..184195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0172"
FT                   /product="transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92936"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92936"
FT                   /db_xref="GOA:Q7MQ38"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ38"
FT                   /protein_id="BAC92936.1"
FT                   /translation="MINDAMDSLNNIDFKKFASQQKSIQMKMRLLALAHFKDGHSRTQI
FT                   AKFLKVSRTSVNKWVQPFLEEGLEGLQEKPRTGRPAFLNAEQREQLSQYIKSRAMDSSG
FT                   GRLTGNDIHAYIVNEFGKHYHPDSIYYLLNHMGFSWITSRSKYPRQS"
FT   CDS_pept        184257..184790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0173"
FT                   /product="transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92937"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92937"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ37"
FT                   /protein_id="BAC92937.1"
FT                   /translation="MGLDNVDVWFQDEARFGQQNTTTRLWAERGSRPRVVKQQQFEYAY
FT                   LFGSVCPARGIGEAMVVPWVNKNIMVEHLKQLSAVTEKGRHAVVIMDGAGWHTNDIAEP
FT                   FDNVSIIKLPPYSPELNPIEQVWSWLRQHYLANQSFADYEDIVSKVCRAWNSFLECSAR
FT                   VRQMCSRSWIDLNS"
FT   CDS_pept        184958..185785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0174"
FT                   /product="predicted signal transduction protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92938"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92938"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ36"
FT                   /protein_id="BAC92938.1"
FT                   /translation="MSQEALISRLNELPRIESVLQELLEMVNRDNFDFSELSKKLAMDQ
FT                   VLSARLLRMANSAHFAGNKPLSNLNEAVIRVGSGAVRTLVSSSILYSAFPKIETLNIKD
FT                   YWANTFEVAMIASKLADQAKLDANEVFTTGVLHNIGELMIHSLVPEQAIEISNKIAEGQ
FT                   SPLSAQREVLGTDATELGAKLAEAWKFPPEMKDAIENINHPGKAKIAKRLACLLYLARD
FT                   INKRWDSMLEEEEKQHYLAEHPAASALGITPGRAFVIDQIRGQGSEMAYNMFS"
FT   CDS_pept        complement(185803..186711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92939"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92939"
FT                   /db_xref="GOA:Q7MQ35"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ35"
FT                   /protein_id="BAC92939.1"
FT                   /translation="MNERRALGFGLSAVLLWSTVATAFKLTLAEFSPIQMLTIASVVSA
FT                   MALLAICALQGKLTQISATFLSNPWYYLLLGLINPLAYYLILFKAYDLLPASQAQAINY
FT                   SWAITLTLMAAVFLGQKIRKQDWVACVFSYVGVIVIATKGDLLGLSFESPVGVALALTS
FT                   TLLWAGYWILNTKNQADPIVGVLLGFLVAIPFAIALTVIEGQSWGQISMQGWLAVTYVG
FT                   LFEMGVTFVLWLSALKLTNNTARISNLIFASPFISLMLLSSIIGEEIHPTTLIGLMLII
FT                   AGLVIQQIKWGKRKLAAADHS"
FT   CDS_pept        186807..188429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92940"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92940"
FT                   /db_xref="GOA:Q7MQ34"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ34"
FT                   /protein_id="BAC92940.1"
FT                   /translation="MKHASLFLERLIMQWIIDNQASLLLTLFSSLSTAILAAWWQRQKL
FT                   EVVNQLLQQQLESERRLSASKIEQLQHGMQQLQTELDDYDQERDQAAYEVKQTHGKLMA
FT                   AIEKLRYFDAVKQERQQYFDELTALRECNAKLETQLREQQARHEQLTQANQEKLQILEQ
FT                   AEVRLKQQFEHLANQLFEEKTAKVDQQNRLSLEGLLSPLKEQLEGFKKQVNDSFSHEAK
FT                   ERHTLVHELKNLQRLNEQMTREAVNLTQALKGDNKQQGNWGEVVLARVLAESGLREGHE
FT                   YQTQVSLQNEAGKRYQPDVIVYLPQDKQVVIDSKMTLVAYERYFHAESDSERAIELSNH
FT                   LAAIRAHIKGLSIKDYHQLKGIHSLDYVLMFIPVEPAFQLAIQADPSLVKDAMEQNIIL
FT                   VSPTTLLVALRTIDNLWRNERQSQNAKIIAQRASKLYDKLRLFVDDMQNLGGALDKANQ
FT                   SYQGAMNKLVTGRGNVIRQAESFKELGVEVKRPISTDLTQLAQNDSLVERHPVEDKVNY
FT                   STAVLGQENHFGPQSNRTAQEEK"
FT   CDS_pept        188429..189211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0177"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methlytransferase UbiE"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92941"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92941"
FT                   /db_xref="GOA:Q7MQ33"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ33"
FT                   /protein_id="BAC92941.1"
FT                   /translation="MTDISVQSNTALESSETTHFGFTTVAKEEKVAKVAQVFHSVAAKY
FT                   DIMNDLMSGGIHRLWKRFTIDCSGARPGQRVLDLGGGTGDLTAKFSRIVGEKGHVILAD
FT                   INNSMLNVGRDKLRDSGIVGNVHYVQANAEELPFPDDYFDIITISFCLRNVTDKDKALR
FT                   SMFRVLKPGGRLLVLEFSKPVFDPLSKVYDAYSFHLLPKMGELVANDADSYRYLAESIR
FT                   MHPDQETLKGMMQEAGFENTSYYNLTGGIVALHRGYKF"
FT   CDS_pept        189220..189825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92942"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92942"
FT                   /db_xref="GOA:Q7MQ32"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ32"
FT                   /protein_id="BAC92942.1"
FT                   /translation="MPFEPLITAVIETSLNVLVKDNPDLEKRLLRLKGQVIQVHLQELN
FT                   KTLTFIFSQQIDVLANYEGQPDCYLSLKLAVLPELREQANITKLIKQDKLILEGDIQLA
FT                   QKFAQLITDAKPDVEEWVSRVTGDVVAHSLAQGVKNVGGFVGRQEKKQQHHLAQVITEE
FT                   WRLAPGPLEVAYFCDQVDDAKSDLARLEARLQKLLEKA"
FT   CDS_pept        189822..191456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0179"
FT                   /product="putative ubiquinone biosynthesis protein AarF"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92943"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92943"
FT                   /db_xref="GOA:Q7MQ31"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ31"
FT                   /protein_id="BAC92943.1"
FT                   /translation="MTPTELKRLYRIIKVQLEYGLDDLLPDHQLAKAPRWMRKSLFWLK
FT                   NQHPEKPLGDRLRLALQELGPVWIKFGQMLSTRRDLFPPHIADPLALLQDQVSPFDGAL
FT                   AKAQMEQALGGPLETWFSDFDLVPLASASIAQVHTAKLKTTNQEVVLKVIRPDIRPIID
FT                   ADLKLMRRMASIVAKAMPEARRLKPIEVVREYEKTLLDELDLRREAANAIQLRRNFTDS
FT                   EELYVPEVYPDFSNETVMVSERIYGIQVSDITGLKANGTNMKLLAERGVSVFFTQVFRD
FT                   SFFHADMHPGNVFVNPEHPENPQWIGLDCGIVGTLNSEDKRYLAENFLAFFNRDYRRVA
FT                   ELHVDSGWVPADTNIDEFEFAIRIVCEPIFAKPLCEISFGHVLLNLFNTARRFNMEVQP
FT                   QLVLLQKTLLYVEGLGRQLYPQLDLWETAKPFLEEWMMNQVGPKALINAIKDRAPYWAE
FT                   KLPELPELLYDSLKQGKAMNQRMDQLYQGYRASKRQQATGKFLFGVGATLVVCSAILVD
FT                   HTYEQLSLATAIAGVTFWLFSWRAYRR"
FT   CDS_pept        191508..191744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0180"
FT                   /product="Sec-independent protein secretion pathway
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92944"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92944"
FT                   /db_xref="GOA:Q7MQ30"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ30"
FT                   /protein_id="BAC92944.1"
FT                   /translation="MGGISIWQLLIIAVIVVLLFGTKKLRGIGSDLGGAIKGFKKAMNE
FT                   EESEKKDADFEPKSLEQQNKQAATESKKDKEQA"
FT   CDS_pept        191748..192140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0181"
FT                   /product="Sec-independent protein secretion pathway
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92945"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92945"
FT                   /db_xref="GOA:Q7MQ29"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ29"
FT                   /protein_id="BAC92945.1"
FT                   /translation="MFDIGFWELVLIFVVGLVVLGPERLPHAIRSVARFVSAAKSMANS
FT                   VKDELAHELKVQELQENLRKAEQMGMEELSPDLKASVEQLKQAAQSVNRPYADVSAKNE
FT                   ATSSSSSDATHQTEATKTSAANTKSE"
FT   CDS_pept        192207..192956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0182"
FT                   /product="Sec-independent protein secretion pathway
FT                   component TatC"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92946"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92946"
FT                   /db_xref="GOA:Q7MQ28"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ28"
FT                   /protein_id="BAC92946.1"
FT                   /translation="MSTVEQTQPLISHLLELRNRLLKAILAVLIVFVGLIYFSGEIYEF
FT                   ISAPLVERLPEGATMIATDVASPFFTPLKLTLIVAVFLAVPFILYQVWAFVAPGLYKHE
FT                   RRLIMPLLVSSSLLFYCGVAFAYYVVFPLVFGFFTAISLGGVEFATDIASYLDFVLALF
FT                   LAFGIAFEVPVAIILLCWTGATDPKSLSEKRPYIIVGAFIVGMLLTPPDMISQTLLAIP
FT                   MCLLFEVGLFFARFYTRKEESEEQEQE"
FT   CDS_pept        complement(192992..193150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92947"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92947"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ27"
FT                   /protein_id="BAC92947.1"
FT                   /translation="MISATKIITKVRSYMCNHSIHLQRHHRSFWQKIIGIKEIYICQNC
FT                   GHTIKVR"
FT   CDS_pept        complement(193292..194062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0184"
FT                   /product="Mg-dependent DNase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92948"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92948"
FT                   /db_xref="GOA:Q7MQ26"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ26"
FT                   /protein_id="BAC92948.1"
FT                   /translation="MIDTHAHIYAKEFDQDRDQVVQRALEQGIEKILLPNIDLDSIEPM
FT                   LRTEAAYPDICHSMMGLHPCYVDNNVKQTLETIYAWFAKHSFIAVGEIGIDLYWDKTYQ
FT                   KEQEWAFVTQLNWAKELKLPVVIHTRDSIQETLKLLKAEQDGTLSGVFHCFGGSIEEAN
FT                   AINDLGFHLGLGGVTTFKNGGMDSVIPSLDLNYVILETDCPYLAPVPHRGKRNEPAYTR
FT                   LVNERIADLRQLSNEEVAKITSENAKRLFHLLDK"
FT   CDS_pept        194211..195254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0185"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92949"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92949"
FT                   /db_xref="GOA:Q7MQ25"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ25"
FT                   /protein_id="BAC92949.1"
FT                   /translation="MSVSIQGPFPARRMRRMRKHEFSRRLMAENQLSVSDLIYPMFILM
FT                   GKDRRESVESMPGVERLSIDLMLEEAQYLAQLGVPAIALFPVVNQDAKSLCAAEAYNPE
FT                   GLVQRAVRALKEHVPAMGVITDVALDPFTTHGQDGIIDEEGYVMNDETTEVLIKQALSH
FT                   AEAGADVVAPSDMMDGRIGRIRDALEEAGYIHTQIMAYSAKYASNYYGPFRDAVGSASN
FT                   LKGGNKKNYQMDPANSDEALHEVALDINEGADMVMVKPGMPYLDVVRRVKTELQVPTFA
FT                   YQVSGEYAMHKAAIQNGWLKERETVLESLLCFKRAGADGILTYFAKDVAQWLAEDNAQA
FT                   AQFLKTE"
FT   CDS_pept        195994..198867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0186"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92950"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92950"
FT                   /db_xref="GOA:Q7MQ24"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ24"
FT                   /protein_id="BAC92950.1"
FT                   /translation="MRERGFTGLDVASLADHFILCWITTTMATIPENPLILIDGSSYLY
FT                   RAFHAYPGTMSNGDIPTNAVYGVVNMLRSMMRQFASDRIAVVFDAKGKTFRDDMYPEYK
FT                   ANRPPMPDELRCQIEPLHQVIKAMGLPLIAIEGVEADDVIGTLAYQASQQGMPVLISTG
FT                   DKDMAQLVDDNITLINTMTNVVMDREGVIEKFGIPPELIIDYLALMGDKVDNIPGVPGV
FT                   GDKTATALLQGIGGLSQLYDHLDDIAALSFRGSKTMAKKLVDNKDNALLSYQLATIKLD
FT                   VALQETPESLLKTEPNKDELIKLYGQLAFKSWLNELLEGGTGVVEADEKAQTSVRSGAS
FT                   PVESEINNAAANIDRSQYQTIFDQATFDIWLDKLKASELFAFDTETDSLDYMVANLVGL
FT                   SFAVAEGEAAYVPVAHDYLDAPEQLDRDWVLAQLKPLLEDDTKAKVGQNLKYDASVLAR
FT                   YGIEMKGIKHDTMLASYVYNSVGGKHDMDSLALRFLQHSCISFEQLAGKGKNQLTFNQI
FT                   DLNEAAVYAAEDADVTLRLHNRLFANIEQDEKLNAIYQEIEVPLVPVLSRMERTGVLID
FT                   DMKLSAQSQEIAVRLGELEQKAYEIAGQPFNMNSPKQLQTILFEQMGLPVIKKTPSGTP
FT                   STAEEVLQELALDYPLPSVIMEYRGLAKLKSTYTDKLPKMINPHTGRVHTSYHQAVTAT
FT                   GRLSSTDPNLQNIPIRNEEGRRIRQAFVAPHGYKILAVDYSQIELRIMAHLSGDQALLD
FT                   AFQQGKDIHAATAAEIMGVSIEQVSSEQRRRAKAVNFGLIYGMSAFGLAKQLGIPRGEA
FT                   QTYMDKYFERYPGVMQYMEDTRSNASQHGYVETIFGRRLHLPEITSRNVMRRKAAERAA
FT                   INAPMQGTAADIIKKAMLLVDQWIQEEGNGRVKLLMQVHDELVFEVEESCLTEIESKVQ
FT                   QLMESAAQLNVPLVAEAGHGDNWDQAH"
FT   CDS_pept        complement(199672..200334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0187"
FT                   /product="predicted GTPase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92951"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92951"
FT                   /db_xref="GOA:Q7MQ23"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ23"
FT                   /protein_id="BAC92951.1"
FT                   /translation="MELTVSVKIHYQNTHFITSAPDIRHLPADEGIEIAFAGRSNAGKS
FT                   SALNRLTNQKNLAKTSKTPGRTQLINLFKVTEGCHIVDLPGYGFAQVPLEMKNKWQKSL
FT                   GEYLQKRECLKGLVVLMDIRHPMKDLDQQMIFWAIESRIPVQVLLTKADKLKSGARKAE
FT                   LLKVRKLAETFGGDVQVDVYSSLKGLGVDQLRAKLDTWFAPALAHLQEDEEGSNSAE"
FT   CDS_pept        200481..201098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0188"
FT                   /product="cytochrome c4"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92952"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92952"
FT                   /db_xref="GOA:Q7MQ22"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ22"
FT                   /protein_id="BAC92952.1"
FT                   /translation="MKKLALILSLIASCSVWAQGNIEAGKAKSQTCVACHGADGNSAIT
FT                   TYPKLAGQHAKYLEKQLKDLKLGMESAGKQGRYDPVMSGMAMPLSEQDMADLAAYYASL
FT                   PISHNTTPENVVEQGKVLYTAGDANRGIAACIACHGPRGNGTELSGFPKISGQHADYIK
FT                   AQLVKFRDASRGNDMNAMMRDIAKKLTDEDIEILSKYVGGLH"
FT   CDS_pept        complement(201516..201689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0190"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92953"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92953"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ21"
FT                   /protein_id="BAC92953.1"
FT                   /translation="MAKTVLHSFSAPIIHLFFVLSMPKGVVRHLPDDFWLSIDFLYHGL
FT                   LPKPDPLPCLNL"
FT   CDS_pept        201669..202475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0189"
FT                   /product="methyltransferase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92954"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92954"
FT                   /db_xref="GOA:Q7MQ20"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ20"
FT                   /protein_id="BAC92954.1"
FT                   /translation="MQHSFGHSVAVRKATAWLSLFLFWPFFYEIGDYLPVGSPIWGDFL
FT                   VCFASLFEEVRMHTCPLCQHDQILHYFTDKRREYLQCARCELVFVHPEQRLDAKTEKSH
FT                   YDLHENNPLDLGYRRFLSRITDPLLERIAPQSNGLDFGCGPGPTLSLMLEEHGHVMSLY
FT                   DLYYHPDRSVLRREYDFMTATEVIEHLYEPNVVWQQWLNLVKPRGWIGLMTKMVIDREA
FT                   FANWHYKNDPTHVIFFSQATFQYLAERDKLELEFIGKDVILLRKTQ"
FT   CDS_pept        202475..203020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92955"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92955"
FT                   /db_xref="GOA:Q7MQ19"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ19"
FT                   /protein_id="BAC92955.1"
FT                   /translation="MSRKKKSRKPGAAGAPEFMVTRNRSESDVAGRLRKKDKKRKGLKA
FT                   GGRNSEEGAQQKHGSSQVRDPRLGSKKKIPLIVEPAKKLTKQERRLSAEQELEMLENDA
FT                   KLNVLLDRIESGENLGRGLQQYVDEKLDRIEQLMSQLGLLEPEAEEEFEDEAPVRKSRS
FT                   DDDLLADFEDFDMDDYKG"
FT   CDS_pept        203029..203517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92956"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92956"
FT                   /db_xref="GOA:Q7MQ18"
FT                   /db_xref="InterPro:IPR019617"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ18"
FT                   /protein_id="BAC92956.1"
FT                   /translation="MSVTLLAIFGGAIILGLASYAGYLLLQLKKQKELQLQHQKLAIEK
FT                   RNANIFDSVNTLCLAGIQGQCDLSEIAIRVYCIMDYVQGEERVDFDATYPAIAELYHIV
FT                   KDMARGEERQKLEKQQRMKQNLERHKAEGRLSEAVIEELKTLQQKVKPLNNQIHIQMI"
FT   CDS_pept        203662..205053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0193"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92957"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92957"
FT                   /db_xref="GOA:Q7MQ17"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ17"
FT                   /protein_id="BAC92957.1"
FT                   /translation="MSNQNLESNQQIVWDQAVLDKYNYSGPRYTSYPTALEFHEAFTIS
FT                   DYDMACTQYPERPLSLYIHIPFCHKLCYYCGCNKVITRHSHKADEYLDVLEHEIRQRAS
FT                   LLQGRRVTQLHFGGGTPTFLSAKQITRLMTLLREEFTFTAEAEISIEVDPREIALEMLD
FT                   HLRAEGFNRLSIGVQDFNKEVQKLVNREQDEAFIFAMVERAKQLGFRSTNLDLIYGLPK
FT                   QDRDSFAKTLEQVLSMQPGRLSVFNYAHMPQLFAAQRKIKDEDLPKAEEKMAILQNTIA
FT                   TLTDAGYQFIGMDHFALPDDELAVAQRNGVLHRNFQGYTTQGECDLVGFGVSAISMIGD
FT                   AYAQNQKELKKYYAQVNDLRHALWKGVALDGDDLLRREVIKQLICNFKLDKVAIEKQFA
FT                   VTFNQYFKEDLQLLQTFIDDALVEVDEQVIRVTLRGRLLIRNICMCFDKYLRAKARQQQ
FT                   FSRVI"
FT   CDS_pept        complement(205131..207662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0195"
FT                   /product="GGDEF family protein"
FT                   /note="with 1 transmembrane domain"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92958"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92958"
FT                   /db_xref="GOA:Q7MQ16"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ16"
FT                   /protein_id="BAC92958.1"
FT                   /translation="MYELNDSSKISLKAAVITPFVVIFLLSISLVILVQRHSYERAVVD
FT                   LSNKQLSALTENVQTHLTEYLGAPFDAGLAMAHTISFNHLYKADDTSQLQDYFLNAFQT
FT                   LYADIPQLDVIGFGSEAADYIGFRKESNGTHTLMIQDDRTDSKLVIYRGDQISKDIVSV
FT                   IPNYDPRVRPWYAPVAEKRQVMWSSIYANADERQEITLSALSPIYDKQQFVGVMVTDIR
FT                   INTFNAFLNRLQEKTKATVYIMDNDQRLVAHSAQGSVVSWGTEWSKKGDRLLATESADP
FT                   IIKQHAERAKAERMLQHEEAQQFEFETKNERYFSLLSPYTDQYGLTWFIGISISETELL
FT                   GVLPKSQQQSWLIGILVSAIGMSFCLVIFSRITRPITATATAARNLANGNWDSSMPKPG
FT                   RIHETSLLVNAFNEMANNLKASFKALHNQLVFDSLTKLYSREGLIDVSKRKLTESGSLF
FT                   MLGVNRFRDINDSLGHHNGDQLLIKVSERIQTLFDDQFLLARTGGDEFAIYAPHINQSE
FT                   EVTLTVNRLQQLFIAPFYMNDESVVMKVSIGVVITDSDSNMTRWLRNGSIALSNAKQDV
FT                   SGVSYYRPEMADASKFRTQMLAKIQDGIDSQEFIPYYQPIIELKSGKVIGAEALARWLS
FT                   KQGIISPLDFIPIAEDSGLIQKIGSQILRQACHDCAKAIAAQRWDARFQLHVNISVNQL
FT                   LRDDFVAEVSQILQETGLAATNLTLEITESRLVESAHGTLDNMHKLRALGIGIAIDDFG
FT                   TGYSSLAYLHSLPFDCLKIDRTFVEKLNRQEINNSVVAAVVNITKGFNVNVVAEGVETS
FT                   LQAELLMELGCTLAQGYLYSRPVPFDEWPSL"
FT   CDS_pept        207610..207774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0194"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92959"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92959"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ15"
FT                   /protein_id="BAC92959.1"
FT                   /translation="MMTAALREILLLSLSSYIEKASLLECLGFAPVFERVETKAQNRIS
FT                   QMGRRDGIG"
FT   CDS_pept        complement(207781..209190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0196"
FT                   /product="nitrogen regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92960"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92960"
FT                   /db_xref="GOA:Q7MQ14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ14"
FT                   /protein_id="BAC92960.1"
FT                   /translation="MSKGYVWVVDDDSSIRWVMEKTLSSANIKCETYANGESVLMALER
FT                   EVPDVLVSDIRMPGIDGIELLRQVHEKCPNLPVIIMTAHSDLDAAVNAYQKGAFEYLPK
FT                   PFDIDETLTLVERAIAHGQEQKREQMASAQTHTAHTPEIIGEAPAMQEVFRAIGRLSRS
FT                   SISVLINGESGTGKELVAHALHRHSPRSSKPFIALNMAAIPKDLIESELFGHEKGAFTG
FT                   ANSVRQGRFEQANGGTLFLDEIGDMPLDIQTRLLRVLADGQFYRVGGHSPIKVDVRIVA
FT                   ATHQNLERLVQQGKFREDLFHRLNVIRVQIPALRERKQDIEKLTQHFLLRAAEELGVEA
FT                   KTLHGSTVEILNRLNWPGNVRQLENICRWLTVMASGSEVLPSDLPSELVNEKRVVDDNN
FT                   ASGTWQETLSNWAEHALESGEKELLAYALPQFERILLEAALKHTNGHKQDAAKVLGWGR
FT                   NTLTRKLKELY"
FT   CDS_pept        complement(209209..210261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0197"
FT                   /product="nitrogen regulation protein NtrB"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92961"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92961"
FT                   /db_xref="GOA:Q7MQ13"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ13"
FT                   /protein_id="BAC92961.1"
FT                   /translation="MKVNSALSNTILSNMVTATLILDDELQIHHANPAAEQLFSQSAKR
FT                   IVHHPLSQLIQHASLDLALLSQPLQSGQSITDSDVTFVVDGKPLLLEVTVSPISIEREL
FT                   MLLMEMRKVDQQRRITQEMNQHAQQQAAKLLVRGLAHEIKNPLGGLRGAAQLLEKMLPD
FT                   PSLTEYTQIIIEQADRLRALVDRLLGPQKPGKKQQTNLHQVLEKVRQLVELESEQTLVI
FT                   ERDYDPSLPDIYIDADQIEQAMLNIVSNASQILAHQEDGKISIRTRTVHQANIHGQRCK
FT                   VAARIEIMDNGPGIPVELQDTLFYPMVSGREGGTGLGLSISQNLIDQHNGKIDVESWPG
FT                   HTNFTIYLPI"
FT   CDS_pept        complement(210390..210926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92962"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92962"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ12"
FT                   /protein_id="BAC92962.1"
FT                   /translation="MKLLFALVLSLSAPLVCAQTVYTWVDDNGVLHMSDTPNNGAKTVK
FT                   LPDLEASAPPPQVESTQSLDKPAELTKEKPKSQQQEAVPLALTLASPSHDATIRSNQGI
FT                   ITIQVQTNRKLDIGEQLQLVFDGNRYGAPQTSTLWQLKNIDRGTHIIAIQAVRSGKLIA
FT                   STSPISVHLHRTKIK"
FT   CDS_pept        complement(211124..212533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0199"
FT                   /product="glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92963"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92963"
FT                   /db_xref="GOA:Q7MQ11"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ11"
FT                   /protein_id="BAC92963.1"
FT                   /translation="MSVENVLSLIQENEVKFVDLRFTDTKGKEQHISIPSHQIDADFFE
FT                   DGKMFDGSSVAGWKGINESDMVMMPDASSAVLDPFTEEATLNIRCDILEPATMQGYDRD
FT                   PRSIAKRAEEYMRSTGLADTVLVGPEPEFFLFDDVKFATDMSGSFFKIDDVEAAWNTGS
FT                   DYENGNKGHRPGVKGGYFPVAPVDSSQDLRSAMCLVMEEMGLVVEAHHHEVATAGQNEI
FT                   ATRFNTLTTKADEIQIYKYVVHNVAHAFGKTATFMPKPLVGDNGSGMHVHQSLAKDGVN
FT                   LFAGDKYGGLSEMALYYIGGIIKHARALNALTNPSTNSYKRLVPHYEAPVMLAYSARNR
FT                   SASIRIPVVPSPKARRIEVRFPDPAANPYLAFAAMLMAGLDGIKNKIHPGEAMDKDLYD
FT                   LPAEEAAEIPKVAESLKQALEYLDNDREFLTAGGVFSDDFIDSYIELKTKEVERVNVAV
FT                   HPLEFELYYSV"
FT   CDS_pept        213064..214893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0200"
FT                   /product="GTP-binding protein TypA"
FT                   /note="involved in stress response"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92964"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92964"
FT                   /db_xref="GOA:Q7MQ10"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ10"
FT                   /protein_id="BAC92964.1"
FT                   /translation="MTTPQIDKLRNIAIIAHVDHGKTTLVDKLLQQSGTLQSRGDVEER
FT                   VMDSNDIEKERGITILAKNTAIRWNDYRINIVDTPGHADFGGEVERIMSMVDCVLLIVD
FT                   AVDGPMPQTRFVTQKAFAHGLKPIVVINKIDRPGARPDWVMDQVFDLFDNLGATDEQLD
FT                   FKVVYASALNGWASLEEGETGEDMEPLFQTIVDVVDAPNVDLDGPLQMQISQLDYSSYV
FT                   GVIGVGRVTRGKVKANQQVTIVGADGKTRNGKVGTVLGYMGLERHEVEQATAGDIIAIT
FT                   GLGELKISDTICDVNKPEALPALSVDEPTVTMTFQVNTSPFAGLEGKYVTSRNILERLE
FT                   KELVHNVALRVEQTEDPDKFRVSGRGELHLSILIENMRREGFELAVSRPEVILKEENGQ
FT                   LMEPFETVTIDVQEEHQGGIMEKIGMRKGELKDMSPDGKGRVRLDFMMPSRGLIGFQTE
FT                   FMTLTSGSGLLYHTFDHYGPHKGGNIGQRINGVLIANAAGKALTNALFNLQERGRLFIG
FT                   HGVEVYEGMVIGIHSRDNDLTVNALKGKQLTNVRASGTDDAQVLTPPITMTLEQALEFI
FT                   DDDELVEVTPENIRIRKKFLTESDRKRASREAK"
FT   CDS_pept        214970..215491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0201"
FT                   /product="predicted ATPase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92965"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ09"
FT                   /protein_id="BAC92965.1"
FT                   /translation="MDLVIISGGPGAGKTTLINALSAQGYMTFAEGSRTLIEEQSVRAD
FT                   GILPWTNLPAFAELCLALMSEQKRQASGATVAFFDRAIPDIIGYLKMGRCEVPTTLHQA
FT                   SQGYYAKVFVCKPESSIYVQDEVRPHTFAEALQIHQMLVECYRDLGYQVVEVPWGSVAE
FT                   RVAFILQYVR"
FT   CDS_pept        complement(215549..216190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0202"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92966"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92966"
FT                   /db_xref="InterPro:IPR021342"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ08"
FT                   /protein_id="BAC92966.1"
FT                   /translation="MPYLITILLTIFALTGCQSAYYSAMEKVGYHKREIMVDRVEDAKE
FT                   SQQEAQQEFTSALQALSSLTQFNGGELEEVYNQINDQYQESEKAAQEVRDRIAAIEDVS
FT                   DALFDEWQQELALYTNAKLRRSSEQKLKETKASYQQMLKAMKRAEQKMTPVLNTLRDNT
FT                   LYLKHNLNASAVGSLQGEFMSLEKEIANAISQMNAAIAESDKFLQKLNQQ"
FT   CDS_pept        216223..217176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0203"
FT                   /product="ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92967"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92967"
FT                   /db_xref="GOA:Q7MQ07"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ07"
FT                   /protein_id="BAC92967.1"
FT                   /translation="MVRTMNQLFGSDKLRLPQRAQAGIAFVRYLIARMNHDRINVNAGY
FT                   LAYITLLSIVPMLTVLLSILSKFSVFENVGSVLQSFIINNFVPASGDAVHAALQEFIAN
FT                   TGKMTAVGAAFLFVAALMLISNIDKNLNYIWRVKKKRRAVFSFSMYWMVLTLGPILVGA
FT                   SIAATSYITSLRLLDSEAISTVYDQLLRWLPFILSSSAFVGLYLLVPNKKVQFSHAVVG
FT                   AMIAAVLFELSKKGFAAYITQFPSYQLIYGALAAIPILFVWVYLCWLIVLIGAEVTAAL
FT                   GEREHWRPTEDVIQSLPNNDTELEKDTQRDRFDSES"
FT   CDS_pept        217151..217585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0204"
FT                   /product="D-Tyr-tRNAtyr deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92968"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92968"
FT                   /db_xref="GOA:Q7MQ06"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ06"
FT                   /protein_id="BAC92968.1"
FT                   /translation="MIALIQRVSEAAVRVDGEVVGQIDKGLLVLLGVEKDDDEAKAKRL
FT                   MERVTTYRVFEDSEGKMNLNVQQVDGKVLVVSQFTLPADTKKGTRAGFSRGAHPADAER
FT                   LYDYFSDLCQQVLPTERGRFAADMKVSLINDGPVTFWLQV"
FT   CDS_pept        217628..218554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0205"
FT                   /product="predicted acetyltransferase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92969"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92969"
FT                   /db_xref="GOA:Q7MQ05"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ05"
FT                   /protein_id="BAC92969.1"
FT                   /translation="MFKLITPETDNQLNKYFHFRWQMLREPWRMPIGSERDEYDPMSHH
FT                   RMIVDGRGRPIAIGRLYITPDNEGQIRYMAVKGNRRSKGMGSLVLVALESLARQEGAKR
FT                   LVCNAREDAISFYQKNGFERRGELTDERGPVRHQQMVKPLDPMANVLRKPEWCTELQDR
FT                   WEKQIPIADKMGIKINQYTGYQFECCAQLNPNLNPHNTLFAGSAFTLATLTGWGMAWLL
FT                   LKERGLKGDIVLADSNIRYRHPVDKTPIASTSLDGISGDLDRLASGRKARIVILVTIYS
FT                   GDVAAVEFTGTYMLLPNYKKQLEQQQA"
FT   CDS_pept        complement(218570..220510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92970"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92970"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ04"
FT                   /protein_id="BAC92970.1"
FT                   /translation="MKKALISVALLLIVIALIPISILVSLQTRYASQVFNQLNQFSGLG
FT                   MQAESVHYQYPDHFSFKNVSFTHNEVSYIEQLEIWLSPELYANGRVQIASVLLDGLSLQ
FT                   TGLSRSPKTFIPNTVQIHQLAISNLDYADNQLSARGIKFQVKQPQWQRSDQFIPFGEIQ
FT                   FSAQQLYWQGEAFNQPLLDIDYKPQDSALYGLSLSWRGAKVSGQAEQYPQGWSLVNVTV
FT                   EGLDLSQQQLTSILAKPWDRFGSQITHINSLDILRSSLALEDYRLINFELSSENLTLPF
FT                   SLWQQQQGLISFSAESVQDQHNVWVEPRIKFTLDPNAINVEEASAQWQQGNLLFSGTLK
FT                   PDAIELDQLMVNNVKWAAEQPGEGAWLWQWLENASHVSVERLNIERSQFIQLIHQPYWQ
FT                   LSGLNIDGEKLLLKQEQQLGLWQGKLRATAANASYQDILSSHPLVEMHSDDGLWQLDRL
FT                   FAPLKQGYIEAYGQLQLNSLSKPWQATLNADGLPMGLLLSQLPLPFDLNAISSIDVSAT
FT                   GLGGDWAMFSHSLTGGVHARLHEAYTPFDEGNILPLQVSEISLSMERGKLTLAPIKLQG
FT                   PDIEGTIGGASDLTAPEQGGIRYQVKMGCQQLSGDMMSDEHQRVNQCPEQSQAAQETPQ
FT                   AQTEEAANAAS"
FT   CDS_pept        complement(220634..222262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0207"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92971"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92971"
FT                   /db_xref="GOA:Q7MQ03"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ03"
FT                   /protein_id="BAC92971.1"
FT                   /translation="MTVMEHTKAASIDLTKHGLRNVKEVVRNPSYEMLFAEETRADLEG
FT                   YEKGVVTELGAVAVDTGIFTGRSPKDKYIVKDATTEEHMWWTTPAVPNDNKPITQEVWN
FT                   DLKQLVTNQLSGKRVFVIDGYCGANPDTRLSIRVITEVAWQAHFVKNMFIRPTEEELAS
FT                   FEPDFVVMNGAKCTNQKWKEHGLNSENFTVFNLTERMQLIGGTWYGGEMKKGMFAMMNY
FT                   FLPLKGIASMHCSANMGKEGDVAIFFGLSGTGKTTLSTDPKRALIGDDEHGWDDDGVFN
FT                   FEGGCYAKTIKLSKEAEPDIYNAIRRNALLENVTVRNDGSINFDDGSKTENTRVSYPIH
FT                   HIENIVKPVSKGGHANKVIFLSADAFGVLPPVSKLTPEQTKYHFLSGFTAKLAGTERGI
FT                   TEPTPTFSACFGAAFLTLHPTKYAEVLVKRMEEAGAEAYLVNTGWNGSGKRISIQDTRG
FT                   IIDAILDGSIEEAPTKHVPIFNLEVPTSLPGVDPTILDPRDTYVDPLQWESKAQDLAQR
FT                   FINNFAKYTDNAEGQSLVAAGPQLD"
FT   CDS_pept        complement(222596..223471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0208"
FT                   /product="disulfide bond chaperone"
FT                   /note="HSP33 family"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92972"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92972"
FT                   /db_xref="GOA:Q7MQ02"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MQ02"
FT                   /protein_id="BAC92972.1"
FT                   /translation="MASNVLNRYLFEDLSVRGELVQLDEAYQRIISSKDYPAALQKLLG
FT                   ELLVSTTLLTATLKFEGSITIQLQGDGPVSLAVINGDNEQKIRGVARWEGHIADDATLH
FT                   DMMGKGYMVITIEPKKGERYQGIVGLEGDNLEQVLEGYFERSEQLKTRIWIRTGEHEGK
FT                   AHAAGMLIQVMPDGTGSENDFEHLEQLTNTVKNEELFTLPANELLYRLYNQEQVRLFEP
FT                   QNVEFRCGCSRERSGAAIVTVDKNEIYDILASDGSVSLHCDYCGTTYSFDESDVNKLYE
FT                   EAASEPKTLH"
FT   CDS_pept        complement(223503..223895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0209"
FT                   /product="ribosome-associated heat shock protein"
FT                   /note="implicated in the recycling of the 50S subunit, S4
FT                   paralog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92973"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92973"
FT                   /db_xref="GOA:Q7MQ01"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ01"
FT                   /protein_id="BAC92973.1"
FT                   /translation="MTMSSPNEAVRLDKWLWAARFYKTRSIARDMVDGGKVHYNGQRAK
FT                   PSKIVEVGAVLKLRQGNEEKTVVIEKLSTQRRGAPEAQTLYSETQESQAKREAQAMQRK
FT                   LNAHNPSPDRRPDKKQRRDIIKFKHQ"
FT   CDS_pept        complement(223905..224102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0211"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92974"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92974"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MQ00"
FT                   /protein_id="BAC92974.1"
FT                   /translation="MEKCSPKTARYAVVASINLASTQSFALYHSLLVTRLSDSDFANCL
FT                   EKFAVSHHCKVQDSIIHSSD"
FT   CDS_pept        223925..224086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0210"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92975"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92975"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPZ9"
FT                   /protein_id="BAC92975.1"
FT                   /translation="MNLALYNGDLPQIFQGSWQNRNQRGVSQASCDIVQSSVSKRDLST
FT                   QQQHNVLF"
FT   CDS_pept        224117..224257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0212"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92976"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92976"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPZ8"
FT                   /protein_id="BAC92976.1"
FT                   /translation="MRAIIFSRIKKDKSQCVQAKKAKAQNLNSERNRLSETIRAECRIG
FT                   Q"
FT   CDS_pept        224220..225149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0213"
FT                   /product="type II secretory pathway, component EpsC"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92977"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92977"
FT                   /db_xref="GOA:Q7MPZ7"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPZ7"
FT                   /protein_id="BAC92977.1"
FT                   /translation="MKPSELSAGLANSPLLTRMIANNGMIQSRASALLAGVLVALTGWT
FT                   LGQVVWLTQESNTQIVAWRPAPQQNAQGKQGERLNLADLQAINLFGVYNENKPKPVVSQ
FT                   PVVQDAPKTRLNLVLVGAVASSNPQTSLAVIANRGQQATYGVGEEIEGTRAKLKAVLVD
FT                   RVIIDNEGRDETLMLEGVEYKKLSESAPRVIPSSTIAKNNPPDTDEQLAQIREEITADP
FT                   QKIFQYVRLSQVKQEDKVIGYRVSPGKSPQLFEAVGLQDGDIAVQLNGNDLTDPAAMGK
FT                   IFNAVSELTELNLTVERDGQQHDIYIQF"
FT   CDS_pept        225186..227204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0214"
FT                   /product="type II secretory pathway, component EpsD"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92978"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92978"
FT                   /db_xref="GOA:Q7MPZ6"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPZ6"
FT                   /protein_id="BAC92978.1"
FT                   /translation="MKHWFSKSAWLLAGTLACSSGVLANEFSASFKGTDIQEFINIVGR
FT                   NLEKTIIVDPSVRGKIDVRSYDVLNEEQYYSFFLNVLEVYGYAVVEMENGVLKVVKSKD
FT                   SKTSAIPVVSDDTVKGDNVITRVVAVRNVSVRELSPLLRQLIDNAGAGNVVHYDPANII
FT                   LITGRAAVVNRLAEIIKRVDQAGDTEIEVVELGNASAAEMVRIVDALNRTTDAKNTPEF
FT                   LQPKLVADERTNSILISGDPKVRDRLKRLIRQLDVEMASKGNNRVVYLKYAKAEDLVDV
FT                   LKGVSDNLQAEKNSGQKGASSQRNDVVIAAHQGTNSLVLTAPPDIMLALQDVITQLDIR
FT                   RAQVLIEALIVEMAEGDGVNLGVQWGNLETGAVIQYSNTGTPIGKVMVGLEEAKDQTKT
FT                   EYYTNKDGDRVPYQVTESGDYSTLAAALAGVNGAAMSLVMGDWTALISAVSSDSNSNIL
FT                   SSPSITVMDNGEASFIVGEEVPVITGSTAGSNNDNPFQTVDRKEVGIKLKVVPQINEGD
FT                   SVQLNIEQEVSNVLGANGAVDVRFAKRQLNTSVIVQDGQMLVLGGLIDERALESESKVP
FT                   LLGDIPILGHLFKSTNTQVEKKNLMVFIKPTIIRDGMTADGITQRKYNYIRAEQLYKAD
FT                   QGLKLMDDGHIPVLPKFGEDKRHPAEIQAFIDQMEQQ"
FT   CDS_pept        227204..228703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0215"
FT                   /product="type II secretory pathway, ATPase EpsE"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92979"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92979"
FT                   /db_xref="GOA:Q7MPZ5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPZ5"
FT                   /protein_id="BAC92979.1"
FT                   /translation="MVDILDTAPSYRRLPFSFANRFKMVLEIEHPERPPVLYYVEPLNA
FT                   QALVEVRRVLKQTFVPQAIAAEAFEKKLTEAYQRDSSEARQLMEDIGSDDDFFSLAEEL
FT                   PQDEDLLETEDDAPIIKLINAMLGEAIKEGASDIHIETFEKILSIRFRVDGVLRDVLSP
FT                   SRKLAPLLVSRVKVMAKLDIAEKRVPQDGRISLRIGGRAVDVRVSTMPSSHGERVVMRL
FT                   LDKNATRLDLHSLGMTPVNHDNFRHLISRPHGIILVTGPTGSGKSTTLYAGLQELNSNE
FT                   RNILTVEDPIEFDIDGIGQTQVNPKVDMTFARGLRAILRQDPDVVMVGEIRDLETAQIA
FT                   VQASLTGHLVMSTLHTNTAVGAITRLRDMGIEPFLISSSLLGVLAQRLVRTLCQDCKEP
FT                   YEADKEQRKLFGAKKKDALTLYRAKGCEKCNHKGYRGRTGIHELLMVDDKVQELIHAEA
FT                   GEQAMDKYIREHTPSIRSDGLDKVLQGVTSLEEVMRVTKES"
FT   CDS_pept        228703..229920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0216"
FT                   /product="type II secretory pathway, component EpsF"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92980"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92980"
FT                   /db_xref="GOA:Q7MPZ4"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPZ4"
FT                   /protein_id="BAC92980.1"
FT                   /translation="MAAFEYKALDAKGRTKKGTLEGDNARQVRQRLKEQGMVPIEVMET
FT                   KAKLAKSKSSGGFKRGISTPELSLITRQISTLVQSGMPLEECLKAVSDQAEKPRIRGML
FT                   AAVRAKVTEGYTLADSLSDYPHIFDELYRSMVAAGEKSGHLDAVLERLADYCENRQKMR
FT                   SKLLQAMIYPVVLVVFAVTIVAFLLATVVPKIVEPIIQMGQELPQSTQFLLAASEFVQE
FT                   WGLLLLGSIVFAIYLLKTALKKPNVRMAWDRRILSLPLLGKISKGLNTARFARTLSICT
FT                   SSAIPILEGMRVAVDVMSNQFVKQQVLLAADSVREGASLRKALDQTRLFPPMMLHMIAS
FT                   GEQSGELESMLTRAADNQDQSFESTVNIALGIFTPALIALMAGLVLFIVMATLMPMLEM
FT                   NNLMSG"
FT   CDS_pept        229935..230417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0217"
FT                   /product="type II secretory pathway, pseudopilin EpsG"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92981"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92981"
FT                   /db_xref="GOA:Q7MPZ3"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPZ3"
FT                   /protein_id="BAC92981.1"
FT                   /translation="MAWSFGLIILEKTMQNKAKKQAGFTLLEVMVVVVILGILASFVVP
FT                   NLLGNKEKADQQKAITDIVALENALDMYKLDNSVYPTTDQGLEALVTKPSSPEPRNYRD
FT                   GGYIKRLPKDPWGNEYQYMSPGDKGTIDIFTLGADGQEGGEGAAADIGNWNMQDFQ"
FT   CDS_pept        230344..231048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0218"
FT                   /product="type II secretory pathway, pseudopilin EpsH"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92982"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92982"
FT                   /db_xref="GOA:Q7MPZ2"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPZ2"
FT                   /protein_id="BAC92982.1"
FT                   /translation="MQMVKKAVKAQRQILATGTCKTSNNGTSSRRGNHLKPRFSSRLAG
FT                   FTLIEILLVLVLLSLTAVAVIATLPTRSDERGKKYAQSFYQRLQLLNEEAVLSGKDFGV
FT                   RIEEEKSRYTLLKLEADGWQTLELNKIPATTELEDEVAMQLTLGGGAWQQDDRLFKPGS
FT                   LFDEEMFADEEKEKKQRPPQIFILSSGELTPFSLSFYPDDQDATENGWRVRAKDTGQII
FT                   LLAPGEEEQDDG"
FT   CDS_pept        230969..231403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0219"
FT                   /product="type II secretory pathway, pseudopilin EpsI"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92983"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92983"
FT                   /db_xref="GOA:Q7MPZ1"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="PDB:2RET"
FT                   /db_xref="PDB:3CFI"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPZ1"
FT                   /protein_id="BAC92983.1"
FT                   /translation="MVGEYEPKTQGRLFCWPPVKKSKTMVKRRKYAGMTLLEVLVALAI
FT                   FATAAMSVIRAVSQHINTVGYLEQKMFAAMVADNQMAMVMLNPKNLKASNGEEELAGQT
FT                   WYWKVAPVATTQPLLKAFDVSVAAEKQASPIITVRSYVAK"
FT   CDS_pept        231390..232091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0220"
FT                   /product="type II secretory pathway, component EpsJ"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92984"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92984"
FT                   /db_xref="GOA:Q7MPZ0"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="PDB:2RET"
FT                   /db_xref="PDB:3CFI"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPZ0"
FT                   /protein_id="BAC92984.1"
FT                   /translation="MWRNKTCRKRNTRQRGFTLIEVLVSIAIFATLSVAAYQVVNQVQR
FT                   SNELSQERTARLNELQRALVMMDSDFRQIALRQTRTNGEEPSKKLLHWADYLLDSDSKG
FT                   IMFARLGWHNPQQQFPRGEVTKVGYRIKDERLERVWWRYPDTPAGQEGVVTPLLSDVEE
FT                   LNVRFYDGKQWINEWSNELALPAAISVELTLKDYGKIARTYLTPEGNLQKQASGSEDSG
FT                   QNNSGGAGNNG"
FT   CDS_pept        232066..233106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0221"
FT                   /product="type II secretory pathway, component EpsK"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92985"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92985"
FT                   /db_xref="GOA:Q7MPY9"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPY9"
FT                   /protein_id="BAC92985.1"
FT                   /translation="MVEQATMAKSNRSRQSGVALIIILLLLAIMATIAGSMSERLFAQF
FT                   KRGTNQISYQQAYWYSIGVEALAKVGIEQSYKDSDTINLNQPWALEEKTYPLDYGQAKG
FT                   RIFDKQACFNLNALSPVVMQDAAVERPYLVKVFRALLEESGVESYESEVIADSMWEFVD
FT                   PNDAVRSSSGVEDSTYEGMKPAYLAANGYIADSSELRAVYQVSGEMMATLQPLVCALPT
FT                   DEWRLNVNTISAEQAALLVALFSPALSESDAKQLIEKRPFDGWANIDAFLSESEMAGIS
FT                   EEIKKLAKAYLGVDSRYFELDAQVLVEDSRVRIRSLMYSKNRETVTVVRRRFGGISERV
FT                   SDRSAE"
FT   CDS_pept        233075..234274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0222"
FT                   /product="type II secretory pathway, component EpsL"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92986"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92986"
FT                   /db_xref="GOA:Q7MPY8"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPY8"
FT                   /protein_id="BAC92986.1"
FT                   /translation="MSEFLTVRLSSEQYSPIPWLVWSSSQQEVIASGELSDWQQLDDLK
FT                   NYAEQRPIVVLVAASDVVLTEVDIPPGASRQFESMLPYLLEDEIAQDVDDLHFSVLAKE
FT                   NGKAQVCGVDRRWLQHMLDAFRAQGLDVKRVLPDSLALPLDDEGISAAQLGEQWLFRHS
FT                   ACQGSAVDDSWMPVYLNALAGEQPLSVACFSSLPEQQGQAHWLSRPVEMTMALLSQGVA
FT                   DGKFSLLTGEFKPKSSFFKHWKVWQKVAISGSLLIAALVAQQVLTIQRYESQAQAYREE
FT                   SERIFRQVMPGRNKIPTVSYLKRQMEDEIRRLSGGGTGDSMLQWMAQLPGTIGQVKNFE
FT                   VLSIKYDGNRGEVRIQAKSNDFQIFEQARVKLSEQFEVEQGQLNRTGDAVIGSFVLKRK
FT                   "
FT   CDS_pept        234282..234773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0223"
FT                   /product="type II secretory pathway, component EpsM"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92987"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92987"
FT                   /db_xref="GOA:Q7MPY7"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPY7"
FT                   /protein_id="BAC92987.1"
FT                   /translation="MTNLLNMFQAWWSSISQREQRLVVVCGVFGLIGLIYWGVLQPINA
FT                   RAEQAQLRIQSEKQLLSWVSEKADELTGLRASGGVSFSNQPLNQVIASSARQFKVELQR
FT                   VQPRNEMLQVWVAPMPFNRLVDWLTFLKEKQGIEVEFMDIDRGKESGLVEVNRLQFKRG
FT                   "
FT   CDS_pept        234775..235536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0224"
FT                   /product="type II secretion pathway protein N"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92988"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92988"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPY6"
FT                   /protein_id="BAC92988.1"
FT                   /translation="MKRAIIYSLIFILFFSISLLSSIPVSFALNYLPPVRGLTIEGTSG
FT                   TVWQGSASTIRWQGQSFGEVHWDFQTSKLFTGNVQYALRFGRGSDLNLRGKGLVGYGLG
FT                   QGVYVENLVASLPAEKVASRLPMPLPLQVEGQVEVNVRHAVYQAPWCASGTGTLVWSAS
FT                   KVGTPIGALDLGPVISDFTCENSQLSVKGEQQSAQVSAQFSAQVTPNRQYTTSAWFKPG
FT                   AEFPAAMKSQLSWLGNPNGQGQYEFDYQGRF"
FT   CDS_pept        complement(235662..236489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0225"
FT                   /product="3'-Phosphoadenosine 5'-phosphosulfate (PAPS)
FT                   3'-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92989"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92989"
FT                   /db_xref="GOA:Q7M7K9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M7K9"
FT                   /protein_id="BAC92989.1"
FT                   /translation="MPTSQDLSALLPQVIDIARTAGQLILDIYQSKQYQEYTKSDETPV
FT                   TSADLAAHKLITQRLSELTPDIPVLSEEAADISLEQRAQWNRYWLVDPLDGTQEFIARS
FT                   GDFATIIALVENNKPVMGVVYGPVSGVTYYAYQGKGAWKIPEMNESLKIQTHKHELPGQ
FT                   NIAIAISRRQDINRITSRMSSSWNYDLVPLGSAALKACLVAEGAVDCYLRLGPTGEWDT
FT                   AATQCIVEEAGGRILSTYLEPLSYNERDTLENPNFIVLGDADLPWNDILQVKG"
FT   CDS_pept        complement(236504..237058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0226"
FT                   /product="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92990"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92990"
FT                   /db_xref="GOA:Q7MPY5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPY5"
FT                   /protein_id="BAC92990.1"
FT                   /translation="MSRRKEPDILNRNVVAQSRLFSIESLELRFSNGEERIYERLKPSG
FT                   KNAVMMVPVTEQGDLLLVREYAAGTERYELGFPKGLIDQGESAEQAADRELKEEIGFGA
FT                   KQLTPLKQVVLAPSYFSSKMTLFLAQDLYPETLEGDEPEPLEVVRWPLVQAEELLHHLD
FT                   FCESRSITALLLALRALRPAK"
FT   CDS_pept        complement(237174..237857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0227"
FT                   /product="thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92991"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92991"
FT                   /db_xref="GOA:Q7MPY4"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPY4"
FT                   /protein_id="BAC92991.1"
FT                   /translation="MRSKACFLIKTLDPFVIRSKMASITYKFTRVFVVSNITITEAAQT
FT                   HFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELS
FT                   LPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGG
FT                   HVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRG
FT                   DHSYY"
FT   CDS_pept        complement(237889..238695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0231"
FT                   /product="predicted amidophosphoribosyltransferase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92992"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92992"
FT                   /db_xref="GOA:Q7MPY3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPY3"
FT                   /protein_id="BAC92992.1"
FT                   /translation="MLIFPLTPTFSSLKRHMWSSTLATRFIRPTARMLTDWLSEKILRS
FT                   LPRLCHLCGLPMNHDHHPLWCLHCLTLFDAEPRCQRCGLPTLTVVPQCGQCLKSPPPWQ
FT                   RLYCLTPYRFPASHYVNQIKHQRKFWYCASLAPLLIQRIDRPAPLLLSVPMHWRRQWLR
FT                   GFNQSDVLAAQLARRLNRPFLAHAFTRLLHTPPQQGLNKQQRQRNLAGAFRLNRSALPH
FT                   AIPKHVAIVDDVVTTGSTVRQLCQLLLAVGVESIDIYCLCRTPEKD"
FT   CDS_pept        238216..238347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0228"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92993"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92993"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPY2"
FT                   /protein_id="BAC92993.1"
FT                   /translation="MPTPMHRHREQQWRGAINALDEQRSQAGAVPELALMFDLIDVV"
FT   CDS_pept        238422..238583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0229"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92994"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92994"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPY1"
FT                   /protein_id="BAC92994.1"
FT                   /translation="MGQPLTSAARNVGNAVRHRTGLGSAGTKAGDGRDSSASRTDDRGE
FT                   EEIGVFFH"
FT   CDS_pept        238607..239455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0230"
FT                   /product="biotin biosynthesis protein BioH"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92995"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92995"
FT                   /db_xref="GOA:Q7MPY0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPY0"
FT                   /protein_id="BAC92995.1"
FT                   /translation="MGRMNRVASVLDHMWRLRLEKVGVRGKMSTDLHWQTQGQGPDLVL
FT                   LHGWGMNGAVWQQVVERLEPHFRLHVVDLPGYGHSAHLHAASLEEIAQQLLEHAPKQAI
FT                   WVGWSLGGLVATHMALHHADYVSKLVTVASSPKFAAEARWRGIQPQVLSAFTEQLSEDF
FT                   HITVERFMALQAMGSPSARQDVKNLKQAVFSRPQPNPQSLLAGLQMLAEVDLRDHLPHL
FT                   TMPMLRLYGRLDGLVPIKVAQDLEKALPASEQFIFTQSSHAPFITEPESFCHQLLSFAG
FT                   K"
FT   CDS_pept        complement(239387..239509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0232"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92996"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92996"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPX9"
FT                   /protein_id="BAC92996.1"
FT                   /translation="MVTSCIDQYLNRFNFIFRLLAGKAQQLVAKALWFSDKRRV"
FT   CDS_pept        239593..240063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92997"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92997"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPX8"
FT                   /protein_id="BAC92997.1"
FT                   /translation="MIVSPTTVSVPLIAPSVNVQTEQAARDNRVREPVAPTVALAKSNA
FT                   ERKVKSDDKRRRQSSWDPSEHPGYEMETNTQEISVYHEDPKDTLERLFGLLALRSYSEE
FT                   QGKGYAMRYRLPKRILDAAIREGIMEKRRAIIKYHYGHSVAPHTPSEVIAVL"
FT   CDS_pept        complement(240147..242438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0234"
FT                   /product="transcriptional accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92998"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92998"
FT                   /db_xref="GOA:Q7MPX7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPX7"
FT                   /protein_id="BAC92998.1"
FT                   /translation="MSQAICRLIAQELNVRPEQVTAAVALIDDGNTVPFIARYRKEVTG
FT                   GLDDTQLRNLDSRLSYLRELDDRRQTILKSIQEQGKLTAELESEILTADSKTRLEDLYL
FT                   PYKPKRRTKGQIAIEAGLEPLADTLWNHPQTEPESEAIRYINADKGVEDSKAALDGARA
FT                   IIMERIAEDANLLEKIRQYLNRHAEIVSRVVAGKEHEGEKFKDYFEHNEAISKVPSHRA
FT                   LAMLRGRNEGFLSLTLNADPQQEESVRQSYCETLIADHYGVTLSNAPADNWRKQVISWA
FT                   WRIKVSMHMETELMAAMKERAEIEAIEVFATNLKDLLMAAPAGPRATLGLDPGLRTGCK
FT                   VAVVDATGKVLATDTIYPHVPQNQYDRAMQTVAALIKQHNVDLIAIGNGTASRETDAFA
FT                   ADLIQRGNLKVQKIMVSEAGASVYSASELAAKEFPNMDVSLRGAVSIARRLQDPLAELV
FT                   KIDPKSIGVGQYQHDVSQSMLAKRLDAVVEDCVNAVGVDVNTASAALLTRVAGLSTTLA
FT                   QNIVDFRDEHGRFDSRTTLKKVPRLGPKAFEQCAGFLRIMDGKNPLDASSVHPEAYPVV
FT                   KAIAEKNQKAVKALIGDSSFLKGLRAVDYTDEHFGVPTVTDIIKELDKPGRDPRPEFKT
FT                   ATFAEGIHNVSDLEVGMILEGVVSNVANFGAFVDIGVHQDGLVHISALTDRFVSDPREV
FT                   VKAGDIVKVKVMEVDVQRKRIALSMRLNDEPGQDNRSQRAAAPRRHDNDNTLGGAMGGA
FT                   FAAAFAKAKK"
FT   CDS_pept        242599..243156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0235"
FT                   /product="transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC92999"
FT                   /db_xref="EnsemblGenomes-Tr:BAC92999"
FT                   /db_xref="GOA:Q7MPX6"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPX6"
FT                   /protein_id="BAC92999.1"
FT                   /translation="MTGKARQNSLLFAPSDSVRAIKGKFVKTKMITREGYNKLKQELDY
FT                   LWKEHRPEITQKVSWAASLGDRSENADYTYNKRLLRQIDRRVRFLSKFLPEVKIVDYAP
FT                   QQEGKVFFGAWVEIENEAGEVMKFRIVGPEEIYGDAKGYISIDSPMARALLKKEVDDEV
FT                   QVPTPSGIKEWFINSIEYDKGQ"
FT   CDS_pept        243345..244076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0236"
FT                   /product="transcriptional regulator OmpR"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93000"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93000"
FT                   /db_xref="GOA:Q7MPX5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPX5"
FT                   /protein_id="BAC93000.1"
FT                   /translation="MDGHMQENFKILVVDDDARLRALLERYLSEQGFQVRSVANGEQMD
FT                   RLLTRENFHLMVLDLMLPGEDGLSICRRLRNANNMLPILMLTAKGDEVDRIVGLEVGAD
FT                   DYLPKPFNPRELLARIKAVLRRQTIELPGAPSAEEKIVEFGEFRLNLGTREMFRGDEPM
FT                   PLTSGEFAVLKSLVTNAREPMSRDKLMNMARGREYSAMERSIDVQISRLRRMLEEDPSK
FT                   PRYIQTVWGLGYVFVPDGKPA"
FT   CDS_pept        244169..245467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0237"
FT                   /product="osmolarity sensor protein EnvZ"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93001"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93001"
FT                   /db_xref="GOA:Q7MPX4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPX4"
FT                   /protein_id="BAC93001.1"
FT                   /translation="MRFRSSFTQSIFIFITLLLASQVFSYYAVFNYALLPSLQQFNKIL
FT                   AHELNLVLDDDSALMADAPLRRQVLEQLGVTVHAADSEQAKEFDHAMTIDLMSEEMTHE
FT                   LGSPTEVRLLLGSESYILWMKIDALPGSLIRIPLSELQEEDFAPLFRNSLIVALLIIAG
FT                   GWLFIRLQNRPLIALEKAAKEVGRGEIPPPLPEKGATEIRAVTRAFNQMSRGIQELEAD
FT                   RALLMAGISHDLRTPLTRIRLATEMMSPEDSYLAEGIISDTEECNEIISQFMDYLKPVN
FT                   TQSFTEVDINGISGDVASSEGGYEVQIETAFQPSIRTAFGSPIAIKRAVSNLVVNALRY
FT                   GNGWVKISTGMTADSKLVWVCVEDNGPGIEKSQVAKLFEPFTRGDTARGSEGTGLGLAI
FT                   VKRIVSQHHGSVVVNNRSEGGLKVQLSFPTSER"
FT   CDS_pept        complement(245550..246953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0238"
FT                   /product="xanthine/uracil permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93002"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93002"
FT                   /db_xref="GOA:Q7MPX3"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPX3"
FT                   /protein_id="BAC93002.1"
FT                   /translation="MTTPNPMRKTDLIYQLNDRPPLPQTLFAALQHLLAMFVAVITPSL
FT                   IICQALGVSAEQTNTIISMSLFASGISSFIQIRTFGPIGSGLLSVQGTSFNFLGPIIGA
FT                   GLALKAGGASVESMMAAIFGTILVASFAEILLSRVLEYARRIITPLVSGIVVTLIGLTL
FT                   IQVGLVSMGGGYAALGDGTFGSLDKLALAGTVLGLIVLLNRAKNPYVRVASIVIAMLVG
FT                   YVMAYFMGMVDTRQASSSALIALPIPMQFGLSFDWSLFIPLVLIFLITALEAIGDITAT
FT                   SEVSGEPVKGPVYMKRIKGGVLADGLNSALAAVFNSFPNSTFSQNNGVILLTGVASRYV
FT                   GYFIAGMLVLLGLFPGVAGFVQLIPEPVLGGATIVMFGTIAAAGVRIISRVDLDRRAIL
FT                   IMALSFSMGLGIAQKPEILQFMPEFIKSIFSSGVAAGGITAIVLNLLLPEKLQGEEEEK
FT                   AHEPATVKR"
FT   CDS_pept        complement(247209..249290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0239"
FT                   /product="RecG-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93003"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93003"
FT                   /db_xref="GOA:Q7MPX2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPX2"
FT                   /protein_id="BAC93003.1"
FT                   /translation="MSAQLLSAVPLTSLSGVGAKVAEKLEKIGLSSVQDLLFHLPLRYE
FT                   DRTRIYPIAKLHAGLWAAVQGHVMQVDTLFGKRKMLTVKLSDGNGTITLRFFNFTAAMK
FT                   NNFAEGKLVHAYGEIKRGNMGLEIVHPDYKFFAPTQKPDVEQSLTPVYPTTDGLRQITL
FT                   RNLTDQALALLDKAAVQELLPAGLYDQQLTMGQALHIIHRPSPEIDLELFDEGKHPAQV
FT                   RLIMEELLAQNLSMLAVRSKGQQDVALPLPPVHQLKQQLLAQLPFSPTNAQARVVQEIE
FT                   EDMQKAHPMMRLVQGDVGSGKTLVAALAAVRAIEHGYQVALMAPTELLAEQHAINFANW
FT                   FEKMGIPVGWLAGKLKGKAKEAELARIASGEAKMVVGTHALFQEHVVFDHLALVIIDEQ
FT                   HRFGVHQRLELREKGAKQGAYPHQLIMTATPIPRTLAMTAYADLETSVIDELPPGRTPI
FT                   QTVAIPDTKREDIVERIRHACLNEGKQAYWVCTLIDESEVLEAQAAADTAEELQRKLPD
FT                   VRIGLVHGRMKPAEKQAVMQAFKNNELHLLVATTVIEVGVDVPNASLMIIENPERLGLA
FT                   QLHQLRGRVGRGSVASHCVLLYHAPLSKTAQKRLSVLRESNDGFVIAQRDLEIRGPGEL
FT                   LGTKQTGLADFKIADLVRDQRLIPEVQRAARYIHHNYPQNAAAIIERWLGERDIYSKA"
FT   CDS_pept        complement(249458..250144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0240"
FT                   /product="rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93004"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93004"
FT                   /db_xref="GOA:Q7MPX1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPX1"
FT                   /protein_id="BAC93004.1"
FT                   /translation="MNEERYQRIQQVLKARQTDLTLCLEEVHKPNNVSAMIRTADATGL
FT                   HKVHAVWPTEQMKTLKNTSAGARNWVEVDTHDSIADAVSALKAQGMQVLVTNLSDSAVD
FT                   FRQIDYTQPTAIILGSEKIGVSEQAKALADQDIIIPMVGMVQSLNVSVACAVILYEAQR
FT                   QREAAGMYQNDESSIDAETINRILFERGHPVLAKVAKRKGLAYPPLDDAGQIVADPEWW
FT                   ADMQKK"
FT   CDS_pept        complement(250232..252271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0241"
FT                   /product="guanosine-3',5'-bis(diphosphate)
FT                   3'-pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93005"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93005"
FT                   /db_xref="GOA:Q7M7K8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M7K8"
FT                   /protein_id="BAC93005.1"
FT                   /translation="MVARDAHEGQTRSSGEPYIIHPVAVARILADMRLDVETLQAALLH
FT                   DVIEDCDVSKEDLEAQFGHTVAELVDGVSKLDKLKFRDRKEAQAENFRKMVLAMVQDIR
FT                   VILIKLADRTHNMRTLGALRPDKKRRIARETLEIYSPLAHRLGIHNIKTELEELGFEAL
FT                   YPNRYRVLKEVVKSARGNRKEMIQRIHSEIEGRLQEVGLQARVLGREKNLFSIYNKMKT
FT                   KEQRFHTIMDIYAFRVVVDTADTCYRVLGQVHSLYKPRPGRMKDYIAVPKANGYQSLHT
FT                   SMVGPHGVPVEVQIRTEDMDQMADKGVAAHWSYKGNGERTGTTAQVKAQRWMQSLLELQ
FT                   QSAGNSFEFIENVKSDLFPDEIYVFTPKGRIVELPVGATAVDFAYAVHTDVGNTCVGAR
FT                   VDRNPYPLSKALKNGQTIEIISAPGARPNAAWLNYVVTSRARTKIRQVLKTMRREESIT
FT                   LGRRLLNHALGEHSLADISPENLNHVLSDLKIQSLDDLLAAIGLGERMSIVIARRLLGD
FT                   ADELTELRSNDSKTKKKLPIRGSEGLLLTFANCCHPIPDDHIIAHVSPGRGLVVHRETC
FT                   PNVRGYQREPDKYMAVAWSDDYDQEFIAELKVDMLNHQGALAELTNVISKTGSNIHGLS
FT                   TEERDGRLYTVTVLLTTKDRVHLAGIMKKIRVMPSCSRVRRRKN"
FT   CDS_pept        complement(252387..252659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0242"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93006"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93006"
FT                   /db_xref="GOA:Q7MPX0"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPX0"
FT                   /protein_id="BAC93006.1"
FT                   /translation="MARVTVQDAVEKVGNRFDLVLIAARRARQMQTGGKDSLVPEENDK
FT                   PTVIALREIEEGLITKEVLDARERQEQQEQEAAELAAVSSIARNR"
FT   CDS_pept        complement(252786..253409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0243"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93007"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93007"
FT                   /db_xref="GOA:Q7MPW9"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPW9"
FT                   /protein_id="BAC93007.1"
FT                   /translation="MGKGTLYIVSAPSGAGKSSLISAMLEKNPTYAMKVSVSHTTRGMR
FT                   PGEQDGVHYHFVEKEHFEDLITKGEFLEYAEVFGNYYGTSRVWIENTLDKGIDVFLDID
FT                   WQGARQIREQMPHAKSIFILPPSNGELERRLNTRGQDSEAVIAKRMAEAKSEISHYNEY
FT                   DYVIINDDFDTALMDFKAIIRAERLKQDKQAAKYSGMLDALLAE"
FT   CDS_pept        complement(253695..254912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0244"
FT                   /product="TPR-repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93008"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93008"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPW8"
FT                   /protein_id="BAC93008.1"
FT                   /translation="MMKSFKNVLASLTLIAGVILTPAQAKEAPELSDRTFRTVNKVQEL
FT                   IATEKYSAALEKLSDALEGTTKKYDRAVLLQQTGFLYSLKEDYKNAAKYFAESLKLEAL
FT                   PVPVAQQVRYSLAQLYLSEEKYKQSVETMKTWFEIAKTTDEKPQAHAYITLASAYVQMD
FT                   DYKNAIAPTKQAIAMSKNPSESWYLLLMASHYELKQLKEVVGVLKILTTKYPEKKRYWM
FT                   QLSGTYMELNQERNALSALEMAYKMGLLDEEKEFLRLVNFLAYQNIPYRAAKTLQTELD
FT                   NGNITRNQDNLERLASFWQQAKELDKAIDTYQQAYALAPTAKSQIRIARLMLQDKQFDK
FT                   ATEFTGTPAADAKLDQKAELEYVRGLAYFELKDSQRALRSMQSAAQSEKMRQVVSPWIT
FT                   YLAGQG"
FT   CDS_pept        complement(254923..255555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0245"
FT                   /product="periplasmic protein TonB2"
FT                   /note="links inner and outer membranes"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93009"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93009"
FT                   /db_xref="GOA:Q7MPW7"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPW7"
FT                   /protein_id="BAC93009.1"
FT                   /translation="MRYLASIALALVVSLGLFWGMDKLVNKERHELASNDDLRMVDFIR
FT                   VKPEEKVQEKKRELPKPPPPKRPPPPPEMKITSTVKPVMEQIPMDMPKLDLPVNITGGS
FT                   VLGHYSQGGGAQVAGTGGPMPLATFQPQMPRKAAKAGLEKGLVVLEFTVNERGGVEDIK
FT                   VLKEEPRRMDLGKEARKTVSKWTFKPKMVDGKPVSSRMAQEIEFSVN"
FT   CDS_pept        complement(255560..255967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0246"
FT                   /product="tonB system transport protein ExbD2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93010"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93010"
FT                   /db_xref="GOA:Q7MPW6"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPW6"
FT                   /protein_id="BAC93010.1"
FT                   /translation="MKRRYSSDSNDEMAIDMTPMLDIVFIMLIFFIVTTSFVKEAGIDV
FT                   NRPSANSAQTVAKGNIMVAVGAAGDVWIDKRRVEVDAVRANVERLRAESPDGAVVIQAD
FT                   EEANAGVVVKVMDQIRMAGVANISIAATNKD"
FT   CDS_pept        complement(256049..256576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0247"
FT                   /product="tonB system transport protein ExbB2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93011"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93011"
FT                   /db_xref="GOA:Q7MPW5"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPW5"
FT                   /protein_id="BAC93011.1"
FT                   /translation="MWWLIEELESIRRFLGMGGDVLVAIFVLSFMLWVVLLERWFYFIA
FT                   VAPRAMKQALATWTERTEHTSWNARMIRQEIISRQDIENKKGLPIVKVLIALCPLLGLL
FT                   GTVVGMIQVFDILAIVGTGSPRAMASGISKATIPTLAGMVASLSGLFFSTRLDHLAKVT
FT                   TRKLEDKLKHIA"
FT   CDS_pept        complement(256586..257947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0248"
FT                   /product="putative TolR protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93012"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93012"
FT                   /db_xref="GOA:Q7MPW4"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR017270"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPW4"
FT                   /protein_id="BAC93012.1"
FT                   /translation="MKGFKTIAAALLASLFMVSGAHAEAPKSLNELLKNVKSESIVESK
FT                   ENKAREQEFLADRNKQAELLKQAKAQLKAETALGEQLKATFDDNDKKLTELTETLRQRS
FT                   GTLGEMFGVVRQYAGEFKGLFNASQNAVQFPQRDALLTKLAESKELPSTEELESFWHTV
FT                   LQQIIVSGETSTTPATVVYGEGKEAVRDVTLVGEFNAIADGKYVTYVPQTGKFEELSRQ
FT                   PRANITRHVAGFESTSSSYEPLFIDPSRGVILSLLVQSPTVKERIDQGGIVGYVILAMG
FT                   ALGALIALFCYLRLLVIGGKMRKQAKSDAVIEGNPLGEVIQAYQDHKGDNLEDLEAKLD
FT                   EIILRNAPKIERFIVSIKLFASVAPLLGLLGTVMGMIGTFQAITLFGTGDPKLMAGGIS
FT                   EALVTTMLGLVVAIPLLFFYTLVHSKGRRLVQTLEEQSAGFIARYQEKLHTAER"
FT   CDS_pept        complement(257950..258774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93013"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93013"
FT                   /db_xref="InterPro:IPR016866"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPW3"
FT                   /protein_id="BAC93013.1"
FT                   /translation="MAREMPAPFSTDKNTDKDATMTLKKFGVSALTAAMLSLTGSALAA
FT                   DAGSVISTQAGTNKAAQASQDKIDGYADSTDTMLAEYKAIMRQVDSMKVYNEQINRMVQ
FT                   SQQGELDSLDRQIAQIDQTAMEVVPLTLKMIDALDEIVTLDLPFQTKERNKRINELREL
FT                   MDRADVTTSEKFRKVMEAYQIEEGFSRSIESYKASLDRNGEVVTYDFLRIGRTALLYQS
FT                   PDGVETGMWNQQTRQWEALPESYRIAVQQGIRIAKKQAPPALIKLPVFAGEE"
FT   CDS_pept        complement(258798..261386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0250"
FT                   /product="outer membrane receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93014"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93014"
FT                   /db_xref="GOA:Q7MPW2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPW2"
FT                   /protein_id="BAC93014.1"
FT                   /translation="MYKNTTALSVAISLALGTAAMSPIAFAEEQQVEQLQKMKVTGSRI
FT                   STTEMEGPSPVTVITSKDIAAKGFNSAQDILNSLTQNTGGTLAQTNSFSFTPAAQSVNL
FT                   RGLGASRTLILIDGRRMPQYPLAQNGVSNFQDIGQIPVSAIERVEVMTDSGSAIYGSDA
FT                   IGGVVNFILKKDFDGVSVKARYGDATEGGYENGRLDIVAGKDMEDKRVLFVAQLAGNEM
FT                   LQQSDRSWAGDDNSDRSAFGAYSSYGASFVEKGTGNVLTPQVNSKTCQDVVGEHGIDRA
FT                   DGKCGFNRSAYRSLKPENKQVDLLLRGEMDLNDDMTAMAEARFGYKSTSSIFEPNPYDV
FT                   ETDATHSRGEGKYTRRLVEFGPRESNTEANAFGLTTGLTGLLADAYDWEVYASYSEQKV
FT                   ETDNPAVLNTLDQAVQNGDIDLLDTISAADVAKYSGRSTKEAYSKLYSINGSLAGDLVE
FT                   LPAGMSGFAVYGEWNRTDYNESIDAITKSGGFSGLGGTSGGGERDQIGLGVEVLIPVLE
FT                   DLEVTLAGRYDHYFDDSATGGAFTPKASIAYRPTDTLLLRGSYGLGFRAPDLKRLFGEE
FT                   TKAFGSGFDPELCKKAGGTGPDETIPECSTQYFDTVNGPNAELEEETSTNINLGLAWEP
FT                   VDDLGLTVDWYHIKMENVVSAPSYQDVINDPSKYPGTQVVRNPDGTIKTVIYGPVNQAF
FT                   ETRSGIDLSLGYAYDTVSMGSFSTKFSITKILIAESQESSSEPVIDERDFLPEYTATLN
FT                   LGWAYQDVNVNLFGKFRDEMCTSYANDYYFEDCDAAKKAGYETKISSMTTWNLTTSYQF
FT                   NESGRVTLGIINMFDKEPPKDPLNDTSPFYADTYDDPIGRQVYVEASYDF"
FT   CDS_pept        262220..263245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0251"
FT                   /product="ABC-type transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93015"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93015"
FT                   /db_xref="GOA:Q7MPW1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPW1"
FT                   /protein_id="BAC93015.1"
FT                   /translation="MLSYFLRRLALVIPTFLGITILIFAITRFVPGGPVERMLSKMQAQ
FT                   GDGAAAMTTAGGNSALSEEQMAELNAFYGLDKPVAQAYLDWLSKLVRLDFGESTRYYEP
FT                   VGDMIAERLPVSLFYGGMTFFISYFISIPLGYYKALRHGSVFDSASSILIFVGYALPGY
FT                   VVGVLLITLFSYHLEWFPMGGFVGDDFDDLETFFERAKDVMWHAVLPLICYLIGDFATL
FT                   TLTMKNNLMENLSSDYIRTAIAKGLPFKTAVRKHALRNSLIPIASHFGNSLLFFMTGAF
FT                   LIEVIFNIDGIGLLGYESIIERDYPVVMGIVAINAVLLLLGNIISDVCVALVDPRVKFG
FT                   A"
FT   CDS_pept        263247..264290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0252"
FT                   /product="ABC-type transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93016"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93016"
FT                   /db_xref="GOA:Q7MPW0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPW0"
FT                   /protein_id="BAC93016.1"
FT                   /translation="MIKVSPLTQKKIRSFKAIKRGYWSFILLSAMLVLSLFAELLINSK
FT                   ALMVKYDGHYYFPVISDVRSGSEFGQESAGEANYRQLQKQFAAEDSGNFVIMPIVPWNP
FT                   YEQDFSGDFPPTAPSAESKHYLGTDVIGRDILARLVYGFRTAMGFALLTMAISYTIGTA
FT                   VGCAMGYWGGKFDLFVQRLIEIWSMVPFLYVIMILVSIVQPTFALFVGINVLFGWMGMT
FT                   WYMRTMTYKESAREYVLAAKALGASTARILFQHILPNTMVMIVTLAPFTIAGNITALTA
FT                   LDYLGLGLMPPTPSWGELLQQGKSNLDSPWIVASVVSSIVAVLVMVTFIGEAIRAAFDP
FT                   KKFTRYV"
FT   CDS_pept        264329..266161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0253"
FT                   /product="ABC-type oligopeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93017"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93017"
FT                   /db_xref="GOA:Q7MPV9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPV9"
FT                   /protein_id="BAC93017.1"
FT                   /translation="MMKKTLLTTALSLMSAGVYATTLPADVNWQTNWDEPLFASSDAKF
FT                   GGTFRTFIQSFPQTLRSVGPDSNSGLRSFFLDETPALVDQHPDTLEWIPALANEWAFAG
FT                   DNRTVYFKLNPNAKWSDGKPVTADDFVFMLKFYRSKDLVAPWYNEYYTNVIDDVQKIDQ
FT                   HTFAAVSKVEKNQEDLLYTLGALRPRPAHFYAKPAKDENGDGIDDNFVRKYNFKAEPTT
FT                   NAYYLDDIKKGKSVTFKHVGQDWWGYSNKYYQHRYNVEKIRITVIRDNDIAMKHFEKGD
FT                   LDTFGLILPDLWHDKSNTEPYQKGYIEKFWGYNQTPQGAGGLWMNVATPLLDDLNVRKG
FT                   IMHATDYDGMIDKITRGDYSRKPHALGSGHGKYDLPNPVPPKFDPELAIRYFEAAGFNQ
FT                   IGADGVRVNDKGQRLSFAITYGYAHHTPRIAYLKEQAKKAGLEFELKLVDGSSAFKFIL
FT                   EKKHELAFLDMGTSDVPAYWEYFHSANANRPQTNNHTNFSTPELDTLIMAYKNEFDLEK
FT                   KYNYSHQIQQIVSDANLIVPGYMVPYTRVGYWRWLKYPQKAMTKKSEVLFTSGGAIGLG
FT                   TFWIDRDAKKETEKAIKAGKAFAPVTVIDDTYKL"
FT   CDS_pept        266185..267054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0254"
FT                   /product="ABC-type oligopeptide transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93018"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93018"
FT                   /db_xref="GOA:Q7MPV8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPV8"
FT                   /protein_id="BAC93018.1"
FT                   /translation="MQDDVILSVRDLEVSFTTDDGPVKVLHGVNFDVRAGRTLGLVGES
FT                   GSGKSVTSMSIMGLLPKPYGQIVNGQILYRGTDLVTLPAEQMYAMRGDRISIIFQDPMT
FT                   ALNPVHTVGRQINEVLELHRPDLDKRARNEYALEMLKKVRIPLPEKRLNEYPHNLSGGM
FT                   RQRVMIAMALACKPDILICDEPTTALDVTVQASILELMNELQQETGMAMIFITHDLGVV
FT                   AEVCDDVAVMYGGRIVEYAEIFELFDHPKHPYTERLMGLMPSLDSEPKQLIDIKPMDSS
FT                   MFEVSQRS"
FT   CDS_pept        266984..267904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0255"
FT                   /product="ABC-type oligopeptide transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93019"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93019"
FT                   /db_xref="GOA:Q7MPV7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPV7"
FT                   /protein_id="BAC93019.1"
FT                   /translation="MSLSSSSTLSRWIAACLKSVRGAKEFRMSKEVLRIENLKQHFVSG
FT                   KGLFRKGYTVKAVDGVSLSVNQGETLGLVGESGCGKSTLGRTLLKLYEPTEGHIFFEGR
FT                   DITKLSPKEMCPLRKEMQIVFQDPMESLNQRHTIGMILEEPYIIHKIGTPEERKTWVKE
FT                   LLVKVGLPVEAVNRYPHEFSGGQRQRIGIARAIALKPKLLICDESVSALDVSVQAQILN
FT                   LLLHLQQEMNLAIIFISHDLSVVKHVSDKVAVMYFGKVVEEGSAKEVYANPQNDYTKKL
FT                   LSAIPITHPKYRKHKRKAEQQQDVA"
FT   CDS_pept        268030..268473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0256"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93020"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93020"
FT                   /db_xref="GOA:Q7MPV6"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPV6"
FT                   /protein_id="BAC93020.1"
FT                   /translation="MLGMLQVPSHLPKSFSRPFLKIFHILEAVLLVAITLATLYAMVQE
FT                   FIHVFVEKRVLLTDILLMFIYLEVLAMVQQFVMNGKIPVRYPIYIAMMAIARYITLGMK
FT                   ELDATLVVWLSVAAFVLAAATLLIRVGHHYWPYVDNHTAEKDE"
FT   CDS_pept        268628..269011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93021"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93021"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPV5"
FT                   /protein_id="BAC93021.1"
FT                   /translation="MMLRKGTANLLLLLSLLMALLLSSGFARAQTEPPSNLHHKTSNDI
FT                   TNVSYCDWSLEAVEKDEPGCCEPGGRCYQNQCCTHYGHSMGAAVIESQQYTDEAPYRNE
FT                   WIASPIVIYTSAEMRTHYRPPIA"
FT   CDS_pept        269057..270097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0258"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93022"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93022"
FT                   /db_xref="GOA:Q7MPV4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPV4"
FT                   /protein_id="BAC93022.1"
FT                   /translation="MPCELVMRVNRLLFAPPSYRNSKMKTHRFTFAESLPALLFLSVCL
FT                   IWGTTWFAMEIAVQTIPPIFATGLRFLIAAPLLLILGQRLRQPLFFPKGKMHWMFIVAI
FT                   FYFAIPFTLMIFGEQYISSGLASIIFATMPIAVMITSRWFLGLTLRRLQTAGLLIAVLS
FT                   LVLILAKEMSLGGDDYLLGFLALGGAVAIHAVMYVCVQKYCQDIPVLTYNALPSLMASM
FT                   LLLTASWIIEKPAFSVFSQVSMLSVVYLGVFASVGGIVAYFKLGQVSTPFTASICFLFF
FT                   PLIALSLSTWMSGNSISSTSVVLLLPLLGGIFVTKAEPQFWARFGRKRIKSKPVLCKRC
FT                   MKELNV"
FT   CDS_pept        270073..270300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0259"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93023"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93023"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPV3"
FT                   /protein_id="BAC93023.1"
FT                   /translation="MHEGAERLDENVIQNKAPNLGALSNRYRVRTYSMFWICSLSSGLD
FT                   PNKLNELSKRNRSKMPVCPPNCPPLAYGFY"
FT   CDS_pept        270370..270498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0260"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93024"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93024"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPV2"
FT                   /protein_id="BAC93024.1"
FT                   /translation="MKGFIEHDFRQHSFAIFSLVLHDSNESAESSLSLKWTLWCPF"
FT   CDS_pept        complement(270633..271952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93025"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93025"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPV1"
FT                   /protein_id="BAC93025.1"
FT                   /translation="MTMQRNLLNALIAWKSQPVRKPLLIDGARQTGKTYLLQELFGNTF
FT                   ANILRIDFLENPAYKEAFDGSLSPDELVMNIELLTNQAFNPDTDLLILDEIGECERAVT
FT                   SLKYFAEKAPSYFVAASGSNIGLLNTFPVGKVEQYNLRPLTFQEFIYASNEQALIKAFD
FT                   SQASTPAVHTKLMDKLTDYFFTGGMPEAVSAWYQFKDSSILERVEKVTKIHADLVEGYR
FT                   RDFGKYAGKVDATLIESVFNSIPAQLSLVSDESVKRFKFKHVHERKSRYSDFETAIHWL
FT                   NCCRLALPNYPIEGLPKSPLAAYKKDNMVKLFLFDVGLLNHMLGSSYKEIKQQNYEYKG
FT                   YVAENFVQQELTAIGVDPSYSWNDARAEIEFILATDEGDIIPVEVKSGKRTRAKSLASY
FT                   VEKCTPNKTFKLTGTQGSSALEQTNIVMPLYFTQYLPERW"
FT   CDS_pept        272326..272583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93026"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93026"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPV0"
FT                   /protein_id="BAC93026.1"
FT                   /translation="MRKQTMNPTTQSPTNSVHPARQQRILRLPEVKAKTGFGRSTIYAL
FT                   MASGEFPRSIRIGARAVGWLESDIDQWIETRRIGAAYGRG"
FT   CDS_pept        272561..274309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93027"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93027"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPU9"
FT                   /protein_id="BAC93027.1"
FT                   /translation="MLLMAVDKPSASNQLPVGDMHSNMPSLPAGFAYNAQNWLVMQPAG
FT                   QDSPVKICSWLQVAARTRDPQGDNYGYLLHWLDDDNRHRYWAMPAELLAGDGSEYRRIL
FT                   LSRGMRLSNSVKARQLLSLFIQQMGELATQKAISVNCIGWHHHAYVHPRLTFYPSEHNN
FT                   PRMVLQTMHPIEGFIQQGSSDSWRQHVGCYCLDNPLLIVGVCAALAAPLLQLCGVDGFG
FT                   LHLYGASSTGKTAALYPALSVWGEPNQLRHSWRATANGLEGTALAHNDALLALDEMGEV
FT                   DPKEAGDVAYMLANGQGKTRAGKYGEMRLPARWRLVFLSTGEVTLESHLASIGKRVKAG
FT                   QQVRVIDLSADAGAQMGVFNHSHGINAADLADHLKQQSRQHYGCLALDWLRYLTQHSAQ
FT                   VRPVFQNVRQRFLASLPTEADGQVRRVAEKFALLASAGLLAIQAKVLDWPTQSVEAACL
FT                   SQLNQWILARGGVAANEDQQAIRQVRSFIEQHGESRFTPKQTGYSSQVRQRAGWLDTTG
FT                   PQTLYLFYPTGWREATEGLSPDRAAKALMAAGYLVPDGNRPQRKVSLPDNTRPRMYCVK
FT                   GSILDD"
FT   CDS_pept        274559..274756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0264"
FT                   /product="VrlI homologue"
FT                   /note="similar to VrlI protein of Dichelobacter nodosus"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93028"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93028"
FT                   /db_xref="GOA:Q7MPU8"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPU8"
FT                   /protein_id="BAC93028.1"
FT                   /translation="MNSDRWLSVEEIAEYLGVSKDTVYSWISKKGMPAHRIGRPWKFKA
FT                   DEVDQWVRSGGASDDSKEEK"
FT   CDS_pept        274695..277148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0265"
FT                   /product="type I site-specific restriction-modification
FT                   system, R (restriction) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93029"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93029"
FT                   /db_xref="GOA:Q7MPU7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="PDB:3H1T"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPU7"
FT                   /protein_id="BAC93029.1"
FT                   /translation="MRWISGLDLVAHQMTARKKNSMALNEADTCRVYVTPKLKESGWEN
FT                   NPSAITEQYTFTDGRVQFKGSKVQRGEQKRADYLLKYTRDFPIAVVEAKPENSPVGQGM
FT                   QQAKDYAEILGLKFAYSTNGHEILEFDYTTGEEQLLSRFPTPDELFKRLCGDEGIKDED
FT                   LDTLLSPYHHVSGYSPRYYQQIAINRAVQSVLQGKKRSLITMATGTGKTVVAFQISWKL
FT                   WSARWNRTGDYRKPRILFLADRNVLVDDPKDKTFTPFGDARHKIEGGKVVKSREIYFAI
FT                   YQSIASDERRPGLYKEFPQDFFDLIIIDECHRGSARDNSNWREILEYFEPAFQIGMTAT
FT                   PLREDNRDTYRYFGNPIYTYSLRQGIDDGFLAPYRVHRVISEVDAAGWRPSKGDVDRFG
FT                   REIPDGEYQTKDFERVIALKARTDAFAKHLTDFMKRTDRFAKTIVFCVDQEHADEMRRA
FT                   LNNLNSDLSRKHPDYVARVTSEEGKIGKGHLSRFQELETSTPVILTTSQLLTTGVDAPT
FT                   CKNVVLARVVNSMSEFKQIVGRGTRLREDYGKLWFNIIDYTGSATQNFADPDFDGYPEI
FT                   EDEVVIDEDGEEVVDDTLTPESEVLEVAEETGEYEVNTEGEGADDEEEHEPRKYYVDGG
FT                   SVKITSHLVYELDEDGKQLRVIQYTDYTAEKVKTLFSSLDELKDSWANPLKREEIILEL
FT                   QERGIQFEDLVAESGKTDADPLDLLCHIAFNVPLRTRKERADYLKKNKPDFFDQYGPEA
FT                   RAILTSLLDKYTDHGPKQFSIPDSLQVPPISEYGNVMEIANLFGGALQMKTAVDQLQTL
FT                   LYSQQ"
FT   CDS_pept        277154..278746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0266"
FT                   /product="type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93030"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93030"
FT                   /db_xref="GOA:Q7MPU6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="PDB:3UFB"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPU6"
FT                   /protein_id="BAC93030.1"
FT                   /translation="MTIRFMARTKKADQPMTTAQQLGAIVKSSRQIMRKDKGLNGDLDR
FT                   LPMLTWIMFLKFLDDLEQMRETEAVLEGKSFQPAIEAPYRWRDWAAIEGGITGDELIAF
FT                   INNDEAMRPDGTRGIGLFAYLRSLQGDNGGDRRDVIATVFKGMQNRMINGYLLRDVVDK
FT                   INGIHFNSSEEMHTLSRLYETMLREMRDAAGDSGEFYTPRPVVRFMVEVMDPQLGESVL
FT                   DPACGTGGFLVEAFEHLERQCKTVEDREVLQESSIFGGEAKSLPYLLVQMNLLLHGLEY
FT                   PRIDPENSLRFPLREMGDKDRVDVILTNPPFGGEEEKGILGNFPEDMQTAETAMLFLQL
FT                   IMRKLKRPGHGSDNGGRAAVVVPNGTLFSDGISARIKEELLKNFNLHTIVRLPEGVFAP
FT                   YTDIAGNLLFFDRSGPTDDIWYYQITVPEGRKKYTKTKPMESHEFDECLNWWSNRIVNQ
FT                   NAWKESASEIIKYSESGQLIDVNLDRKNPNSLEVLEHEEPMDLIEKITTKEESLLAILE
FT                   QIKAEISTQGISK"
FT   CDS_pept        278743..279885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0267"
FT                   /product="type I restriction-modification enzyme,
FT                   specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93031"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93031"
FT                   /db_xref="GOA:Q7MPU5"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPU5"
FT                   /protein_id="BAC93031.1"
FT                   /translation="MKEYTLRDVLIRQKEAITVEDDAEYKRITIKMNGNGVLLRDEVIG
FT                   DAIGTKRQFLVSSDQFVLSKIDARNGAFGIVPKSCDGAIITGNFWAFDVNSELADVKYL
FT                   DFMSKTPEFKDFCIVASEGTTNRKYLDENKFLDKRILLPELAEQKKVVAKILKFKNKIE
FT                   LARKIRNEILSDLYVLLNSTFHKLIEGAVYKPMSKVAPLERRKVEIDVNAEYPELGVRC
FT                   FGNGTFHKPILNGMDVGTKKLYQMVPGDLVFSNVFAWEGAIAVVKKEDEGRVGSHRFIT
FT                   CLPKSGVVTADFLCFYFLTTEGLEKIQAASPGGAGRNRTLGLKKLENIEVPVPDYDKQL
FT                   WFNQLQSYVEKIKQAQSENATELEALMPSILDKAFKGELV"
FT   CDS_pept        279885..280682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0268"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93032"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPU4"
FT                   /protein_id="BAC93032.1"
FT                   /translation="MSMPAPTLAYDAGTQPVIAHGLSYQDEQVSEMLAGPVKHILQDTA
FT                   GNDELQELLGSVVSTEFEQEGLRQALIDETVPDNWRVGEAIAEAFVADKGNCVFPWPTG
FT                   RDLKNPNASPAGCDLTGFQPVNDAELPYRFAFGEVKTSEENKAPPSVMTSLGTQLFGLR
FT                   DNRQVKDALLRYLGLHAVRAPWEPMFKSAAKRYLSSNTTDVAVYGVLVRDIAPSASDIA
FT                   GRAKALAADCPVQTDIEMYALYLPLNIIGTLSARAQAAMQEAS"
FT   CDS_pept        280679..283921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0269"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93033"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93033"
FT                   /db_xref="GOA:Q7MPU3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPU3"
FT                   /protein_id="BAC93033.1"
FT                   /translation="MTLSQEHLLQVDQHWAVQSIGAERRDKAMEMAERRLVDVVLGNLL
FT                   EHAATEFDSDLLEQVATAYELAAIEGIGALLHPVANQDNKNIRELAQAGAFRAFGLYRV
FT                   LPVPSDNEARLFHVLHVSGLAYCADRWTDLRRWFEEQSSTVAVPSVAGVTWDKRLLYRI
FT                   FDCWLRLLRKNRWDDLDQISEIVLGLRNDQANYEKALLEQTQGAEAQSIAMRLVALYHW
FT                   AKATERLAVYMLQGEPVAIDAQLDQHFEAAQKAAQASKDPQLEMILRWLHVASRKMVAG
FT                   SLWWVAHTVNSRVTRFVSHVTKHKSLFELLPPQRAALQEQGLLDQASRAVIVDLPTSGG
FT                   KTALAQFRMLQALNQFDQDDGWVAYVAPTRALVSQITRRLREDFGPLGIQVEPLTGAIE
FT                   VDAFEEALLGEARAFQVLVATPEKLQLVMRNKKVARPLALVVMDEAHNIEDESRGLRIE
FT                   LLLATIKQESPRANFLLLMPFVPNANDLAQWLAADRGRSISLGTSAWQPNERIVGLFDI
FT                   HKGEKAGDWNLSFETLTTTQRTIHLKGTHKVDGNRPLQKLNYTKAKGVTTQAVAMAKVF
FT                   SKRGTSIAVAQTIPDTWSIARKVAAELEPLVQVHEDIKLVQRFLAAEISEDFELIDMLS
FT                   KGVVVHHAGLPAEALSLIEWLTEAGHIRVMCATTTIAQGLNFPVSSVFLATRKLPYGNE
FT                   MSHRAFWNLAGRAGRIGHDSVGVIGIAAGAQPNEIRKYVSDATASLVSRLEGMLDDLQT
FT                   AGKLADLSWVMQQEQWADFRSYIAHLWNEKRNLDAVIGEAEQLLRNTYGFGSLRAKADK
FT                   ASQEKADALLEATKGYVRKLAEHPENASLADVTGFSPEGVRSTLLDLNNLENKLTLADW
FT                   EPSSLFGDKSKSVLPSLMGIMLRVPQLQESLREISKGQGNSHRKLADITQAWVTGSSIE
FT                   SIAKTYFEGDSLTDQISKACRAVYRDLANNGAWGLSALSKMPTSGLDFEAMTDEEKRRL
FT                   NNLPAMLYHGVKTEEGVLMRMNSVPRSIAERAGEDFKARTEAGAEKTLSPRKASEYLKS
FT                   LKPDDWARLKPDNSSLSGEDYLKVWKRLSGEA"
FT   CDS_pept        complement(284319..285020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0270"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93034"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93034"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPU2"
FT                   /protein_id="BAC93034.1"
FT                   /translation="MISDVLWASANDWDREWIQQVVALLVGHAAFTLYPALSQCDNAAE
FT                   RLTRWLTHQLPRVKQAHPGCPIHQWLNSIGAQVILEKWHSPDQWPNLYWLPLPEVDGHA
FT                   QGGLVLLPAHLLPTYRDGTSQTNTLHVNTPANARIFWCITPLSKAGKRATLHPKQQNRA
FT                   FCLPSSPELMDKSCTGLLLRGLRKENQKRNGNVISHQINLALLHHLCGPESDVWITSKC
FT                   FGNENKTQQQG"
FT   CDS_pept        complement(285144..285329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0271"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93035"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93035"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPU1"
FT                   /protein_id="BAC93035.1"
FT                   /translation="MPVLDQSKVWHFLHPKPTSASKYKPFVFANPECKRSFGVSIFLHG
FT                   LNAAKQHRIGLCISNS"
FT   CDS_pept        285448..285567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0272"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93036"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93036"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPU0"
FT                   /protein_id="BAC93036.1"
FT                   /translation="MGKCVREHANDCPVKPIDKNANLVYIFNIILVFINQRSV"
FT   CDS_pept        285564..286616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0273"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93037"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93037"
FT                   /db_xref="GOA:Q7MPT9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPT9"
FT                   /protein_id="BAC93037.1"
FT                   /translation="MIGERIKRARAAAGLSMQALGEQVGISANMVKKYEHDQSMPSSGV
FT                   LLKLATALSVRTEYFFRPAQVTLGEVEYRKKASASAKLLKKIESDVVDQAERWLALKNV
FT                   WPNFPIASFNYHPDVPVVSTLDAVEQVAAKVRTDWQLGMNPLPDLIDLLESKGILVIVS
FT                   NVPQADKFDGLQAKISGQPIVVVSSHWPGCRQRFTLAHELGHLVLHGLLDESLDEEMAC
FT                   NRFASAFLLPEVGLFQHLGERRSNVDPKELYFLKHEYGLSMAACLYRSADLGVITEEKK
FT                   RQIFIQFSKNGWRKQEPGNPYPQEQTLLFEQLVYRALAEGIVSESKAAELLQMSVMALH
FT                   KQRQMLAEAV"
FT   CDS_pept        286617..287096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0274"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93038"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93038"
FT                   /db_xref="InterPro:IPR021799"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPT8"
FT                   /protein_id="BAC93038.1"
FT                   /translation="MYLLISDANILIDLEEGQLLGVFFNLPYQLKVPDVLFHEELSDQH
FT                   GYLLELGLLLGELSPESMMYSFELRQKYAGPSMNDCFALALAKQEQCPLLTGDMALRKA
FT                   AEKEAILVQGTLWVVEQLVTHGVLSVEEAQAAYDKMAKAGRRLPWALAKQRLTQL"
FT   CDS_pept        complement(287147..287317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0275"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93039"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPT7"
FT                   /protein_id="BAC93039.1"
FT                   /translation="MKNHSIGSAYWPSSMANAAACRKGPSGETNKPPFAHLPWAVGTMG
FT                   QHLIHQALEGE"
FT   CDS_pept        complement(287229..287606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0276"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93040"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93040"
FT                   /db_xref="GOA:Q7MPT6"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPT6"
FT                   /protein_id="BAC93040.1"
FT                   /translation="MSPLHNTTQEGANMQFMMRLAPITFPIAMLAGLGWCIGIALLEQP
FT                   HGIGYALTRHCLMVFVVLAPWLMLKLMFYVIVSLGRKLGLIPPARPTHSLGYEESLYWF
FT                   SVLAFFDGKRSRMPKRPIRRN"
FT   CDS_pept        complement(287569..288873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0277"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93041"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93041"
FT                   /db_xref="GOA:Q7MPT5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPT5"
FT                   /protein_id="BAC93041.1"
FT                   /translation="MVGSHYCPLHYFSNYGVNMGKLTAKQVIAYSKADPKKYSDGEGLY
FT                   FCVRKQGSPYWMIRYTTAKGRREATLGQFPLMSLADARIAAAYFRKEVRDGIDPLLEKQ
FT                   KIELPDIETVDQLFHDWYRTDLSRRLKHPKIPYRVYTKDISPVIGIKCIAEVTARDVRE
FT                   VLERIRESNRPTIANDTLMYMKQLFRHAIKLDLTLNNPAAAFTVDDAGGVESSKDRMLS
FT                   KEEIHYAFSVFHTHINSFGRDNYLACCLFLVLGVRKSELCEAMWREMDLTTGVWDLPKE
FT                   RSKTGVPISIPLPRQAIAWFNELQIRACGSPYVFPARRASHRPHMGPDTLNRAISKLFG
FT                   REPGRKKQPPNKMGKLEHFTVHDLRRTFRSLAASLGIAGNVAERCLNHKLKGVEGIYDR
FT                   HDYFEERRIAHQTVADVVEPLVNFEPASQHHTGGR"
FT   CDS_pept        complement(289135..290022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0278"
FT                   /product="uncharacterized stress-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93042"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93042"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPT4"
FT                   /protein_id="BAC93042.1"
FT                   /translation="MIKQENSMIYSMTAYARKEIKADWGSAVWEIRSVNQRYLETYFRM
FT                   PEQFRGLEPVLRERFRQRLARGKVECSLRFEANPAARSELTINETLASQVIGAAKQIMQ
FT                   LTGEDSRINPFQVMQWPGVMETPEQDMDAINQQLLAAFDQALNEFIEARGREGDNMKAL
FT                   IEQRLTAITAEVVKVRARMPEIIEWQRERLFSKFEEAKVELDASRVEQELIILAQKSDV
FT                   AEELDRLDSHVKETTNILKKGGAVGRRLDFMMQEFNRESNTLASKSIATDITASGVELK
FT                   VLIEQMREQIQNIE"
FT   repeat_region   290077..290110
FT                   /gene="rpt1T01"
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="GAAGCATTGTTGCTAAA"
FT                   /note="2 units of 17 bp in-tandem repeat"
FT   CDS_pept        290211..290927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0279"
FT                   /product="RNase PH"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93043"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93043"
FT                   /db_xref="GOA:Q7MPT3"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPT3"
FT                   /protein_id="BAC93043.1"
FT                   /translation="MRPNDRAADQVRPIKITRNYTAYAEGSVLVEFGNTKVLCNATVEE
FT                   SVPRWLKGQGKGWVTAEYGMLPRATHSRTRREAANGKQGGRTMEIQRLIARSLRAVVDL
FT                   EAMGEFMITVDCDVIQADGGTRTASISGASVAMADAFQHLVDSGKLKANPMKGHVAAVS
FT                   VGILGEDVLCDLEYVEDSAADTDMNVVMTEEGKMIEIQGTAEGEPFSHEQLLALLESAK
FT                   KGISEIVAAQKAALAN"
FT   repeat_region   290969..291045
FT                   /gene="rpt1T02"
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="CTAGACC"
FT                   /note="11 units of 7 bp in-tandem repeat"
FT   CDS_pept        291084..291725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0280"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93044"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93044"
FT                   /db_xref="GOA:Q7MPT2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPT2"
FT                   /protein_id="BAC93044.1"
FT                   /translation="MKAYQREFIEFALEKQVLKFGEFTLKSGRKSPYFFNAGLFNTGRD
FT                   LARLGRFYAAALADSGIEFDVLFGPAYKGIPIATTTAVALADHHDIDTPYCFNRKEAKD
FT                   HGEGGNLVGSALEGRIMLVDDVITAGTAIRESMEIIQANGADLAGVLVAIDRQEKGKGE
FT                   LSAIQEVERDFACAVISIVSLSDLITFLEEKGDTAEHLDAVKAYRAQYGI"
FT   repeat_region   291785..291805
FT                   /gene="rpt1T03"
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="CTAGTCC"
FT                   /note="3 units of 7 bp in-tandem repeat"
FT   CDS_pept        complement(291825..292763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0281"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93045"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93045"
FT                   /db_xref="GOA:Q7MPT1"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPT1"
FT                   /protein_id="BAC93045.1"
FT                   /translation="MTTATKPAFSISLLHPKYWPVWLGFGLLAILVTILPYKLQLWLGR
FT                   SLGHFAMRFAKSRVHVARRNLELAFPEMGQQEREAIVVENFKNTGLALFETGIAWFWPD
FT                   WRIKRHVVFGDTRELMELDANKKGVLVVCTHSLNLEITARAFSLFAPGYGVYRPHDNPA
FT                   YDFIQTWGRTRCGNQMVDRKDVKGMLKILRGGGRLWYLPDHDYGNNHAVFVPFFAVPDA
FT                   CTTAGTGVLVDASKCAVITASSFRKGETYTLEIDPDISDQFPRKDAVGAATVMNQAIEK
FT                   VILRGLDQWMWLHKRFKSMADPSQPRGIRYK"
FT   CDS_pept        complement(292767..293357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0282"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93046"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93046"
FT                   /db_xref="GOA:Q7MPT0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPT0"
FT                   /protein_id="BAC93046.1"
FT                   /translation="MAGSKKSNRREEILQALAHMLESAEGASRITTAKLAQQVGVSEAA
FT                   LYRHFPSKARMFEGLIEFIEEALMSRINRILDEEKDTLERIRLVLQLLLAFAERNPGLT
FT                   RIMSGHALMFENERLRDRINQLFERIETQLRQILRERKLREGKSFPVEEKILAAQLLGQ
FT                   VEGSLNRFVRSDFKYQPTENFEEYWALLSAQIK"
FT   CDS_pept        complement(293508..294752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0283"
FT                   /product="DNA/pantothenate metabolism flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93047"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93047"
FT                   /db_xref="GOA:Q7MPS9"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPS9"
FT                   /protein_id="BAC93047.1"
FT                   /translation="MLGSATVILESNQMQTLAGKKILLGISGGIAAYKCADLTRRLKER
FT                   GAEVQVVMTKAAKEFITPLTMQAVSGRPVSDSLLDPAAEASMGHIELAKWADLILLAPA
FT                   TADLIARMAAGMGNDLLTTLVLATDAPVAVSPAMNQQMYRNVATQENIATLSRRGMEIW
FT                   GPAAGEQACGDVGPGRMLEPMQLVALCEQFFQPKPLQDKSILITAGPTREAIDPVRYIT
FT                   NHSSGKMGYALAQAAMQLGANVTLVSGPVSLPTPVNVNRINVDSAQEMYDAVMAQASDH
FT                   DIFISCAAVADYRPATIAEQKLKKTDDSDEMTITMVKNPDIVASVSAMTENRPFTVGFA
FT                   AETNDVEVYARRKLEKKKLDLLCANDVSVEGQGFNSSDNAITLYWPQGEKALPLNSKAA
FT                   LSMEILKQIQTLMGH"
FT   CDS_pept        294941..296662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0284"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93048"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93048"
FT                   /db_xref="GOA:Q7MPS8"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPS8"
FT                   /protein_id="BAC93048.1"
FT                   /translation="MRYLLKIKTIIWIATELVMKSRNKLLLLTLIPLVLLTAMVTAVFY
FT                   FNSVKSLDVELSEYRNELIETRKSELKAYLMMGVTAIKPLYDADVNGNNQQQAKQILKA
FT                   MRFESDGYFFAYDSKGVNTLHAIKPELEGKNLYGMKDDNGVAVIAGLIDASQKGDGFLY
FT                   FSWHKPTINAQAPKLGYAEYLPKWDWVLGTGIYIDDIDTQVAEHRVQSIASLNEHTLSA
FT                   IGFTLVGLLIACGVISVIVSRAILPLQHIAASLQDVAAGGGDLTARLSVESQDEVGEVA
FT                   KAFNQFMDKLHPLMVDIRSSAQTVQSAATGLDQQTSLASNQMQTHCLETDKVVTAVTEM
FT                   SATAREVANNTHATAQAIDSANAQISEAQVEVNHAIEGIGKLVDEVNITSDAISQLSQQ
FT                   TDQITKVLQVIGEIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRSLASRTQNSTLE
FT                   IGDMLKQLQNGVARAVTTMSASQERGEQTALESVQIKESLAGIQSAVEMIRDMGIQTAS
FT                   AAEQQSAVAEDINQNLVTIQQIVNEINNNLQESETISTRLSVSGQEMHDLVGHFKL"
FT   CDS_pept        296776..297450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0285"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93049"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93049"
FT                   /db_xref="GOA:Q7MPS7"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPS7"
FT                   /protein_id="BAC93049.1"
FT                   /translation="MSLKNLPSESMPREKLLQRGPQSLSDAELLAIFLRTGTQGMNVIE
FT                   LADFLLRDFGSLRKLFSADEQSFCRHKGLGQAKYVQLQAVLEMTQRYLAETLQRGDALT
FT                   SPQHTKLYLSSMLRDRHREAFYVLFLDNQNRVIKDEVMFEGTIDAASVYPREVVKRALH
FT                   YNAAALILAHNHPSGVAEPSQADRRITRRLSDALGLVDIRVLDHFVVGDGEVVSFAERG
FT                   WI"
FT   CDS_pept        297762..297998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0286"
FT                   /product="ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93050"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93050"
FT                   /db_xref="GOA:Q7MPS6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPS6"
FT                   /protein_id="BAC93050.1"
FT                   /translation="MSRVCQVTGKRPAVGNNRSHARNATKRRFLPNLQTHRFWVESEKR
FT                   FVKLRLTAKGMRIIDKKGIDVVLADMRARGENV"
FT   CDS_pept        298014..298184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0287"
FT                   /product="ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93051"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93051"
FT                   /db_xref="GOA:Q7MPS5"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPS5"
FT                   /protein_id="BAC93051.1"
FT                   /translation="MAKKGIREKIRLVSTANTGHFYTTDKNKRNMPGKFEIKKFDPVVR
FT                   QHVVYKEAKIK"
FT   repeat_region   298262..298366
FT                   /gene="rpt1T04"
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="CCTAGAA"
FT                   /note="15 units of 7 bp in-tandem repeat"
FT   CDS_pept        298431..298928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93052"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93052"
FT                   /db_xref="GOA:Q7MPS4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPS4"
FT                   /protein_id="BAC93052.1"
FT                   /translation="MRVSPKRRRRWNNILIAGITFFIVIINAPTLIKTYLLDDQSTTQI
FT                   ESINGYPSLLNPETQLLSIQLSDNSLEWQKGMWVTARELSISPQEWAQRWQSLLGTQLD
FT                   DATMQKLAPQLIEPETIEVWYQDQEEPQRITFYRLTDFWVFKNWQDQWIAISVSTDYLF
FT                   PY"
FT   CDS_pept        298883..299767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0289"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93053"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93053"
FT                   /db_xref="GOA:Q7MPS3"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPS3"
FT                   /protein_id="BAC93053.1"
FT                   /translation="MDCHFSFNRLFVSLLDIEHFDLGATMPELPEVEVSRMGITPHLLN
FT                   QTIQSLIFRTPKLRWVIPSELKKLQGQVIRHIGRRAKYLIIETDVGSAIVHLGMSGSLR
FT                   VLDADFPAGKHDHVDLKLSNGKVLRYNDPRRFGAWLYAAPGEDHDVLGNIGPEPLTDAF
FT                   DGQYMFEKAQGKRVAVKQFIMDNKIVVGVGNIYASESLFRSRILPTRATMSLSAEEWQR
FT                   LVSHIKQTLQTAIEQGGTTLKDFSQADGKPGYFAQELQVYGKAGESCPECGEAIQELKI
FT                   GQRNTFYCSYCQC"
FT   CDS_pept        complement(299684..299827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0290"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93054"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93054"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPS2"
FT                   /protein_id="BAC93054.1"
FT                   /translation="MIKHTDDRHFYLSLQPVSGSLALTVRTVEGIALPYFKLLNRFAAF
FT                   WA"
FT   CDS_pept        299914..301890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0291"
FT                   /product="phosphoglycerol transferase"
FT                   /note="alkaline phosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93055"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93055"
FT                   /db_xref="GOA:Q7MPS1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPS1"
FT                   /protein_id="BAC93055.1"
FT                   /translation="MDFQQNAHRAMRIIFSLIVAALLLLTVSRGLFLLLAADFSDLTGL
FT                   GNDLFRAFWVGVRFDAKIIAIAFAPLFLAGLILAAFARGFSLWQRAVPNYAFVIFFLLT
FT                   AFSIGNYYYYVTYGNYIDVFAFGLFDDDTEAVLENAWEDYPILRSFFVSLAVAWLSRIG
FT                   AQWLVARLQKRRFTPRHWSYMTAVIVAVILLYVVIARGSIGTLPLKRYHANVSDNKLLN
FT                   IITPNAFMALDWAKSDYKKQSKFEPISAQEVEAQMMKVLGQPTPYFATPENAYLAENPP
FT                   HVVMALMEGMGTNVLIEDDAQSNDLLGVLREGFEQDFVFKRFMAGTSATIDSIVMMLMH
FT                   SDVPTISHSSAQKKPLASSAVLPYKQAGYRVVFIYGGNGMWRNLSNYLPVQGFDQVYDE
FT                   NSIKNAFPDAAKHADTWGVPDEFTFKFARKVLDEATQPTLIYIMTVTNHSPFRAPSDYQ
FT                   AKPVKASERLKTLLGPMEEEADDLLQAYQYANDSLGQFVHGVKQSPLAEKTVIAASGDH
FT                   RVRYLAIDEEAEFGLTFGVPFYLYVPESILQHVEHQYDPSRIGSHRDIFPTLYHLSLSA
FT                   QQYVSLGGENMLSTHGVSNVGFNASRVITEQGAYSASKPERLYPWGEGLYSQETTIANP
FT                   QPEWAADYRKLMNDYLRLQVTQP"
FT   CDS_pept        complement(301966..302460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0292"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93056"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93056"
FT                   /db_xref="GOA:Q7MPS0"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPS0"
FT                   /protein_id="BAC93056.1"
FT                   /translation="MSKKALSRVVYPGTFDPITNGHLDLIERAAKMFDEVIIAVAASPS
FT                   KNTMFTLEERVDFARQVTRHLDNVTAQGFSGLMVDFARAVDANVLIRGLRTTVDFEYEF
FT                   GLTNMYRRLLPGLESVFLTPSEEHAFISSTIVREVAIHGGDVTQFVPTVVAEALHQKKK
FT                   V"
FT   CDS_pept        302547..303581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0293"
FT                   /product="ADP-heptose:LPS heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93057"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93057"
FT                   /db_xref="GOA:Q7MPR9"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPR9"
FT                   /protein_id="BAC93057.1"
FT                   /translation="MKKILVIRNDKIGDFMLAWPSFAMLKQSMPEAHITALVPSYTQEL
FT                   ARLCPWIDDVLLDPTEKAGKEATKQLVQEIKSRQFDASINLFSTTYNALLVWKAGIKYR
FT                   LAPATKIAQIFYNRRIKQKRSQSAKPEYQYNLDLIRAFLNEQKVTAVEPQAPFLLFDET
FT                   ELSVQKLKLSEQLSIEAHKPWVMVHAGTGGSANNLTLAQYAELLKGIEQDFQLIVTAGP
FT                   GETEKAQQLLKEYAQLGGQGVVYDKNEGLVDFTRSIACADLFIAGSTGPLHIAATLDVP
FT                   TVGFFPSKRSSTPLRWRPLNSEGRHLAFCPPKGGGEAMEADMSRIDIDAALVQLNPWVS
FT                   PYLS"
FT   CDS_pept        complement(303550..304341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0294"
FT                   /product="lipopolysaccharide biosynthesis
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93058"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93058"
FT                   /db_xref="GOA:Q7MPR8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPR8"
FT                   /protein_id="BAC93058.1"
FT                   /translation="MSESINKPTLAVALIVKNEAANLEACLKTVEGWVDEIVILDSGSS
FT                   DETEAVARRYTDKFFINKEWPGFGPQRRLAQQYVESDYVLWLDADERVTPELKLSIQQA
FT                   VESNEANTLYSMCRLSWVFGRYIRHCGWYPDRVVRLYPTKLTQYDDALVHEKVEITKAM
FT                   KVKELQGDAIHYTYNDLHHYLVKSAGYANAWAEQREKRGKKSSISQGVLHAIACFVKMY
FT                   IVKAGFLDGKQGFLLSLLSAHSTLVKYADLWIRTSTEKPKD"
FT   CDS_pept        complement(304326..305387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0295"
FT                   /product="ADP-heptose:LPS heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93059"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93059"
FT                   /db_xref="GOA:Q7MPR7"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPR7"
FT                   /protein_id="BAC93059.1"
FT                   /translation="MSLFEQAPNSVCFLRLSAIGDVCHAVAAVQALQRHWPSTKVTWVI
FT                   GKVEAQLLQGLEGVELIVFDKKQGLDGMKAVWRQLKGRRFDALVHMQLALRASLVTLGI
FT                   KATYKVGFNFKRAKEGQWLFTNRKISDTESAHVLDSFYSFIEYLGVPRTPPQWQLPISD
FT                   ADHHFAQETLGDQPTLVISPAASKDERNWLADRYAALGDYAYEQGYQVVICGSPAEREK
FT                   TLAADILRHMQNPALSLVGKTNLKQLTAVLNKAAVVLAPDSGPAHIATTQGTPVIGLYG
FT                   HSNPKRTGPYNNLNEVVSVYEQFIVEQHGKAAETLPWSTRVKGDHIMQAISVSDVIRSF
FT                   DHITKKESACLNQ"
FT   CDS_pept        305420..305878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0296"
FT                   /product="diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93060"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93060"
FT                   /db_xref="GOA:Q7MPR6"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPR6"
FT                   /protein_id="BAC93060.1"
FT                   /translation="MQIPKINVKYPSFIDGNDKAFLSMTQPNIGKPGNTGIKRIIKATG
FT                   YSIQGLKAAFKHEAAVRQEFALLVVAIVLATWLDVSMLERITLLAVVVLVLIVELMNSA
FT                   VEAVVDRIGVEHHELSGRAKDIGSAAVLVALIFAGFTWLYIVGSHYWW"
FT   CDS_pept        305882..306592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0297"
FT                   /product="putative KDO kinase WavC"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93061"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93061"
FT                   /db_xref="GOA:Q7MPR5"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPR5"
FT                   /protein_id="BAC93061.1"
FT                   /translation="MIEQQQFGQSRICYDSEWVSSPELALFDPQYWQAQNKVVGSATGR
FT                   GTTWFVQLPKITAALRHYRRGGLFGKLVKDHYWFRSWSATRSFAEFHLLKQLREAGVNV
FT                   PRPIAAYAMRKGLFYQADLLSERIANAQDLVTILQKHSLNAELYQKIGVEIAKMHRVGV
FT                   NHTDLNIHNILIDAQETIWIIDFDKCYPQAGDGWKQENLDRLKRSFNKERVKRSIHWHD
FT                   KDFQALLTGYESQQ"
FT   CDS_pept        306637..308472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0298"
FT                   /product="predicted hydrolase"
FT                   /note="alkaline phosphatase superfamily"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93062"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93062"
FT                   /db_xref="GOA:Q7MPR4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012159"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024588"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPR4"
FT                   /protein_id="BAC93062.1"
FT                   /translation="MSFKQKLHAHGWFILINALVLMLIASRYFAFLPEFPTDPLGITFI
FT                   LAGTWGQMTLLAALIGLVTIPTLFLPKPFRNGTQALIASLGVATLFIDTIVFAQYRFHI
FT                   NAVVLELVMSGQIVSFPLITWLMVIGGVALLLAAQWWTIRWLENGAPVRALKLGRKFAL
FT                   LTFAALLATNAIHIWAAAHAYQPVTTVKRYLPLFYPATADKFMRKQGWVDEEALERQKA
FT                   LAFKRKNDLNYPLAPLQTQPVEKPLNIMLLVVDSWRADTFNADNTPNMWKYAQSGVVFN
FT                   NHIATGNATRTGIFGLFYGIPGTYWHGFLANQQSPVLIDRLQALDYQLGIFTAAQLRKP
FT                   EFNQTVFTKVENLRIGSEGSRPSELDADLTQDWLAWYDQRDKSKPTFSFLFYDAPHGYD
FT                   FPADFEPKYEPMLKEVNYLKLNNDTDPTPFFNRYKTSVRYVDSMATKVLDKLKESGDLE
FT                   NTLVIITGDHGQEMNDNKLNFWGHNSNFTDAQVNVPFAIFGPGVDAAKMQWSSEALTSH
FT                   QDVVPTLMKHYLGVSNDVKDYSVGEDLLGDAVKRDWIISSNYSGYAIITDDNILEVSGG
FT                   GQYQFMDKTNLQLKDQQPNFTYLQQALEQISRFSK"
FT   CDS_pept        308484..309347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0299"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93063"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93063"
FT                   /db_xref="GOA:Q7MPR3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPR3"
FT                   /protein_id="BAC93063.1"
FT                   /translation="MTRKASLIIAFYNNTQALGLIFKALSAQSCMDFEVVIADDGSKED
FT                   AVTWLEEQKNQVPFALKSVWHEDKGFRKNRILNHAVLAAESEYLIFIDGDCIPEKHFIE
FT                   DHINNAQRGSVLSGRRVELPELFTPLMQACENPETFFSQHKWQIFRQYLFTSPDAETKG
FT                   RCNRGRHVEKGIRLPYAWQQKLIGGFKPAGILGCNFSLYKSDLLKVNGFDMRYEAPAVG
FT                   EDSDLDYRLGLIGITTRVLKGLAIQLHIYHPWLSRTSPNYELFLDTMEHKRSWAEQGID
FT                   TLKEHQ"
FT   CDS_pept        309344..310405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0300"
FT                   /product="dTDP-D-glucose 4;6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93064"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93064"
FT                   /db_xref="GOA:Q7MPR2"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPR2"
FT                   /protein_id="BAC93064.1"
FT                   /translation="MKILVTGGAGFIGSAVIRHIINDTRDSVINLDKLTYAGNLESLHE
FT                   VSSSERYVFEQVDICDRTELDRVFAVYKPDAVMHLAAESHVDRSIDGPATFIQTNIVGT
FT                   YNLLEASRAYWSNLEENEKARFRFHHISTDEVYGDLEGTEDLFTESTSYSPSSPYSASK
FT                   ASSDHLVRAWQRTYGLPTLVTNCSNNYGPYHFPEKLIPLMILNALEGKPLPVYGDGMQI
FT                   RDWLFVEDHARALYKAVTEGGVGETYNIGGHNEKANIEVVKTLCALLEEYRPNKPAGID
FT                   AYESLITYVKDRPGHDVRYAIDASKIERELGWKPEETFESGIRKTVEWYLANQAWWSRV
FT                   LDGSYSRERLGVN"
FT   CDS_pept        310488..311375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0301"
FT                   /product="D-glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93065"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93065"
FT                   /db_xref="GOA:Q7MPR1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPR1"
FT                   /protein_id="BAC93065.1"
FT                   /translation="MKGIILAGGSGTRLYPITRGVSKQLLPVYDKPMIYYPLSVLMLAG
FT                   IQEILVITTPEDQASFQRLLGDGTDFGLSLHYAVQPSPDGLAQAFIIGEEFIGDDCVCL
FT                   VLGDNIFYGQDFTTKLKSAVENAENGHGATVFGYQVKDPERFGVVEFDDKMQALSIEEK
FT                   PHVPKSDYAVTGLYFYDNQVVVMAKMVKPSARGELEITALNQMYLEQGNLNVELLGRGF
FT                   AWLDTGTHASLHEASSFVETIENVQGLKVACLEEIAWRSGWLSHKQLTSLATAMLKNDY
FT                   GQYLMKLVTEKVKP"
FT   CDS_pept        311372..312253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0302"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93066"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93066"
FT                   /db_xref="GOA:Q7MPR0"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPR0"
FT                   /protein_id="BAC93066.1"
FT                   /translation="MRVLIVGSSGQLGHCLVRSLQTEHDILALDRQQLDICEEQAVEKV
FT                   FATFQPQFVINAAAYTAVDKAESEPEMAYRVNEEGPKLLAQECHHHGCPLVHISTDYVF
FT                   DGDKNGLYCEDDRPAPGNIYGMSKLAGEHAVQHACSQYYILRTSWVFSEFGNNFVKTML
FT                   RQGAERTQLGIVSDQVGGPTYAGDIARVIGRLLERFQFGEPVEYGLYHFSGMPHVSWFE
FT                   FAQAIFGLAHEQGVLKRKVELKPLSTREYPTAAIRPMNSRLDSTKLKSQLQLEASDWKA
FT                   ALNQLDRYVEQK"
FT   CDS_pept        312253..312810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0303"
FT                   /product="dTDP-6-deoxy-D-xylo-4-hexulose-3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93067"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93067"
FT                   /db_xref="GOA:Q7MPQ9"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPQ9"
FT                   /protein_id="BAC93067.1"
FT                   /translation="MKVIETSIPEIKIIEPMVFGDERGFFMETWHQARFEELVTGKPTR
FT                   FVQDNHSKSKQGILRGLHYQMQHTQGKLVRVVSGEVFDVAVDIRQGSPTFGQWVGVYLS
FT                   AENKRQMWVPEGFAHGFYVTSEEAEFVYKCTDYYHPQSEQCIAWNDTVIGIDWPIPIGK
FT                   GPMLSKKDASAPNLSECKYLLG"
FT   CDS_pept        complement(312811..313497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0304"
FT                   /product="putative WavS protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93068"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93068"
FT                   /db_xref="GOA:Q7MPQ8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPQ8"
FT                   /protein_id="BAC93068.1"
FT                   /translation="MLTQLTYCLREWDSAFFNRRIGDVSLATHNHYKDTLFDLITTKVC
FT                   SDDVNLISNLNQNGFQYCEGEITFSKMLSNHSHIDYDIADESDLPQLSSLVAGMYKYSR
FT                   FKYPWFNPEEKDLFYKTWLKKAVLGQFDDVCIIFRQKKTISGFVTLKLSSNSATIGLIG
FT                   VNDLSRGQGIGCKLIQCCESYLVNKNIQLIHVATQTSNVAAINLYIKNDFLVENTSVWL
FT                   YKSNSS"
FT   CDS_pept        313601..314752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0305"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93069"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93069"
FT                   /db_xref="GOA:Q7MPQ7"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPQ7"
FT                   /protein_id="BAC93069.1"
FT                   /translation="MFETNYMIPFNKPPVTGEELQFIQEAISCGKLSGDGEFSRKCENW
FT                   FVSHTGTTKALLTPSCTHALEMAAMLIDIQPGDEVIMPSYTFVSTANAFVLRGAKVVFV
FT                   DIRADTMNIDESKIEVAITERTKAIVPVHYAGVACDMDTIMGLSDKYGLYVIEDAAQGM
FT                   MSTYKGRALGSIGHIGTYSFHETKNYTSGGEGGLLLVNDQSFSQRAEIIREKGTNRNQF
FT                   FRGMVDKYTWVDVGSSMLPSEIQSAYLWAQLINAKRINEKRINDWNYYFDSLLPLKEKG
FT                   LIELPNIPIECTHNAHMFYIKLPDLTQRTRFIEAMFKQGVLSVFHYIPLHSSPAGKSFG
FT                   RFNGKDIYTTMESEKLVRLPMFYGLALSERNKIISTIFDILES"
FT   CDS_pept        314752..315870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0306"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93070"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93070"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPQ6"
FT                   /protein_id="BAC93070.1"
FT                   /translation="MFQDKHVFFVDVEDNFIYLNVDALIYRAGVEPSNIVIVFFGKNDG
FT                   FYKVRKIVGVEYFLFDYINIKDVIFSKTITFISINANNVFYISKIIDIDTCVCDKTYIL
FT                   ITDDEVERWGKCIDVHGVIKKDKALNISSEEVEVTSKIKWFIGNSNTFEDKIRHALKRN
FT                   DFKLINAGIIFDTLPVNESNCFSDLLSRCEAWNGKEKKILIGTKKKSFSIREVKAVMRS
FT                   LCKFKLGEEYKVVIMWHKKNRKQRLLLDLYTIWLRHFKQQTLDISYVTELSPLAYTSLI
FT                   SSCSHIILQKRGGASTVRTYLKFGAGVVCIPSGTDNEFGFKRALDLDVISFDSTDDLMK
FT                   KIINSKIDIKYNESCTRMEELRSASVLSMLYN"
FT   CDS_pept        315923..316864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0307"
FT                   /product="acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93071"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93071"
FT                   /db_xref="GOA:Q7MPQ5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPQ5"
FT                   /protein_id="BAC93071.1"
FT                   /translation="MKFRQDINGLRAIAVLGVITFHFFPNAMPGGFSGVDVFFVISGFL
FT                   MTGIIVESINKDNFSILRFYKSRFNRIAPALVVLCITLIILGWFILMPLDYKLLGKHIT
FT                   NSILFFSNVIYLRESGYFDVSSYDKWLLHTWSLSVEWQFYLLYPCVILLLRRFFDFNII
FT                   KKAILLMTLLGFIVSAYMSYTSPNSAYYLLVSRSWQMFIGGVVYLFPFYVGDKCQIRMH
FT                   ILGIILIVFSYFFISQHLPWPGVGSLLPVIGAALILFSNYQGGFISQCGIFRSIGSWSY
FT                   SIYIWHWPVVVFYITMIFKAIIFYSVYLALYY"
FT   CDS_pept        316777..317868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0308"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93072"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93072"
FT                   /db_xref="GOA:Q7MPQ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPQ4"
FT                   /protein_id="BAC93072.1"
FT                   /translation="MALACCCFLYYYDLQGYYFLFGLFGSILLGFISYRYIELVGYIYL
FT                   SSNVKNSYFVFLIVVFISVGIVGRAIYKTNGMEWHYSEMVVNSINEVNNVNPRKKECHV
FT                   GTGKVPECVYGGNEIAVIVIGDSHAQSIIRSVEKSLPKGRGVLDWTMSGCRTISSLYNT
FT                   FNHGLIDHSCGEFVSYAIDRLSDYPRVPIIVDNRYNYTVMGPNEPELIAQKDKVMEFIP
FT                   SVANFERRDEVYISKMNEAFVETLCKLSKNNPLFILEQTPEMKQNVPQTMAREFMKGNE
FT                   DFRVKLPIEEYQERNAIFTKVVSKLSTDCGINLISVVDKFCDNKYCYGDIEGRPVYFDD
FT                   DHLSEFGASQLIPEIEKQLQSHF"
FT   CDS_pept        317976..319166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0309"
FT                   /product="predicted nucleoside-diphosphate sugar epimerase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93073"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93073"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPQ3"
FT                   /protein_id="BAC93073.1"
FT                   /translation="MNPILPLIGRTNALFTQDIAQHEAELSRIVSESRFLVLGGAGSIG
FT                   QAVTKEIFKRHPQKLHVVDISENNMVELVRDIRSSFGYIDGDFQTFALDIGSIEYDAFI
FT                   MADGQYDYVLNLSALKHVRSEKDPFTLMRMIDVNVFNTDKTIQQSIDAGVKKYFCVSTD
FT                   KAANPVNMMGASKRIMEMFLMRKSEQIAISTARFANVAFSDGSLLHGFNQRIQKNQPIV
FT                   APNDIKRYFVTPQESGELCLMSCIFGENRDIFFPKLSEALHLITFADIAVKYLKQRGYE
FT                   PHLCANEDEARELAKTLPAQGKWPCLFTESDTTGEKDFEEFFTDKEVLDMARFENLGII
FT                   KNEPLYQPELLSLFEEQIAQMKDQRAWSKEQIVALFFTMIPDFGHKDTGKYLDSKM"
FT   CDS_pept        319179..320324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0310"
FT                   /product="putative aminotransferase"
FT                   /note="involved in regulation of cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93074"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93074"
FT                   /db_xref="GOA:Q7MPQ2"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026385"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPQ2"
FT                   /protein_id="BAC93074.1"
FT                   /translation="MNAQLLVEFVRDQYQTQDFIPLHAPTFAGNEKAYVMETIDSTFVS
FT                   SVGKFVDEFERKMEAFTGTPKAVATVNGTAALHAALYMAGVERGDFVITQALTFVATCN
FT                   ALYHMGAEPIFVDVSPVSLGLCPKAMDAFLEENAQVTEGGCIHKQTGRRIKAVVPMHTF
FT                   GHPVELDELLAVCLKWNISLVEDAAESLGSFYKGKHTGTIGDFGAVSFNGNKIITTGGG
FT                   GMVLCGSEEAGKRTKHVTTTAKVPHPYEFFHDEPGFNYRMPNLNAALGCAQMEVLEHYL
FT                   AQKRQLAHQYQAFFASSDVTFVVEPEYAQSNYWLNAIICADAQQRNELLEQTNAAGVMT
FT                   RPIWQLMHRLPMFEQALRGDLTHSEFIEAHLINLPSTPVGA"
FT   CDS_pept        320339..321517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0311"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93075"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93075"
FT                   /db_xref="GOA:Q7MPQ1"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPQ1"
FT                   /protein_id="BAC93075.1"
FT                   /translation="MSVNQKKVAVFTGTRAEYGLLFWLLKDIQADPVLQLQLLVSGMHL
FT                   SPEFGETYQQIERDGFHIDEKIEILLSSDSAVGTAKSMGLGVLGFADALARLKPDVLVI
FT                   LGDRFEALAAAQTAMILRLPVIHLHGGEITEGAYDDAIRHAITKLSYLHGTSTEAYRQR
FT                   VIQLGEAPERVKNIGAIGLDHLKRAQFLDVPALAQSLNFPLTQPYFLVTYHPVTLGEEA
FT                   PETSFQALLDALDSYPEHQIILTYPNADDGGRRIIPMLEAYAAANPQRVLAIPSLGQVR
FT                   YLSAVKHASVVIGNSSSGIIEVPAFDVPTVNIGVRQQGRLAAKSVLHCRASKEEIEQAI
FT                   QTAITIGYKADGEVIDNPYGQGDSSAQVIAMIKSLHFEPCKSFYDLPFEPIE"
FT   CDS_pept        321524..322597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0312"
FT                   /product="sialic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93076"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93076"
FT                   /db_xref="GOA:Q7MPQ0"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020007"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPQ0"
FT                   /protein_id="BAC93076.1"
FT                   /translation="MTLIIAEAGVNHNGDEALAFKLVDAAHQAGADIVKFQTFKAKNLV
FT                   TEQAKQADYQVANTQKQESQLAMLSRLELSYAAHHQLVKHCESLGIEFLSTAFDSESLD
FT                   FLVNDLGLTRLKLPSGELTNAPLVLEHARTGCDLIVSTGMATLAEIEMALGVIAFGYTA
FT                   ADHVAPSVLAFQQAYASNEGQKALKEKVTILHCTTEYPAPMAEINLKAMDTLGKAFDLP
FT                   AGYSDHSEGITIPIAAVARGAVLIEKHFTLDKNMEGPDHKASLEPDELTAMVKAIRQVE
FT                   LALGSAVKSPTVSEVKNKAVARKSLVASQAIQAGDAFSADNVTIKRPGNGMSPYQYWEM
FT                   LERKASRDYQIGDLILE"
FT   CDS_pept        322590..323225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0313"
FT                   /product="putative acetyltransferase"
FT                   /note="isoleucine patch superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93077"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93077"
FT                   /db_xref="GOA:Q7MPP9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPP9"
FT                   /protein_id="BAC93077.1"
FT                   /translation="MNKPLPLVLIGGGGHASVLADILLGQGREILAVICPDDVSSRAAL
FT                   AGILHLTQDEDITRFSPESVRLVNGIGMMPRSTFRQRINEKFLAQGYVFETVIASDAKV
FT                   SSFAEVKSGAQIFPGARVQTGAVIGEHTIVNSEALIEHDCRIGAYNHIAPHATLCGGVS
FT                   SEEQVFVGAGAILLPGLSLGRCSIVGAGVTIRSNVVADMTVSGKVVAR"
FT   CDS_pept        323240..324301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0314"
FT                   /product="putative sugar-phosphate nucleotide transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93078"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93078"
FT                   /db_xref="GOA:Q7MPP8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPP8"
FT                   /protein_id="BAC93078.1"
FT                   /translation="MKNNWKKAVLSPDATIKEALRVIDAESLRVALVVDEKGILQGVVT
FT                   DGDIRRGLLAGKALETMLSEVMNRKPITASVSADRDDLIARMNKSDLLFIPLVDGPYLA
FT                   GLATLHGALVDKPLYQNPVFLMAGGFGTRLRPLTDSCPKPMLKIGNKPILETVIRSFIK
FT                   AGFVNFYISTHYMPELIHAHFGDGSGFGVNITYVHEESPLGTGGALGLLPKDLPKDLPL
FT                   IMMNGDVLTKVDFQRLLDFHVTHDADATMCVREYDYQIPYGVINGEGNKITSMVEKPIQ
FT                   RFFVNAGIYVVSPRVIQSVPENHRIDMPTLLEQHMQERNNVLMFPIHEYWLDIGRMDDF
FT                   NRAQADIHTLGLD"
FT   CDS_pept        324301..325299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0315"
FT                   /product="predicted dehydrogenase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93079"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93079"
FT                   /db_xref="GOA:Q7MPP7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPP7"
FT                   /protein_id="BAC93079.1"
FT                   /translation="MERVAVVGLGNIATRHRRNLKHLFPSALLYAMSASGRVPQEMVND
FT                   ADLLVTSIEELIELRVQLVVIASPAPFHALHSIPLIKAGIPVLIEKPVTATVDDVKRLQ
FT                   SIASQYKTPVSIGYCLRYLSSALQMKSLLSLGKIGYLYHAHVEIGQYLPDWRPSKDYRD
FT                   SVSAKASLGGGALLELSHEFDYTQWLLGDLTLEHAILRQTKELGLDVEDSADLLLSTSK
FT                   QAIVHMHLDFLQRKAHRQCRFVGSKGALEWDLIGNEIRFVTPQGVQVLYSEPKWDKNQM
FT                   YTAMLADFVAQIHQQPNQCVSLAEAAQSVELIEEIKRRFPITSVSGELKGE"
FT   CDS_pept        325292..325993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0316"
FT                   /product="CMP-N-acetylneuraminic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93080"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93080"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPP6"
FT                   /protein_id="BAC93080.1"
FT                   /translation="MNNRMKNCAFIFARGGSKGLPRKNIKLLAGKPLLQYSIDTALATP
FT                   SIEHVFVSTDDTEIADVARASGAIVIERPAELASDTSPEWLSWRHAIEWVQARYGEFDG
FT                   FISLPATSPLRSIDDVEGAINKLFTTEADICISVTPASRSPFFNMVKQTETGMVELVNK
FT                   PQGEVARRQDAPAVFDITTVVYATTPHFVLNHYGIFSGKVTSIEVPKERAVDIDDIYDF
FT                   KLAQAILEETN"
FT   CDS_pept        325993..326766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0317"
FT                   /product="dehydrogenase"
FT                   /note="with different specificities related to short-chain
FT                   alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93081"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93081"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPP5"
FT                   /protein_id="BAC93081.1"
FT                   /translation="MEQLLNNKTILVAGAGGLLGTRLVPALLKQGAKVIAADIHVEAMR
FT                   ERLSSLGVDLQDKKLCCCELDVTKEESVKAFFNKQAQHIDGAVNSTYPRNKTYGKHFFD
FT                   VSLDSFNENLSLHLGSAFLFTQQCAAYFKLQQQPFSLVNISSIYGVVAPKFEIYNNTPM
FT                   TMPVEYAAIKSAIQHLNKYVVSYVNDSRFRINCVSPGGIFDHQPEAFLQAYKEKTHGAG
FT                   MLDVEEVVGSVLFLLSEQSRYVTGQNIVVDDGFSL"
FT   CDS_pept        326780..327424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0318"
FT                   /product="glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93082"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93082"
FT                   /db_xref="GOA:Q7MPP4"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPP4"
FT                   /protein_id="BAC93082.1"
FT                   /translation="MKIVIIDYDMGNVRSIENAINHIGDYTIIVSGEPDTIRSADCLIL
FT                   PGVGAFPDAMKKLEQQKLIDLLTEEVVVRRKPVLGICLGMQLLFESSEEIQLTKGLGWI
FT                   PGKVEYMRPGNDLRVPHVGWNSLILKKENSLFDYLQDDKDFYFVHSLWVNCPEKYKLAT
FT                   FEYGIEMTASVQYENIVGMQFHPEKSQRNGLEAIRSFLDWVKIQKLGVSHA"
FT   CDS_pept        327408..328226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0319"
FT                   /product="imidazoleglycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93083"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93083"
FT                   /db_xref="GOA:Q7MPP3"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020021"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPP3"
FT                   /protein_id="BAC93083.1"
FT                   /translation="MFHMLKIRLIPCIVTKGELVVQSFAFKNYLPIGNVKTAIDFFVNW
FT                   DVDEIIVNDIDASKEFREPNVDLVSWAAKECFVPLTVGGGIKTLEHIRNLLKAGADKVT
FT                   INTKAIDDPDFIKNAASVFGSQCITVSVDAIKQGNVYKLYDYRDGRVLDVDVVDWVRKV
FT                   ESYGAGEILLNSVDRDGSREGYDVELLKTVSGIVSIPVIALGGIGRFDQLAEGAIEGGC
FT                   QALSAANIFQHMEHSTIAAKAQMRNAKLNVRLSSKVKYENFDLDFLGRPY"
FT   CDS_pept        328252..329520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0320"
FT                   /product="putitive LPS biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93084"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93084"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPP2"
FT                   /protein_id="BAC93084.1"
FT                   /translation="MKYCKRCLYPENHALNLIFDVDGVCSGCRVHEEKYQIDWNEKQNE
FT                   LQKLLEHYKGRPGSHYDCVIPVSGVGDDFFVVDLIKNKYGLNPLLVTYNTHFSTKVGVR
FT                   NLARLITELDCDHMMSTVGPDTVKEITRLTLDKLGDMYWHVLAGSQTFPVQVATKLDIP
FT                   LIIWGVNGWLDQVGMFSHHDRVEMTKKVRKEHALRGIDAEHLIGTSEKVSAKDLQAFTY
FT                   PSDEQLESSRVRGLYIGNYVFWDSQKQIENVIKRFGYETNQQERTYNKYESIACANNAS
FT                   VHDYVKFLKFGYAKVNDHVARDIRLKRITREQGLSLIKEYLPRKPESLNTFLEWIELTE
FT                   KEFHQAIDKFRDPRAWEKVGNNWVLKDSVLDIDLANSEQELIVEDPREYIQTKLLEEQS
FT                   FEDEYILLGRTYIDEANYKAKEG"
FT   CDS_pept        329524..330660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0321"
FT                   /product="putitive LPS biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93085"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93085"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPP1"
FT                   /protein_id="BAC93085.1"
FT                   /translation="MKFCSNCVMPDTKPGIVLDERGFCNACRTKEVKEKIDWTARYNDL
FT                   SLIVEDIKAQNNPFYDCIVAVSGGKDSWYQAAVLAEEFGLKVLCVTLAAHLPTTEGIDN
FT                   LNEMIKDLNVDHMKITIKPSVFRKIRRKCFLRQGEPNWAEHCAMFSSVVNTALIYDVPL
FT                   VVWGEDIAFEFGGLQRSESKPSAIAINKSDLIKEKTIHDWLDNDISERDIFFYKYPDYQ
FT                   KLQDAGVKSIYLGHFVRWYGRQNYEFVKKRGFTGRREGPLPGNFLDYDNIDEKLCEINI
FT                   WFKYLKFGFWRATDQTCYDIWNDRMTRDEAVDIVNRLQAEFPSNDFEHFLRFHDITEEQ
FT                   FWETVEKFRNHDIWEQVDGEWKLKYTLEKSQSDEASNA"
FT   CDS_pept        330653..331204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0322"
FT                   /product="acetyltransferase"
FT                   /note="isoleucine patch superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93086"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93086"
FT                   /db_xref="GOA:Q7MPP0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPP0"
FT                   /protein_id="BAC93086.1"
FT                   /translation="MLSVYRKIRFWLTAQRVGPDMPMTHWMLFSQRLGYFLCKRKFKYF
FT                   GHGASIRPGAYAVATDKISLGNNVVIRPGCMLHADPEPNGAEIIIEDDVLIGSSVHIYL
FT                   DTHAFSDISQPIYYQGFYEAKSVTLKKGCWIGAGVIILPGVTIGKNSVVGAGSVVTKCV
FT                   PDYSVAVGNPAKVIKTLSSI"
FT   CDS_pept        complement(331268..332260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0323"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93087"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93087"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPN9"
FT                   /protein_id="BAC93087.1"
FT                   /translation="MNVFLVTSPFQYICANEAREYFNTETNLLVLVEQDTPRGQKNMDH
FT                   IFDQSKWDDIIRLPRTNRTFQVPKAINYIKNKNENIENLFLSEYHGWRSNVFIKNVPAE
FT                   KIIYLDDGLATLIEYEEQIKPDIPYKRKRIFNDLVLKLQGITPPNYMQRQKNFEIFTIF
FT                   ELEETSVKIHRNRMSSLRSCLNSAACYEPSAPIGFIGEANVGVYKEGVQPVGYLSTIRN
FT                   VLAESGRPMIYFPHRMEQDDIFKAVSKIPGVTIHNSESPIEREIGEKNIKLSHLYGYSS
FT                   TALYTLSIIYCEIPIHILENENMAGSLSNSFNNYLIKQFKTNKKPSIKL"
FT   CDS_pept        complement(332267..333529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0324"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93088"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93088"
FT                   /db_xref="GOA:Q7MPN8"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPN8"
FT                   /protein_id="BAC93088.1"
FT                   /translation="MLVRLIYTLLLALAAPLLLFGLYRSKPNKPKFNQRWKEHFGITPK
FT                   LVGQNQPLWIHAVSVGESLAAIPLIKAIKEKTPDQVIVVTTTTSTGAEQIAKLGNLVEH
FT                   RYMPIDFAFAVRGFLKAINPAKMLIIETELWPNTLATVHKANIPIIVVNARLSEKSQQN
FT                   YAKVQPIFNLIHPCLSKVLCQSQADADHFAQLGVPTNKLCVTGSIKFDIHISDEIKHQG
FT                   AELRTLLGQQRPVWIAASTHKGEDEQVLDSHRQVLETHPNALLILVPRHPERFDSVFEL
FT                   CRTKGFETVRRTQAHSIADSTQVYLGDTMGEMLVLLGAADVCFMGGSLVGDKVGGHNVL
FT                   EPAALGVPVITGPSCYNFKEITIALEQAKGIIVAESSLLGRKTQLLLSNSNEQTRMADA
FT                   ALKVVQKNQGALAQTQSICME"
FT   CDS_pept        complement(333523..334581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0325"
FT                   /product="ADP-heptose:LPS heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93089"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93089"
FT                   /db_xref="GOA:Q7MPN7"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPN7"
FT                   /protein_id="BAC93089.1"
FT                   /translation="MRKILIIGPSWVGDMVMSQSLYTTLKQQHPDALIDVIAPGWCKPI
FT                   LERMPEVNRAIEMPLGHGEFNLLGRREIGKSLREFGYDHAYVLPNSAKSALIPWFANIP
FT                   KRTGWRGEMRYGLLNDLRPNKKAFQYMVERYVALAHPREQMIDSSSLGGLETLPRPKLS
FT                   IHADAQQQTLAKFSLTVQSKVIGLCPGAEFGPAKKWPENHYAEVAHAMCQQGHQVWLFG
FT                   SQKDRDTCNGIKQSVPSKFHHQIHVLAGETSLIEAVDLLAACHTVVSNDSGLMHVAAAV
FT                   GCNVVAVYGSTSPKYTPPLAENVEIVHTDIECRPCFKRECQYQHLKCLSELTPKQVLDS
FT                   IRKLDAIAVNAC"
FT   CDS_pept        complement(334578..335570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0326"
FT                   /product="putative lipid A biosynthesis
FT                   (kdo)2-(lauroyl)-lipid IVA acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93090"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93090"
FT                   /db_xref="GOA:Q7M7K7"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011921"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M7K7"
FT                   /protein_id="BAC93090.1"
FT                   /translation="MKTERNDFDPKAHNPTFQWGFLAPKHWGIWLGLLVGLPFALMPLR
FT                   FQRWLVTKIINKLADKPPRTVHNIWTNLTLCFPDKTNAEKETILRDCLITAGVFLLNFP
FT                   LITLFGRRYLEKNCDIIGLEHLEAVREQGHNVILLTPHTWAIDVLPILLAAKGSPVVAM
FT                   VKEQKNPIGDWLMHRQRIQFGGRIYERSAGIKPYMKSIREGYIGYYLPDQDHGREQSIF
FT                   VDFFATQKATLPGLGKLAKVSKAKVVSCFTRFNVETGRYEIHIYPMWNNFPSADEYTDA
FT                   RQMNAFIEEQVSRYPEQYMWIFQLLRTRPNPEETSPYYNEALKKPTAES"
FT   repeat_region   335652..335814
FT                   /gene="rpt1T05"
FT                   /rpt_unit_seq="TAGAACC"
FT                   /note="tandem"
FT   CDS_pept        complement(335812..336753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0327"
FT                   /product="ADP glyceromanno-heptose 6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93091"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93091"
FT                   /db_xref="GOA:Q7MPN6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPN6"
FT                   /protein_id="BAC93091.1"
FT                   /translation="MIIVTGGAGMIGSNIVKALNEIGINDILVVDNLKNGRKFKNLVDL
FT                   DITDYMDRDDFLTQIMAGDNFGPIEAVFHEGACSATTEWDGKYMMLNNYEYSKELLHYC
FT                   LEREIPFLYASSAATYGETTVFKEEREYEGALNVYGYSKQQFDNYVRRLWQDAEEHGET
FT                   LSQITGFRYFNVYGPREQHKGSMASVAFHLNNQILAGENPKLFAGSEQFKRDFIYVGDV
FT                   CKVNLWFMQNGVSGIFNCGTGNAESFEEVAKAVIKHHGKGEIETIPFPEHLKGAYQEFT
FT                   QADLTKLRAAGCDVEFKNVAEGVAEYMAIVNG"
FT   repeat_region   336909..336978
FT                   /gene="rpt1T06"
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="CTAGACC"
FT                   /note="10 units of 7 bp in-tandem repeat"
FT   CDS_pept        complement(336987..339236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93092"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93092"
FT                   /db_xref="InterPro:IPR010344"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPN5"
FT                   /protein_id="BAC93092.1"
FT                   /translation="MTYFNSSSEIPSVGFRSQISAVCLGVLSALAGVTSLHSQASELET
FT                   VTLRPSQTDFGGVGLMQMPSGRMAKEGEFNFGVNLNDDYHHYYTSLQLFDWFETTIRYT
FT                   RIPDTLYNPNPDYSGDNLNTDKGIDIKFRLWQESYWLPETSIGIRDIGGTGLFDGEFIA
FT                   GTKRFGPLDVTLGVGWGYIGQSGNISNPFCKVSEEYCDRDGPTKGTGGSVDFGRWFKGE
FT                   ASIYGGIEYQTPYQPLRLKVEYDANDYTTDYPVRAVNKPMPQHTPWNFGVLYQLGDWGD
FT                   AKLSYQRGDTLTFGFNLYTNFEDLKAVWRDEPKQAVTGRPSEGNTDWQAVAQQLDSNAG
FT                   YQQSTLYEQGDALVIAGEQVKYRDRKEAQDRAAAILANNAPDYITTYKIVDTRNGVDLT
FT                   QTEFDAEAYKQAATYQYLGANSRELGSTSEPDYRENAKPLTTHRERWNAGISPVLAQSL
FT                   GGPEAFYLFHLGFNTEANYWLTDNIEASGSIYVNLADNYDKFNYVEKDPHISNFAVPRV
FT                   RTMFRSYVSDNPVRLNHMQLTWFAQPTQQVYTQMYGGYLETMFAGVGGEVLYRPLGKNW
FT                   ALGLDANLISQRDPDSWFATFDEPFVYYDGYDASNCKPNDVGCQAYVLDKGTTGQLSAY
FT                   YMPQWSLLENTLFKVSAGKFLGGDNGVRVDFSKQFKSGMIVGAFATVTDLTTEEYGEGS
FT                   YNKGFYISIPFDAMTIKPSTARGVFAWQPITRDGGQTLSRKYELFEVTNARSRWY"
FT   CDS_pept        complement(339239..340036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0329"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93093"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93093"
FT                   /db_xref="InterPro:IPR010425"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPN4"
FT                   /protein_id="BAC93093.1"
FT                   /translation="MKNGFSFVTLLSGIVASALTLSPSAVASSQESHIQQPTEVVLLNY
FT                   GLQLNYPQPVRLEQVLLDAQQQNRQQNGSPNAQALSFHEGFQLFNLDKQAEADAQLQHV
FT                   RQQLIELAKDEDYRQASQLLLTLLEKHQYGYRENINLDIDAVRLKADLNPALPGHYALK
FT                   QASRENKVLLLGLIDQKTVPFSADLDVADYIATSTLNNNGNKSEAWVIAPNGNSSKVGY
FT                   SYWNNQHMSVLPGSTIFIGFNSSNNELQALESDIVKLLGMIKG"
FT   CDS_pept        complement(340033..340764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93094"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93094"
FT                   /db_xref="InterPro:IPR021308"
FT                   /db_xref="InterPro:IPR023373"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPN3"
FT                   /protein_id="BAC93094.1"
FT                   /translation="MINLPFQQAILPRFLMRSAAVASLILLSGCVQRFDDMSTTLNEAF
FT                   FGAEDITQTSQQVLALPYASTYMRINDGQRIFMVLGYAEQNPENNQLQLKWVSSDGGMI
FT                   VTENGRVVKTLNLPYGNLIRREVDLAHSQQAKPWQTNLQWQSQYDWKTQGSNSNKGMHY
FT                   GYLGNVTLTQMGSEEAISAIWQQTLTIWQENIFFPQLDTTVQNQYWVNDSGQVMKSIQY
FT                   LGPEMTRIEFEILKPFAEVAQ"
FT   CDS_pept        complement(340797..341234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0331"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93095"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93095"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPN2"
FT                   /protein_id="BAC93095.1"
FT                   /translation="MTKIRKEKAELSSAAKNKKLSTLPPRPQLSFPRMRGSIHPHVPEA
FT                   AFGNVLTAADNDESETNSNTDNEVPKPSHGAYYTMGPRVREDDGVRESMVNLLSLTHAT
FT                   ANAKDNSCANNDGNIEASLDDCLISPFLITPSIVPLNTIFY"
FT   CDS_pept        complement(341032..341454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0332"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93096"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93096"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPN1"
FT                   /protein_id="BAC93096.1"
FT                   /translation="MQRQRTKKLSAPPPRPQSSFQRMRGSIHPHTPEATFGNALTATDN
FT                   NESETSSNNEALKPSYSARYTMGLRVREDDKNKKRKSRAKLSGKEQKTQHTAATPSTVI
FT                   PAHAGIYSSTRARSRVWKCTHRSRQRRKRNQQQHRQ"
FT   CDS_pept        complement(341790..342134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0333"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93097"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93097"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPN0"
FT                   /protein_id="BAC93097.1"
FT                   /translation="MRGSINPHAPDAAFGNVLTTTDNDESETSSNNEARKTSHGARYTM
FT                   GPRFREDDKNKKKSSKCSSKEQKTQHTAATPPTVIPAQTGIHSSTRARSRVWKCTRRDK
FT                   QQLKRNQQQQ"
FT   CDS_pept        complement(342350..342628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0334"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93098"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93098"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPM9"
FT                   /protein_id="BAC93098.1"
FT                   /translation="MPEAAFGNALAATDNDESEANSNTGNEVRKTSHGARYTMGPRVRE
FT                   DDKNKKRKSRAKFSGKEQKTQYTAATPSTVIPVHTGINSSIHARSRV"
FT   CDS_pept        342639..342917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0335"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93099"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93099"
FT                   /db_xref="GOA:Q7MPM8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPM8"
FT                   /protein_id="BAC93099.1"
FT                   /translation="MDPRIHGNDSWWRGGGVLSFLFFAAELSSAFSFLIFVILAKAGTH
FT                   QIASAVDRFWRFIVAAGFAFVVVCCGECISKRGFWHVWMNLSPYARE"
FT   CDS_pept        complement(343150..343440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0336"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93100"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPM7"
FT                   /protein_id="BAC93100.1"
FT                   /translation="MKTYIYKGIIMKKIALAALIALGVSSTAFAAGEAATATTATSTTA
FT                   STGAAAGAGAGAAGAGAATTAAVAAGAAVAATAVVVSSNNTTGTTGTTGTN"
FT   repeat_region   343155..343181
FT                   /gene="rpt1T07"
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="TAGTACCAG"
FT                   /note="3 units of 9 bp in-tandem repeat"
FT   CDS_pept        343944..345176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0337"
FT                   /product="outer membrane capsular polysaccharide transport
FT                   protein"
FT                   /note="surface assembly of capsular antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93101"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93101"
FT                   /db_xref="GOA:Q7MPM6"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR040716"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPM6"
FT                   /protein_id="BAC93101.1"
FT                   /translation="MLSKALERNGVQSNLCSFKSAVNTLNLDDLAYMELKTKLLLAMLA
FT                   PALLAGCTVPGSHLSTDNKNLVEVNDSSQESNLSEVVNLYPLNAQSVTEYAKAQHFTSR
FT                   ANPELDVQIARYEYKVGPGDILNVTIWDHPELTIPAGSYRSASEAGSWVHADGTIFYPY
FT                   IGTVEVADKTVREIRADIAKRLAKFIESPQVDVNVAAFRSKKAYITGEVKVSGQQSITN
FT                   IPLTILDAVNRAGGLAEDADWRNVTLTRNGEEQTISLYALMQRGDLTQNRLLEPGDIIH
FT                   VPRNDSQKVFVMGEVKDPKLLKMDRSGMSLTEALSSVGGINELSADATGVFVIRTSDNK
FT                   SERMADIYQLNIKDASALVIGTEFDLKPYDIVYVTAAPITRWNRVISQLMPTITGFNEL
FT                   TEGALRVKTWP"
FT   CDS_pept        345316..345687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93102"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93102"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPM5"
FT                   /protein_id="BAC93102.1"
FT                   /translation="MRYKELEIWKRSYQVVLQVYNLLKTCRDYGLKDQISRSAVSVPSN
FT                   IAEGSERGSYKDNIRFLYIAKGSCAELATQISLAADLGYIPIEAGQKLESEILEIGRMI
FT                   GGYIKFLSQHVKEESAEYF"
FT   CDS_pept        345845..346285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0339"
FT                   /product="cytoplasmic phosphatase"
FT                   /note="surface assembly of capsular antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93103"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93103"
FT                   /db_xref="GOA:Q7MPM4"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPM4"
FT                   /protein_id="BAC93103.1"
FT                   /translation="MFNKILVVCVGNICRSPTGERVLQKLLPNKTVASAGIAAEKSRLI
FT                   GKPADAMAIEVAKENGVDVENHQSQQLTSALCSQYDLILVMEKGHMEALTQIAPEARGK
FT                   TMLFGQWIGQKDIPDPYRQSKEAFAHAYQLIDEAAQAWAKKL"
FT   CDS_pept        346520..348700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0340"
FT                   /product="putative tyrosine-protein kinase Wzc"
FT                   /note="surface assembly of capsular antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93104"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93104"
FT                   /db_xref="GOA:Q7MPM3"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPM3"
FT                   /protein_id="BAC93104.1"
FT                   /translation="MNETMTTPQNRSSVDNSSDEIDLGKLLGILLDAKWIILVTTFLFA
FT                   VGGVAVALLSTPIYKADALIQIEQKSSGGISSLVGDMGELFSQESSATTEIEIIKSRMI
FT                   LGDTVDKFNLTTVAEPKYLPVIGKGLARIAGKVNQIEISRYTVPEYAQEMKHTLVVLDA
FT                   EKKTYQLVRGDEQVVLQGAAGELAKKDGYELFVTELRSHNEQEFSLSQQSRLEAIEWLK
FT                   KNLAISERGKQTGILMLSFEGENRKQISEILNHISQTYFLQNVERNSAEAEKSLTFLKG
FT                   HLPDIKNSLTTAEDTLNRFRQDNESIDLGLEAKSTLDVMVKLEAQLNELTFKESEISQR
FT                   FTKDHPAYRSLLDKRETLLKERERLNQQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNK
FT                   VQELSIIKAGTVGNVRILDEAQSYAKPVKPKKPLIVVLATLLGGMLSVALVLVKAAFHR
FT                   GVENPDEIEQIGLSVYASVPKSNLQLELANKLARKKRNTDLTLLAESNPADLSIEALRG
FT                   LRTSLHFAMMEAKNNVLMISGPAPGIGKSFVSTNFAAVAAKTGQKVLLIDADMRKGYLQ
FT                   QCFGLNWENGLSDLLSGKVTRDVAVQSAKVENLDIITRGQVPPNPSELLMHPRFKELVD
FT                   WASENYDLVIVDTPPVLAVTDPSIVGAIAGTTLMVARFGQNTVKEIDVARSRFEQAGIE
FT                   VKGVILNAIEKKASSSYGYGYYNYSYGESNKA"
FT   CDS_pept        348769..349908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0341"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93105"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93105"
FT                   /db_xref="GOA:Q7MPM2"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPM2"
FT                   /protein_id="BAC93105.1"
FT                   /translation="MLVSCMSKKKVLTVFGTRPEAIKMAPLVHALAADERFEAKCCVTA
FT                   QHREMLDQVLELFEITPDYDLNLMKAGQTLNEVTARILLELKPVLQEFKPDVVLVHGDT
FT                   ATTFAASLAAYYEQIAVGHVEAGLRTGNIYSPWPEEANRKLTGALTKYHFAPTETSQQN
FT                   LLQENYAEENIFVTGNTVIDALLMVKEKIEQDADLKATLAAQFPYLDENKKLILVTGHR
FT                   RESFGGGFERICEALAQTAKQHPEVQILYPMHLNPNVREPVNRILGSVENVLLIEPQQY
FT                   LPFIYLMDRAHIILTDSGGIQEEAPSLGKPVLLMRDTTERPEAVAAGTVKLVGTDVEKI
FT                   VSNLNTLLTDSEAYQAMSFAHNPYGDGKACQRILDSLCK"
FT   repeat_region   349922..349956
FT                   /gene="rpt1T08"
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="CCTAGAA"
FT                   /note="5 units of 7 bp in-tandem repeat"
FT   CDS_pept        349990..351252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0342"
FT                   /product="UDP-N-acetyl-D-mannosaminuronate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93106"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93106"
FT                   /db_xref="GOA:Q7MPM1"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPM1"
FT                   /protein_id="BAC93106.1"
FT                   /translation="MSFETISVIGLGYIGLPTAAMFASRKKKVIGVDVNQHAVDTINQG
FT                   KIHIVEPDLDMMVHAAVSGGYLKATTTPEAADAFLIAVPTPFLPCAEGDIPPPDLSYIE
FT                   AASKAIAPVLKKGDLVILESTSPVGATEKMAAWLAEARSDLTFPQTYGEEADVNIAHCP
FT                   ERVLPGHVVRELVENDRVIGGLTPKCSARAVELYKTFVQGECVITNARTAEMAKLTENS
FT                   SRDVQIAFANELSIICDKLDINVWELIALANRHPRVNILQPGPGVGGHCIAVDPWFIVS
FT                   KTPEEAQIIHMARKVNDSKPQWVINKVKLAIADFLQANPEKTAKDMTIACYGLAFKSDI
FT                   DDLRESPSLEIAKKVSEFHRGKVLVVEPNIAQLPSELDGNVDLVDISDTNYADLHVVLV
FT                   GHKEFGSNLFDKKNTIFAVNV"
FT   CDS_pept        351200..352519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0343"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93107"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93107"
FT                   /db_xref="GOA:Q7MPM0"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPM0"
FT                   /protein_id="BAC93107.1"
FT                   /translation="MGQIYSTKKIRFSQSMSSLKSNITKGALWQSISIVSTFILIPISI
FT                   SYLGKEDYGLWIVLYSFILLLQSCDLGISSSCRNSLTKLLTQNNKVEAKYLLSTSYVIL
FT                   AGLSLGLLAFIYIIQKTVGIDALQAFPISIFAPILCVVLLDYNLKLVLTVYTSNHKAFV
FT                   LPLSTAMANVLFLMVVATLHFLDVGESNRLILFCFILPVCSLITNAFITLHAYNNGFKF
FT                   LKPSIFFFKKDYFQPLVLSGVSFFVIQVSMAILTQYASILVFEYSSSEVVADLSILDKF
FT                   FGMISVVGAVLLFPFWSKFTQKYTERDFDWIRKCILKLELFFIFTCFCVLILWYLFPFF
FT                   LDVWMTDNDEIAPSLSTIVAIKYLMIFLNSIYSYYLNGIGKLKIQIILYSLGATFIIPI
FT                   SSMLFQVFGVEGVVGYSVLIYFLLAISQKTYIVLSLKGER"
FT   CDS_pept        352520..353737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0344"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93108"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93108"
FT                   /db_xref="GOA:Q7MPL9"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPL9"
FT                   /protein_id="BAC93108.1"
FT                   /translation="MGGVCIAFLYFTNPFLFGRVFWGSDLITLALIFSSALFLLKNNAC
FT                   FSQKISPLKLSLLLSLSLYFITTTIIRLRVGQDFGDLSLHFYQYLSVLILLALRIDHRN
FT                   LEIFYKAICIALLWHVWTIIPQLPLNGFLSSKLSSQTAYAVGEYSIGGLSRRATGFFTA
FT                   PGYLSLFASSSLAIGVLLCISKVNKLNTSILILSCMAGFGSFSRTFMVIFILLVIYILI
FT                   VSRFKHKIFYGAILLLLGSYFTSTTIFKDYLGFVGERLAQSTDFSSNDRITGDTGVLIV
FT                   LEAIAQNPFTGSAIAPDGGDIKASVDGRIIRPHFGILAIISFYGVVVSLALVIPMLFAL
FT                   FKSFTTFTSNKDIEKPVTAAFLAAFLVCVAEPLIDTNLTVIFMAFSLLLSSEFYKNRSF
FT                   SSDFNH"
FT   repeat_region   353594..353617
FT                   /gene="rpt1T09"
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="GCAGCATTTTTA"
FT                   /note="2 units of 12 bp in-tandem repeat"
FT   CDS_pept        353721..354437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0345"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93109"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93109"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPL8"
FT                   /protein_id="BAC93109.1"
FT                   /translation="MILITNKVKTCDNLKDQRLSQAGLNYQAKLSEFLNPELELSLVPV
FT                   FLDYDYDNEEGSKHVFVNTIPRKGRFFRSLRYITDSFKLFFLACSSKEKSVLIYNLDIH
FT                   NLLFVFLNVYFSSKKNYIVVADYIVHKRHFTKVIFDFIYKKVDGVIVLNDRICINENTQ
FT                   LLAGLVRSGDVVQSKKFVSINDAIFSGSLGKTTGFELCLEAFSKLPDIRLNITGKPYHY
FT                   SENDFNFIISKFNSFE"
FT   CDS_pept        354394..354813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0346"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93110"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93110"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPL7"
FT                   /protein_id="BAC93110.1"
FT                   /translation="MILILSLVNLIASNNINFYGLIPMDEYKSLLEQSEIAFSLRDPAD
FT                   MEHDFNFPSKILEYLAAGKFVISSKMYSFIPEGILFYCDFNTDSLVKAVKKVQSLSIEE
FT                   QEAYKIRVYKFIMDNFTESRLIDCLNRLENDQQVF"
FT   CDS_pept        355295..356344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93111"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93111"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPL6"
FT                   /protein_id="BAC93111.1"
FT                   /translation="MKVMRKVLFLYSEIGPYNIPVFEELSKTFNCDIHVVRWDKNCLKP
FT                   YSPKRIDHVTYYKRSKFDENKLKDLIEFINPEIIYVSGWMDNLYLKIVEPIKPKGIPIV
FT                   IGFDDIWTGSLRQVLGQYYFRVRLNKYFSHAWVAGEAQYEFARRLGFSRENIIFDLLSA
FT                   DIKNFSSVKYNENANFFLYVGNFRKVKGTDLLAKSFKFYRDELNGNFKLLCIGNGELIS
FT                   ALSDNSNIIVQGYTEQSELIKAIGQASAFILPSRHDQWGVVAHEFATAGLPLIMSTGVG
FT                   ARSKFLINGYNGFVFENGSSLDLAHKMKAFESISSEEKSNMSKRSRELGTRISPQSSAA
FT                   SFMSLLGYK"
FT   CDS_pept        356341..357423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93112"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93112"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPL5"
FT                   /protein_id="BAC93112.1"
FT                   /translation="MNKLLINFFSAKSGGGKVILDNFMEHFDADDVEIHFIFPSEYDFK
FT                   FEKHLEVKVPKWMNKPYGLFWFYFFFVPNYCRKNGISKVLNFGDVIFPRLKSQTYFFDW
FT                   AYLVLDDSNIWSSMDFKSRFIRMLKAALIKAFKSNNKTVIVQSEAISSSYKKILGFEGE
FT                   IVVAPTPVSINNIDGMSHGIDKNSLVYISNYAPHKNFEIIPRVASILKQNKVDCSIVLT
FT                   IDENSIHWRNLSCELSGLGVLDMVKTLGPLSQEDVFSVLKSSRALFFPSKLESYGIPLI
FT                   EAMILGKPVLTSDTPFIKSVCGDAVLYFDPKCPEDIATKITDFIDGVDYCRMRQSEVSK
FT                   VLENIPSWDQYTRLLIKSSI"
FT   CDS_pept        357438..358559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0349"
FT                   /product="GDP-mannose-4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93113"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93113"
FT                   /db_xref="GOA:Q7MPL4"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPL4"
FT                   /protein_id="BAC93113.1"
FT                   /translation="MPNKVALITGVTGQDGSYLAEFLLEKGYEVHGIKRRASSFNTERV
FT                   DHIYQDRHDDNPKFFLHYGDLTDTSNLTRILKEVQPDEVYNLGAQSHVAVSFEAPEYTA
FT                   DVDAIGTLRLLEAIRFLGLEKKTKFYQASTSELYGEVQEIPQKETTPFYPRSPYAVAKM
FT                   YAYWITVNYRESYGMYACNGILFNHESPRRGETFVTRKITRGLANISQGLEKCLYLGNM
FT                   DALRDWGHAKDYVRMQWMMLQQVTPEDFVIATGRQISVREFVSLSAKELGITLEFSGEG
FT                   IDEIATVVSIDGENAQVLKVGDVIVRVDPRYFRPAEVETLLGDPTKAKEKLGWEPEITV
FT                   EEMCAEMVQHDLAKAKQHALLKSHGYSVSVPVE"
FT   CDS_pept        358588..359595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0350"
FT                   /product="putative nucleotide di-P-sugar epimerase or
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93114"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93114"
FT                   /db_xref="GOA:Q7MPL3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPL3"
FT                   /protein_id="BAC93114.1"
FT                   /translation="MITQLMLDFIMDKEMSSKTVFVAGHTGMVGSAIVRKLKQSNDIKV
FT                   ITKSRAELNLLDQQAVRTFFEENQIDQVYLAAAKVGGIVANNTYPAEFIYENLTIQSNI
FT                   IHSAHLSGVNDLLFLGSSCIYPKFAEQPMTETALLTGVLEPTNEPYAIAKIAGIKLCES
FT                   YNRQYGHNYRSVMPTNLYGENDNFHPENSHVIPALIRRFHEAKLAGDGKVVAWGTGKPR
FT                   REFLHVNDMAEASIHVMNLDSKKYSVNTQEMLSHINVGTGVDCTIRELVETVAKVVGFE
FT                   GVIEFDVTKPDGTPRKLMDVSRLKSLGWEYSISLEVGLRDTYGWFLANQDNFRK"
FT   CDS_pept        359606..360088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0351"
FT                   /product="putative GDP-mannose mannosylhydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93115"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93115"
FT                   /db_xref="GOA:Q7MPL2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR033715"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPL2"
FT                   /protein_id="BAC93115.1"
FT                   /translation="MFLDKRTFSTVIESTPLISIDLVIFDQNNQALLGERLNKPAQGKW
FT                   FVPGGRILKNESLTEAFERLTKEELGEVFSLSKASLLGPYDHFYDDNVFGDGFSTHYVA
FT                   IAYVIRLSNPLNDLPHSIQHGKYQWFDIDSLLIDEKVHKHTKWYFEALQNTQGQLI"
FT   CDS_pept        360085..361494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0352"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93116"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93116"
FT                   /db_xref="GOA:Q7MPL1"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPL1"
FT                   /protein_id="BAC93116.1"
FT                   /translation="MILPIIMAGGSGTRLWPLSRDNYPKQFLKLHGENTMLQETILRLN
FT                   GLEHSPAMLICNEEHRFIAAEQVRQIGVAHSGIFLEPVGRNTAPAIALAAFKAVENNQD
FT                   ALLLVLAADHVIENQAAFQESVNNAKLLAEQGKLVTFGIVGNTPETAYGYIKRGKEVEH
FT                   GFVVDSFVEKPDLQTAQEYIASGNYFWNSGMFLFKASRYLEELKAYRPDIYEACEKAVQ
FT                   VQNNDIDFVRVDKDAFEACPDESVDYAVMEHTQDAVVVPMNANWNDVGGFAALWEVSDQ
FT                   DENGNAFVGDVKSVDTKNTLVFAKDKLVTTVGVEDLVIVNTKDAVLVAHKDESQKVKEI
FT                   VSQLKADERSEVTFHREVYRPWGKYDSVDNGERFQVKRITVKPGAKLSVQMHHHRAEHW
FT                   IVVSGTAKVQIDDTEQFVTENESVYIPITAVHALENPGKVDLELIEVQSGSYLGEDDIV
FT                   RFEDRYGRVKD"
FT   CDS_pept        361498..362907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0353"
FT                   /product="phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93117"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93117"
FT                   /db_xref="GOA:Q7MPL0"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPL0"
FT                   /protein_id="BAC93117.1"
FT                   /translation="MNTKAVIQTSGIAFGTSGARGLVVDFTPEVCAAFSIAFAQSIKSE
FT                   FVFNTMAIAIDNRPSSFDIAKACAAGLKQLNIDVVYYGVVPTPALAYKAMQDNMPCIMV
FT                   TGSHIPFDRNGLKFYRPDGEITKQDEQAILSADFDFADLNLVDISLPTSAKAKDAYIAR
FT                   YTNLFNEESLSGKRVGIYEHSSAGRDIYKSLFEQLGAEVICLGRSDEFIPIDTEAVSDE
FT                   DKLRAKKWVSEYHLDMLFSTDGDGDRPLVAGEDGEWLRGDILGLLCSQALSVGALATPI
FT                   SCNTAIELSGSFKTVTRTKIGSPYVIEAFAELNKTYKRVAGFEANGGYLLASDFEFDGK
FT                   VLKALPTRDAVLPALIVATMGDSIASLLAALPQRFTASDRLKDFATEKGKALIAGLNAN
FT                   PNAILKSLGLGEARSVSKIDGLRLTAENGDIVHLRTSGNAPELRCYVESGCLESLEVLL
FT                   KSVLKNIEEMQ"
FT   CDS_pept        362904..364055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0354"
FT                   /product="putitive LPS biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93118"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93118"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPK9"
FT                   /protein_id="BAC93118.1"
FT                   /translation="MIIMTKNRENQICTNCVMDTTDSKITFDSKGVCDHCNDFYENVQP
FT                   NWHTDEKGHLELERIITKIKKDGEGRDFDCIMGMSGGADSSYLLHVAVKKYGLRPLVFH
FT                   VDGGWNSQIAVNNINVMIEKLGLDLYTEVINWEEMKAFQKAYFKAGVSNIDIPQDHAFI
FT                   ATLYNFAAKHKIKYILNGGNISTECVRNPLEWIYYGTDMAQIKDIRKRFCDNSLKTYPF
FT                   SNVLKHKLYLRYIQRIQVVKPLNYFPYIKEEAMKELEREYGWVPYPQKHFESRFTRFYE
FT                   GYWLPRKFGYDTRKVQYSSLILTGQMTREEAIEKLKFPAITDEDGKHDLEYIANKLDIP
FT                   VSELQSYFEQPNKTYKDYNNQESMFEFGAKVLRWLGVERSIKR"
FT   CDS_pept        364052..364672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0355"
FT                   /product="glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93119"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93119"
FT                   /db_xref="GOA:Q7MPK8"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPK8"
FT                   /protein_id="BAC93119.1"
FT                   /translation="MITIVDYGLGNIKAFANLYKKLNIELVFASDVNDLANATKIILPG
FT                   VGAFDHAMQMLNDSGMRETLDELVLEKKVPVIGICVGMQMMADSSEEGQLKGLGWIPGT
FT                   VKKFKRESQALESQYPLPHMGWNSLEIARTSELLLGLDEQKLFYFLHSYYYEPNDKEHV
FT                   VATANYGFEYACIVNKDNVYGIQCHPEKSHHNGVALLKSFASL"
FT   CDS_pept        364659..365441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0356"
FT                   /product="imidazoleglycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93120"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93120"
FT                   /db_xref="GOA:Q7MPK7"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPK7"
FT                   /protein_id="BAC93120.1"
FT                   /translation="MRVYRMLRSRVIPVLLMREKGLVKTVKFKEGKYVGDPLNAVKIFN
FT                   EQEADELTLLDIDASRLGHEPDYVLIERIASECRMPLCYGGGIKTVEQAERILKLGVEK
FT                   VSLSSAVFENPKIITQLAERVGRQSIVVCLDVKKRLFGSKFDCFTINGTKKQSVDTIEF
FT                   VKQIQTLGAGEIVLNFIDNDGVMKGYDLDAVSKFKALVKVPLTVVGGAGCVDDIAKLVQ
FT                   QEKLVGAAAGSLFVFKGKYKAVLINYPSPSEKKKALEL"
FT   CDS_pept        365485..367626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0357"
FT                   /product="putatve zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93121"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93121"
FT                   /db_xref="GOA:Q7MPK6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPK6"
FT                   /protein_id="BAC93121.1"
FT                   /translation="MKQILQDMAKGTSNLVEAPAPTTSKGNLLINTSISLISAGTERML
FT                   VDFGKASLLDKARQQPDKVKMILEKVQTDGLMTTLEAVQSKLAQPLPLGYCNVGVVNAV
FT                   GRGVNGFKEGDRVVSNGPHADVVRVPKNLCALIPDNVSDEEASFTVVASIGLQGIRLAV
FT                   PTLGEAFVVTGVGLIGLLTVQLLRAQGCRVLAIDYDDAKLELAKQFGAQVCNPGKGEDP
FT                   VAAGMAFSRGNGVDGVIITASTKSNDPVTQAARMSRKRGRIILVGVTGLELNRADFYEK
FT                   ELTFQVSCSYGPGRYDADYEDKGNDYPYAFVRWTEQRNFEAILDMMSSGQVDVKPLITH
FT                   RFKFEDAAQAYDLLTSDKSALGILLQYQSEPSTRHQKSVTLNSKATFEVSKPVVGFVGA
FT                   GNYASRMLIPAFKAGGAQLHTIATSGGINGVTHGEKAGFAKTTTDTSAMISDPEINTVA
FT                   IVTRHNSHARFVCEALNAGKNVFVEKPLAVTLEELAEVEATYYSKASNASEPKLMVGFN
FT                   RRFSPQVQKMKALLSSVKEPKSFMMTMNAGAIPADHWTQDNEVGGGRIIGEACHFIDLM
FT                   RYLADSEIVSVQCRRMGDVSGVDITEDKAAIILGFVDGSFGTIHYLANGAANFPKERVE
FT                   VFAAGRVLQLDNFRKLKGFGWPGFSKMNLWKQDKGQTNCAAAFLSAIESGKESPIPARE
FT                   LFEVARVTIEIADQLRKQQ"
FT   CDS_pept        367623..369434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93122"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93122"
FT                   /db_xref="GOA:Q7MPK5"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPK5"
FT                   /protein_id="BAC93122.1"
FT                   /translation="MSLKLKAQTAIDLGLLNLARVAGYQLGVRSGLNPVKRLSQAPVSG
FT                   LLFRPLSTLVQCESSQRYQFSPFGWKPKRFVSELRWAESTLTGQIYSNMEKPWFSLSDF
FT                   DSNVGDIKGIWEASRFDWVLGLAKDYLSGREQALDELNATAKDWLEHNPPYLGPNWKCG
FT                   QEASIRVMHLAMTAKLLNQVERSEPALLAFVKAHLKRIAPTISYAVAQDNNHGTSEAAA
FT                   LFIGGSWLVSNGNKSAVRWQKMGRKWLENRVKHLIDDDGTFSQYSVNYHRVMLDTYSMA
FT                   ELWRRELNLKSFSPSLYTRIGLATHWLYQLTQEDNGDAPNLGHNDGARLLPLSDTDYRD
FT                   FRPTVQLASILFLQSSAWEKAGSYDEPLKLLGLSKPKQALNKPSSFHFAQGGYAGLRSQ
FT                   TGAFVLFNYPIFRFRPAQNDALHVDFWLDGVNLLRDGGTFSYNAGQAYIDYYGGTQSHN
FT                   TVQFDEHEQMPRLSRFLLGAWLKAENVHWDEARQYCSASYRDYFGCGHKRYVSLSNSTL
FT                   RVVDDIHGVQKKAILRWRLNPGKWIIEGNRVTNHTHSITISSNTDIKRLELVEGKESRY
FT                   YYQETSIPVLEIEVTSDGQITTEYNYS"
FT   CDS_pept        369052..369174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0359"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93123"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93123"
FT                   /db_xref="GOA:Q7MPK4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPK4"
FT                   /protein_id="BAC93123.1"
FT                   /translation="MPGLRLKMCIGMKLDNIVVLVTATILGAVIKDMSLFQTVR"
FT   CDS_pept        369434..370693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0360"
FT                   /product="predicted glycosyltransferase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93124"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93124"
FT                   /db_xref="GOA:Q7MPK3"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPK3"
FT                   /protein_id="BAC93124.1"
FT                   /translation="MNILYFHQHFSTPKGSTGIRSYEMARRLIHHGHNVTMVCGTYGGG
FT                   ETGLDSAFVSGKREGIVDGIRIIEFDLAYSNSDGFIKRSMTFVKFALKSIGLAFTEKYD
FT                   VLFATTTPLTAGIPGIFARWLRGKPFVFEVRDLWPELPKEMGVIKNPVILGLMSFLEWA
FT                   SYRSAHRCIGLSPGIVEGIKKRGVDESKIAMVPNGCDLSIFSQPSEPWRPEGVKETDLM
FT                   AIFTGTHGMANGLDAVLNAALELQKRGRKDIKLVLVGQGKLKPDLERRAVELELNNVVF
FT                   HPPVNKQKLSGLMASADVGMQVLANIPAFYYGTSPNKFFDYISSGLPVINNYPGWLAGM
FT                   IEQTRCGFAIQPDDPSAFADALEKAENQREALTLMGYNARQLAESQFDRSLLADRWVDW
FT                   VTGVNAAKMTSSGENDEKAN"
FT   CDS_pept        370674..371291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0361"
FT                   /product="putative UDP-galactose phosphate transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93125"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93125"
FT                   /db_xref="GOA:Q7MPK2"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPK2"
FT                   /protein_id="BAC93125.1"
FT                   /translation="MMKRLIDFLVSLTALIMLSPVIALVAWKIRKNLGSPVLFRQTRPG
FT                   LNGKSFEMVKFRTMKDAVDEQGNPLPDSERMTSFGDKLRNSSLDELPELWNVLKGEMSL
FT                   VGPRPLLMQYLPLYSTEQARRHEVRPGVTGWAQINGRNAISWEEKFKLDVWYVDNRSFW
FT                   LDFKILLLTVKKVFVKEGISADGHVTIAPFTGQAQSGNSNEH"
FT   CDS_pept        371227..371955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0362"
FT                   /product="putative acetyltransferase"
FT                   /note="isoleucine patch superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93126"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93126"
FT                   /db_xref="GOA:Q7MPK1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPK1"
FT                   /protein_id="BAC93126.1"
FT                   /translation="MAMSPSPRLLGKRSQVTLMNTEYPSACSLGACAILGASGHGKVVA
FT                   EIAELNGYSEIHFYDDRWPELHNIEHWNVVGDSEALLASVQQYACVAVAIGNNAIRLNK
FT                   HKQLLEVGARMPSLVHPRAVISGYATIAEGCVVMANAVVNPFAVLGQTCIVNTGAVVEH
FT                   DCLLADGVHLSPNSAIAGSTQLGECAWLGIGAVTRQLVSVGAGATIGAGATVIGNVAAN
FT                   TVVMGTPAKIQITRDLGARS"
FT   CDS_pept        372109..373284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0363"
FT                   /product="pilin glycosylation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93127"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93127"
FT                   /db_xref="GOA:Q7MPK0"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPK0"
FT                   /protein_id="BAC93127.1"
FT                   /translation="MLNTPFSPWPSFTQEEADAVSRVLLSNKVNYWTGTECREFEKEFA
FT                   AWAGCEYAIALGNGTLALDLALKALGVGGGDEVITTSRTFLASASAIVTAGANPVFADV
FT                   DLNSQNITAETIDAVVTEKTKAVIVVHLAGMPAEMDAIMALAAERGFYVIEDCAQAHGA
FT                   KYKGRSVGSIGHIGAWSFCQDKIMTTGGEGGMVTTNDQALWSAMWSYKDHGKSYDAVYN
FT                   RQHPPGFRWLHESFGTNWRMTELQGILGRIQLQRMAEWTSKRQHNGKLIDQAVADLPVV
FT                   RRVEVADYIEHAEYKHYLFVNPEQLKQGWTRDRIVETINAAGVPAYQGSCSEIYLEKAF
FT                   DNTPWRPEERLKNAVTLGETSLMFLVHPTLTPAEMEKTTAVVRNVLLSASL"
FT   CDS_pept        373400..375352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0364"
FT                   /product="predicted nucleoside-diphosphate sugar epimerase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93128"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93128"
FT                   /db_xref="GOA:Q7MPJ9"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPJ9"
FT                   /protein_id="BAC93128.1"
FT                   /translation="MDKLAYIWSLPRVHKRLISLAIDTLLITFSFFMAIWVRHGEVVVS
FT                   VSSETLLTLAGTVIVTLVIFTKLGLYRAVLRYLTFHALTVVVLGALISALSITTFAYFF
FT                   NAEVPRTVPVIYMTFLALLCGGARMMVRSLIVQASRKGCERVLIYGAGSTGRQLAIALR
FT                   NAETYQVKGFIDNDPSLENTIIQGLTVHSSQQISRLVEKKEIEKILLAMPRATRSERKA
FT                   IIDGLLHLPVEVLTVPDFKDIVNGNATVDELKDVAIEDLLGRDPVEPNPELMKANIHGK
FT                   VVMVTGAGGSIGSELCRQIVRQKPKTLILFELSEYGLYEIDKELSGMVEAMQLEVEIIP
FT                   LLGSVQRINRLSATMRAFGVQTVYHAAAYKHVPLVEYNVVEGVRNNVFGTYYSAKAAIE
FT                   AGVESFVLISTDKAVRPTNVMGTSKRMAELALQALAAKENDKVNGTRFCMVRFGNVLGS
FT                   SGSVIPLFKRQIEEGQAITVTHPDIIRYFMTIPEAAQLVIQAGAMGKGGDVFVLDMGEP
FT                   VKIVDLAKNLIQLSGLEVKSSDNPNGDIEIKFTGLRPGEKLYEELLIGDNVEGTDHERI
FT                   MTANEQFLPLEEFNQILDNLDRACHEFDHETIRQILLETPTGFNPTDGIGDLVWNAKRK
FT                   LNASKDKVVEIKVTA"
FT   CDS_pept        375513..376694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0365"
FT                   /product="predicted UDP-glucose 6-dehydrogenase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93129"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93129"
FT                   /db_xref="GOA:Q7MPJ8"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPJ8"
FT                   /protein_id="BAC93129.1"
FT                   /translation="MTGNVMRITVVGAGYVGLANAALLAQYHSITLLDVDSKRVEQINA
FT                   QSSPIVDADIERFLSSGALQLTATTSPQIAYHDAQLIIVATPTNYDPITNGFDTASVEQ
FT                   VIKDAIQISPNATILIRSTVPVGFTERMRAQAKRCNILFAPEFLREGKALYDNLFPSRI
FT                   VIGEQSERGQKIAELFANAAEKRDVPILLTNPTEAEAIKLFSNTYLAMRIAYFNELDSY
FT                   AEAHGLDARQIIQGVGLDPRIGNHYNNPSFGYGGYCLPKDTKQLLANYQDVPNNIIGAI
FT                   VDANRTRKDFVAESILKRNPKVVGIYRLIMKAGSDNFRASSIQGIMKRIKAKDIEVVVY
FT                   EPVLKEAEFFHSRVIKDLNEFKQTADVIVSNRMVEELVDVADKVYTRDLFGSD"
FT   CDS_pept        376820..377650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0366"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93130"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93130"
FT                   /db_xref="GOA:Q7MPJ7"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPJ7"
FT                   /protein_id="BAC93130.1"
FT                   /translation="MLNMIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEE
FT                   AIEAGMNGMCIVTGRGKHALMDHFDKNYELEHQISGTSKEALLGDIRQLIDSASYTFIR
FT                   QREMKGLGHAILTGKELVGDEPFAVVLADDLCVNQDEGVLAQMVALFNQFRCSIVAVQE
FT                   VPEDETHKYGVISGEMIKDGICRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFELIEQT
FT                   EPGKGGEIQITDALLKQAKSGCVLAYKFKGQRFDCGSVEGYIEATNYCFENLYK"
FT   CDS_pept        complement(377709..377918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0367"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93131"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93131"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPJ6"
FT                   /protein_id="BAC93131.1"
FT                   /translation="MHTGIYSPDATFENALTALDNIEQSNINTGNEAVIPSHTTCCTMG
FT                   PRVREDDEIGEGKKKQTETAASAI"
FT   CDS_pept        377965..378087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0368"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93132"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93132"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPJ5"
FT                   /protein_id="BAC93132.1"
FT                   /translation="MRVALLMLRISEHSEQPFRYDPNTYFGLIRTHIPRLSEHF"
FT   CDS_pept        378217..379749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0369"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93133"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93133"
FT                   /db_xref="GOA:Q7MPJ4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPJ4"
FT                   /protein_id="BAC93133.1"
FT                   /translation="MAKKRTPMNKIKEVLRLKYECGLSYRSIASCLNVSLATVSELVAR
FT                   FKQSQIGWPIPEGCSDTDLTKALYHSKQASRDKVMPDFAQYAVELKRKGMTKMLLWQEY
FT                   HEQYQEQAYAYTQFCEHFTRWFKTQKRSMRQLHVAGDKLFIDYCGPRLQVVNPDTGEVR
FT                   EAEVFVATLGASNYTYVEAFPSQGKSYWLEAHANALEHFGGVPRLLVPDNLRSAVSKAN
FT                   RYEPRLNESYQKLANHYQTAVMPARPYKPKDKAKAENAVLLVERWIMMRLRHQTFHTFK
FT                   ELNLAIRELMNDLNEREMKHYGASRKALFDKLDKPALKPLPKQRYLYTETKRAKVGPDY
FT                   HIEYRRHYYSVPHQLVGHHVELEASNRLVQIYHQGNLVAQHPRSQRERGNSTQPEHMPS
FT                   NHQHQKWSPGRLLNWGANIGPATREVVNKMLNSKPHPEQSYRSCLGLLNLSKAHGESRL
FT                   EQACKDALMLTKPNYTFVNNLLKNNREGQLGKDKANTPNLVHSNVRGPNCYH"
FT   CDS_pept        379667..380500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0370"
FT                   /product="putative transposase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93134"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93134"
FT                   /db_xref="GOA:Q7MPJ3"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPJ3"
FT                   /protein_id="BAC93134.1"
FT                   /translation="MRGNWVKIKRIRRTLFTAMFVARTVITRRKDMNALNDQLKTLRLS
FT                   HAAKALEQQQEQLTTYAELDFEERLSLLLESEILNRNQSKIQRLKRQAKLRVDAQPSQL
FT                   IYKEGRNLNRKQMSELLTGSYLHKHQNILITGPTGAGKTYLGCALATSACDQQQTVRYY
FT                   RLTRLLDDLTAGRLDGSYQKQLQSLAKKGLLLLDDWGMEKLTQEHAGHLLEVLEDRYQN
FT                   SSTIVISQLPVKEWYNMIGNATVADALMDRLVHNSHRIELGGESMRKLAQSEHLE"
FT   CDS_pept        381021..381320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0371"
FT                   /product="predicted endonuclease"
FT                   /note="containing a URI domain"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93135"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93135"
FT                   /db_xref="GOA:Q7MPJ2"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPJ2"
FT                   /protein_id="BAC93135.1"
FT                   /translation="MSLPCVYILASQPYGTLYIGVTGDLIKRIWQHKNGESDCFTKKYR
FT                   VVHLVYFEQFEAMSDAILREKQLKKWNRQWKIQLIESANPHWLDLYKNLRTTIR"
FT   CDS_pept        381384..382724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93136"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93136"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPJ1"
FT                   /protein_id="BAC93136.1"
FT                   /translation="MQVIHHGGKDTVTGSCHEFRAAGIALLIDCGLFQGKDARPPEVDF
FT                   PVKHIDALVLTHAHIDHIGRIPWLLAAGFSGSIYCTEATAELVPLMLEDGLRLQLGLNQ
FT                   KQLHQVLDLVKKRLKPVKYGEWLRLTPRIKNGNRASRFVSHALENYLYLRFNPAGHILG
FT                   SAYLEFKLPNDEVVVFSGDLGPRNTPLLPDPISPPRADYLYIESTYGDKLHESVEERGE
FT                   RLKSIINRSLQDGGTILIPAFSVGRTQELLFDIEQLIFEHNIGTDIPIILDSPLDKRVT
FT                   QSYRRFKKLWGREARRRLEVHRHPLAFKQCITIDDYRQHKALVNRLASTGEPAIVVAAS
FT                   GMCQGGRIMDYLQALLPDERTDVLFAGYQANGTLGREIQSGEKTVQIEQKMVEVRAQIH
FT                   TMSGYSAHADQADLLAFIQGIAQKPKEIHWIHGEDDAKQSLLRAMQF"
FT   repeat_region   382775..382802
FT                   /gene="rpt1T10"
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="TAGTCCC"
FT                   /note="4 units of 7 bp in-tandem repeat"
FT   CDS_pept        383181..383375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0373"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93137"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93137"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPJ0"
FT                   /protein_id="BAC93137.1"
FT                   /translation="MSLLLLSVVASAFPNAAPGACGQMVSRVHGNDGWWCGGNVLSVYL
FT                   REALLMCLASSFDIPTSSL"
FT   CDS_pept        384040..384351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0374"
FT                   /product="ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93138"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93138"
FT                   /db_xref="GOA:Q7MPI9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPI9"
FT                   /protein_id="BAC93138.1"
FT                   /translation="MQNQRIRIRLKAFDYKLIDASTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKKARDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISLG"
FT   CDS_pept        384366..384995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0375"
FT                   /product="ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93139"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93139"
FT                   /db_xref="GOA:Q7MPI8"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPI8"
FT                   /protein_id="BAC93139.1"
FT                   /translation="MIGLIGRKVGMTRVFTEEGVSIPVTVVEVEANRIAQVKTLETDGY
FT                   AAIQVTAGTKKANRVNKAEAGHFAKAGVEAGRGLWEFRLENGEEFAVGSELTVELFNEV
FT                   KKVDVTGTSKGKGFQGTVKRWNFRTQDMTHGNSLSHRAPGSIGQCQTPGRVFKGKKMAG
FT                   HMGAERVTTQNLEIVRVDAERNLLLIKGAVPGATGGNVIVKPAVKA"
FT   CDS_pept        385012..385614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0376"
FT                   /product="ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93140"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93140"
FT                   /db_xref="GOA:Q7MPI7"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPI7"
FT                   /protein_id="BAC93140.1"
FT                   /translation="MELMVKGAAALTVSEATFGREFNEALVHQVVVAYAAGARQGTRAQ
FT                   KTRSEVSGGGAKPWRQKGTGRARAGTIRSPLWRTGGVTFAAKPQDHSQKVNKKMYRGAM
FT                   KSILSELVRQERLIVVDNFSVEAPKTKELVAKLKELELNDVLIVTGEVDENLFLAARNL
FT                   YKVDARDVAGIDPVSLIAFNKVLMTADAVKQVEEMLA"
FT   CDS_pept        385611..385913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0377"
FT                   /product="ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93141"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93141"
FT                   /db_xref="GOA:Q7MPI6"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPI6"
FT                   /protein_id="BAC93141.1"
FT                   /translation="MITQERLLKVLRAPHISEKATMAAEKANTIVFKVAKDATKKEIKA
FT                   AVEQLFEVEVKSVNTLITKGKTKRQGLRQGRRSDVKKAYVTLKEGQDLDFVGGAE"
FT   CDS_pept        385930..386754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0378"
FT                   /product="ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93142"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93142"
FT                   /db_xref="GOA:Q7MPI5"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPI5"
FT                   /protein_id="BAC93142.1"
FT                   /translation="MAIVKCKPTSAGRRHVVKVVNADLHKGKPYAPLLEKNSKNGGRNN
FT                   NGRITVRHIGGGHKQHYRVVDFKRTKDGIPAKVERLEYDPNRSANIALVLYADGERRYI
FT                   IAPKGMQAGDVIQSGVDAPIKAGNTLPMRNIPVGSTIHCVELTPGKGAQLARSAGAYAQ
FT                   LVARDGSYVTIRLRSGEMRKVLSEGRATIGEVGNSEHMLRELGKAGASRWRGVRPTVRG
FT                   VVMNPVDHPHGGGEGRTSGGRHPVSPWGVPTKGYKTRSNKRTDKYIVRRRNK"
FT   CDS_pept        386776..387054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0379"
FT                   /product="ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93143"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93143"
FT                   /db_xref="GOA:Q7MPI4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPI4"
FT                   /protein_id="BAC93143.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAVESGDKKPLKTWSRRSMIIPTMI
FT                   GLTIAVHNGRQHVPVFVTEEMIGHKLGEFAPTRTYRGHAADKKAKKR"
FT   CDS_pept        387065..387397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0380"
FT                   /product="ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93144"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93144"
FT                   /db_xref="GOA:Q7MPI3"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPI3"
FT                   /protein_id="BAC93144.1"
FT                   /translation="MEAIAKHNFARISPQKARLVADLIRGKSVDQALEILTFSNKKAAV
FT                   LVKKVLESAIANAEHNEGADIDDLNVAKIFVDEGPTMKRIMPRAKGRADRILKRSSHIT
FT                   VVVADR"
FT   CDS_pept        387416..388117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0381"
FT                   /product="ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93145"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93145"
FT                   /db_xref="GOA:Q7MPI2"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPI2"
FT                   /protein_id="BAC93145.1"
FT                   /translation="MGQKVHPNGIRLGIVKPWNATWFANTKDFADNLDGDFKVRQFLTK
FT                   ELSKASLSRIVIERPAKSIRVTIHTARPGVVIGKKGEDVEKLRTAVAKIAGVPAQINIA
FT                   EVRKPELDAQLVGDSIASQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIA
FT                   RSEWYREGRVPLHTLRADIDYATSSAHTTYGVIGIKVWIFKGEILGGMPAATEAAEPKA
FT                   DKPKKQRKGRK"
FT   CDS_pept        388129..388539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0382"
FT                   /product="ribosomal protein L16/L10E"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93146"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93146"
FT                   /db_xref="GOA:Q7MPI1"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPI1"
FT                   /protein_id="BAC93146.1"
FT                   /translation="MLQPKRTKFRKVHTGRNRGLAKGTEVSFGSFGLKAVGRGRLTARQ
FT                   IEAARRAMTRHIKRQGKIWIRVFPDKPITEKPLEVRQGKGKGNVEYWVAQIQPGKVMYE
FT                   VDGVPEELAREAFRLAARKLPFKTTFVTKQVM"
FT   CDS_pept        388536..388730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0383"
FT                   /product="ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93147"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93147"
FT                   /db_xref="GOA:Q7MPI0"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPI0"
FT                   /protein_id="BAC93147.1"
FT                   /translation="MMKAQDLREKSVEELNSELLNLLREQFNLRMQAATGQLQQTHTLK
FT                   AVRRDIARVKTVLTEKAGA"
FT   CDS_pept        388730..388984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0384"
FT                   /product="ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93148"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93148"
FT                   /db_xref="GOA:Q7MPH9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH9"
FT                   /protein_id="BAC93148.1"
FT                   /translation="MSDKIRTQLGRVVSDKMDKSIVVAIERMVKHPIYGKFVKRTTKVH
FT                   AHDENNECGIGDTVEIRECRPLSKTKSWTLVKVVEKAKI"
FT   CDS_pept        389147..389518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0385"
FT                   /product="ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93149"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93149"
FT                   /db_xref="GOA:Q7MPH8"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH8"
FT                   /protein_id="BAC93149.1"
FT                   /translation="MIQMQSMLDAADNSGARSVMCIKVLGGSHRRYAHIGDVIKVTVKE
FT                   AIPRGKVKKGDVLKAVVVRTRKGVRRPDGSVIRFDRNACVLLNNNTEQPIGTRIFGPVT
FT                   RELRGDKFMKIVSLAPEVL"
FT   CDS_pept        389532..389849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0386"
FT                   /product="ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93150"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93150"
FT                   /db_xref="GOA:Q7MPH7"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH7"
FT                   /protein_id="BAC93150.1"
FT                   /translation="MAAKIRRNDEVIVLAGKDKGKKGKVTKVLATGKVIVEGINLVKKH
FT                   QKPVPALGIQGGIVEQEAAIDVSNVAIFNAATGKADRIGFRFEDGQKVRFFKSNGETVS
FT                   N"
FT   CDS_pept        389876..390415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0387"
FT                   /product="ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93151"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93151"
FT                   /db_xref="GOA:Q7MPH6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH6"
FT                   /protein_id="BAC93151.1"
FT                   /translation="MAKLHDYYKSSVVAELTKQFGYTSVMQVPRIEKITLNMGVGDAIN
FT                   DKKLLENAAADMATISGQKPLITKARKSVAGFKIREGYPIGCKVTLRGERMWDFMERLI
FT                   SIALPRVRDFRGVNAKSFDGRGNYSMGVREQIIFPEIDFDKVDRVRGLDITITTSAGTD
FT                   EEGRALLAAFNFPFRK"
FT   CDS_pept        390433..390738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0388"
FT                   /product="ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93152"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93152"
FT                   /db_xref="GOA:Q7MPH5"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH5"
FT                   /protein_id="BAC93152.1"
FT                   /translation="MAKQSMKAREAKRAKLVAKFAEKRASLKAIISDVNVSEEDRWNAV
FT                   LKLQTLPRDSSASRQRNRCNQTGRPHGYLRKFGLSRIKVREACMKGEIPGLRKASW"
FT   CDS_pept        390769..391161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0389"
FT                   /product="ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93153"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93153"
FT                   /db_xref="GOA:Q7MPH4"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH4"
FT                   /protein_id="BAC93153.1"
FT                   /translation="MSMQDPISDMLTRIRNGQAANKVAVKMPSSKLKVAIAALLKAEGY
FT                   IVDFAVEGEAKPELEVTLKYFQAKPVIEQLKRVSRPGLRVYKKKDDLPSVMGGLGVAVV
FT                   STSKGLMSDRAARKAGLGGEIICYVA"
FT   CDS_pept        391174..391707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0390"
FT                   /product="ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93154"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93154"
FT                   /db_xref="GOA:Q7MPH3"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH3"
FT                   /protein_id="BAC93154.1"
FT                   /translation="MSRVAKAPVAIPAGVEVKLNGQEITVKGAKGELSRVINNAVVIAQ
FT                   EENKLTFGPREGVANAWAQAGTARALVNNMVVGVTEGFTRKLILKGVGYRAAIKGNAVG
FT                   LTLGFSHPVEHELPAGIKAECPSQTEIVLTGCDKQLIGQVAADIRAYRAPEPYKGKGIR
FT                   YADENVRSKEAKKK"
FT   CDS_pept        391717..392070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0391"
FT                   /product="ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93155"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93155"
FT                   /db_xref="GOA:Q7MPH2"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH2"
FT                   /protein_id="BAC93155.1"
FT                   /translation="MDKKASRIRRATRARRKIAELGATRLVVHRTPRHVYAQVIAANGS
FT                   EVIAAASTVEKAIREQVKYTGNIEAAKAVGKAVAERALEKGVSTVAFDRSGFQYHGRVA
FT                   ALADSAREAGLKF"
FT   CDS_pept        392085..392588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0392"
FT                   /product="ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93156"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93156"
FT                   /db_xref="GOA:Q7MPH1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH1"
FT                   /protein_id="BAC93156.1"
FT                   /translation="MAKEQQVQANDLQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNG
FT                   RVGFGYGKAREVPAAIQKAMEKARRNMVTIALNEGTLHHPVKGRHSGSKVYMQPAAEGT
FT                   GVIAGGAMRAVLEVAGVHNVLSKAYGSTNPINIVRATIDALVDVKSPEMVAAKRGLTVE
FT                   AISE"
FT   CDS_pept        392596..392772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0393"
FT                   /product="ribosomal protein L30/L7E"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93157"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93157"
FT                   /db_xref="GOA:Q7MPH0"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPH0"
FT                   /protein_id="BAC93157.1"
FT                   /translation="MATIKVTQTKSSIGRLPKHKATLRGLGLRRINHTVELEDTPCIRG
FT                   MINKVYYMVKVEE"
FT   CDS_pept        392779..393213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0394"
FT                   /product="ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93158"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93158"
FT                   /db_xref="GOA:Q7MPG9"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPG9"
FT                   /protein_id="BAC93158.1"
FT                   /translation="MRLNTLSPAAGSKHAPKRVGRGIGSGLGKTGGRGHKGQKSRSGGK
FT                   VRPGFEGGQMPLKQRLPKFGFTSRKSLVSAEVRVAELAKVTGDVVDLNSLKAANVITKN
FT                   IENVKIVLSGEINKAVTVKGLRVTKGAKAAIEAAGGKIEE"
FT   CDS_pept        393234..394568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0395"
FT                   /product="preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93159"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93159"
FT                   /db_xref="GOA:Q7MPG8"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPG8"
FT                   /protein_id="BAC93159.1"
FT                   /translation="MAKKPGQDFRSAQSGLSELKSRLLFVIGALLVFRAGSFVPIPGID
FT                   AAVLADLFEQQKGTIVEMFNMFSGGALERASILALGIMPYISASIVVQLLTVVHPALAE
FT                   LKKEGEAGRRKISQYTRYGTLVLATFQAIGIATGLPNMVDNLVVIDQTMFTLIATVSLV
FT                   TGTMFLMWLGEQITERGIGNGISLLIFAGIVAGLPSAIGQTIEQARQGELHVLLLLLIA
FT                   VLAFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFAAQSSHLPLKINMAGVIPAIFASSI
FT                   ILFPGTLAQWFGQNGESSAFGWLTDVSLALSPGQPLYVMLYAAAIIFFCFFYTALVFNP
FT                   RETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLAGALYITFICLIPEFMMVAWNVR
FT                   FYFGGTSLLIVVVVIMDFMAQVQTHMMSHQYESVLKKANLKGYGR"
FT   CDS_pept        394867..395223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0396"
FT                   /product="ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93160"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93160"
FT                   /db_xref="GOA:Q7MPG7"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPG7"
FT                   /protein_id="BAC93160.1"
FT                   /translation="MARIAGINIPDQKHAVIALTAIYGIGKTRSKAILADVGIAEDVKI
FT                   SELTEEQIDQLRDGVAKYTVEGDLRREVSMNIKRLMDLGCYRGLRHRRSLPLRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   CDS_pept        395242..395631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0397"
FT                   /product="ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93161"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93161"
FT                   /db_xref="GOA:Q7MPG6"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPG6"
FT                   /protein_id="BAC93161.1"
FT                   /translation="MAKQPTRARKRVRKQVADGVAHIHASFNNTIVTITDRQGNALAWA
FT                   TAGGSGFRGSRKSTPFAAQVAAERCAEMAKEYGLKNLEVMVKGPGPGRESTVRALNAAG
FT                   FRITNIVDATPIPHNGCRPPKKRRV"
FT   CDS_pept        395659..396279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0398"
FT                   /product="ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93162"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93162"
FT                   /db_xref="GOA:Q7MPG5"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPG5"
FT                   /protein_id="BAC93162.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIDNAPGVHGARR
FT                   GRLSEYGVQLREKQKVRRMYGVLEKQFRNYYAEAARLKGNTGENLLQLLEGRLDNVVYR
FT                   MGFGATRAEARQLVSHKAILVNGKVVNVPSFKVAANDVVSIREKAKQQTRIKAALEVAE
FT                   QREKPTWIEVDAGKMEGTFKRMPERSDLSADINEQLIVELYSK"
FT   CDS_pept        396303..397295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0399"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93163"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93163"
FT                   /db_xref="GOA:Q7MPG4"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPG4"
FT                   /protein_id="BAC93163.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQISSTHAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIEGVLHEYSTKEGVQEDILEILLNLKGLAVRVAEGKDEVFITLN
FT                   KSGSGPVVAGDITHDGDVEIANPEHVICHLTDDNAEIAMRIKVERGRGYVPASARIHTE
FT                   EDERPIGRLLVDATYSPVDKIAYAVEAARVEQRTDLDKLVIDMETNGTLEPEEAIRRAA
FT                   TILAEQLDAFVDLRDVRVPEEKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGD
FT                   LVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIAED"
FT   CDS_pept        397322..397705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0400"
FT                   /product="ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93164"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93164"
FT                   /db_xref="GOA:Q7MPG3"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPG3"
FT                   /protein_id="BAC93164.1"
FT                   /translation="MRHRKSGRQLNRNSSHRKAMFSNMASSLVRHEVIKTTLPKAKELR
FT                   RVVEPLITLAKTDSVANRRLAFARTRDNEVVAKLFNELGPRFAARQGGYTRILKAGFRA
FT                   GDKAPMAYIELVDRPAAEEAAAE"
FT   repeat_region   397957..398047
FT                   /gene="rpt1T11"
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="TTCTCGC"
FT                   /note="13 units of 7 bp in-tandem repeat"
FT   CDS_pept        complement(398053..398547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0401"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93165"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93165"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPG2"
FT                   /protein_id="BAC93165.1"
FT                   /translation="MYKKIAIAAFVSVALMGCQTTSKQTQTGTESGYSEIANAALMGAV
FT                   QTWSQKGAADSDLVSAIQNSTNVSSEQAIGGIGSLLALAQNSLSSNENNELSGLIPGFD
FT                   SLQSSGLTALISNNETVKSAFSALGLDPALISTFTPIILSALQNQGASSGLLDSLSSIW
FT                   K"
FT   CDS_pept        complement(398681..399310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0402"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase 1"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93166"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93166"
FT                   /db_xref="GOA:Q7MPG1"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPG1"
FT                   /protein_id="BAC93166.1"
FT                   /translation="MTFMSDIKFETVEEKASYGIGLQMGQQLAGSGLDGLNVAAIAAGI
FT                   ATSLTGDMPAVEVDEINKALHELYTRAESARAEAAKAAAADGEVFLKDNALRPEVTVLE
FT                   SGLQYEIITEGNGEIPTSDKTVRVHYHGELVDGTVFDSSVSRGQPAQFPVTGVIKGWVE
FT                   ALQLMPVGSKWKLYIPHDLAYGERGAGASIPPFAALVFEVELLDIV"
FT   CDS_pept        399501..400091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93167"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93167"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPG0"
FT                   /protein_id="BAC93167.1"
FT                   /translation="MQRVWRSTSMNRRRKKKAQVDYLALCKQRIAQFDYQRILSNVKQF
FT                   WATLPRLHQRALYVLVPVLFVLLLWPSSEPELKVSEPSTPQRIALDIDTTGLSQQRTEE
FT                   QNNLKSNSWKEYLVRDGDTLSQVFRNNQLSMSDLNALVRIEGDDKPLSQIKQGQLVRFK
FT                   LNDTGQLDILQLEKGTTSVMFFRLSDGGFGRSK"
FT   CDS_pept        400140..400265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0404"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93168"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93168"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPF9"
FT                   /protein_id="BAC93168.1"
FT                   /translation="MRLCELSFSSLMMESDVSVAWHVTTRGRAVAAAQSMKFLAK"
FT   CDS_pept        complement(400165..401037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93169"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93169"
FT                   /db_xref="GOA:Q7MPF8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPF8"
FT                   /protein_id="BAC93169.1"
FT                   /translation="MQAQQLAVVLLIVGNFLATLSDVAVKLIDGDISPFQYMFLRQVVS
FT                   LLLITPLWWVQSPEQRRLTQPAVTITRAHLILIGSGCMMVSITYLPLATANAVFYAAPL
FT                   LMLPLSIWLLKERPSAAKVLATSLGFVGVLIVLRPSQFHWAALFALGTATTLALFNILV
FT                   RKLPASQSVVTTLWWTTLFSIPVSALLALFHWQPMSAQLFLLVAISAVCILGYNGLAVA
FT                   AYRRAPAGQIALSEYSGLLFVTLIGVVGFNELPDGFTWLGISLIVLPLLPVREWLHARQ
FT                   RKHRSPSSS"
FT   CDS_pept        complement(400388..400510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0405"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93170"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93170"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPF7"
FT                   /protein_id="BAC93170.1"
FT                   /translation="MVDNPVLHSGICLARAISLATHECSTVSVGRNKRSVHPWL"
FT   CDS_pept        complement(401038..401490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0407"
FT                   /product="elaA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93171"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93171"
FT                   /db_xref="GOA:Q7MPF6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPF6"
FT                   /protein_id="BAC93171.1"
FT                   /translation="MIQWQLLPFAQLSNTQLYQLLKLRVDVFVVEQNCPYPELDGHDTK
FT                   PGVYHLLGYQGEELVACSRLLPAGTTYPHASIGRVATLASARGNGLGHQLLNRALQCCD
FT                   ELWPNTIIDIGAQQHLEAFYQHHGFRTVSDMYLEDGIPHIDMRKGN"
FT   CDS_pept        complement(401590..402153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0408"
FT                   /product="cAMP-binding protein"
FT                   /note="catabolite gene activator and regulatory subunit of
FT                   cAMP-dependent protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93172"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93172"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M7K6"
FT                   /protein_id="BAC93172.1"
FT                   /translation="MDTRFTQQLQQLNLSADDIALVLSHAKELQLPTRHILHHQGEYPQ
FT                   QFYFLLDGLCHACYLTEEGKEFSKEFYWEVDWMIGFESAILQQASPFLLETLTPVHLLT
FT                   FPIELLQHWRSTHHPLYTHLLETQLVYKERKERFLLLHTPEQKYHLFKTSFPTLLERLS
FT                   DRQIAAYLGITPVSLSRIKNRSTV"
FT   CDS_pept        complement(402226..404199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0409"
FT                   /product="2`,3`-cyclic-nucleotide 2`-phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93173"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93173"
FT                   /db_xref="GOA:Q7MPF5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006294"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041827"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPF5"
FT                   /protein_id="BAC93173.1"
FT                   /translation="MEQTMKVAVKPLSLAVLSSMLVMAGPAMAETIKLRIIETTDIHTN
FT                   VMDYDYYKDKPSQQIGLTRAATLVKQARGEVVNSVLVDNGDLIQGSPMGDYMAAKGIKA
FT                   GEVHPVYKAMNQLSYDVGNIGNHEFNYGLEFLAETINDADFPYVSANVFDKKTGKHYFK
FT                   PYIIKDHTFKDVNGEEHTIKVGYIGFVPPQIMVWDKKNLEGKVFAKDIKATAEELVPQM
FT                   KKEGADVIVAIPHSGVSSDPYKIGAENSVYYLSEVDGIDAIAFGHSHAVFPGKGFDNIQ
FT                   GVDNQAGTINGVAAVMPGRWGSHVGIIDLELQQKQGKWTVVKGQTEARPIFDKATKKPL
FT                   VDADAAMVKALEADHKGTREFVNQPIGKANDVMYSFLALVQDDPTVQIVNLAQKDYVER
FT                   FIQGDPDLAGLPVLSAAAPFKAGGRKNDPANFTEVESGQLTFRNAADLYLYPNTLVAMK
FT                   VTGHEVKEWLECSAGQFKQIDVSSTAPQSLIDWDGFRTYNFDVIDGVNYQIDVTKPAKY
FT                   DGDCKVINADSERVIGLTYQGKPIDVKQTFIIATNNYRAYSNKFPGTGSEFVAFDSPDE
FT                   NRTVVANYISRVSQEKGEVTPSADNNWTFAPIKSDKALDIRFETSPSDKAAQFIKEKGI
FT                   YPMKQIATDDVGFAVYQLDLQK"
FT   CDS_pept        404460..405335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0410"
FT                   /product="uroporphyrinogen-III methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93174"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93174"
FT                   /db_xref="GOA:Q7MPF4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPF4"
FT                   /protein_id="BAC93174.1"
FT                   /translation="MSMADKDTATVFPFKRPSVVASNPTAGRYGHSQLKHGEVALVGAG
FT                   PGDPELLTLKALNYLQQAEVVLYDYLVSDEIMALVPNDAILVCVGKRAGHHSVPQEKTN
FT                   QLLVDFAKQGYKVVRIKGGDPFVFGRGGEELEVLADAGITFQVVPGITAAAGATAYAGI
FT                   PLTHRDYAQSAMFITGHLKAESDQLDWSTLARGQQTLVIYMGLMKSNYIQEQLIKHGRR
FT                   AQTPIAIIERGTQLSQKVFKGQLSELADLAKKAEAPALIVIGEVVQLSQKLDWFLSGTR
FT                   INNSAIANSI"
FT   CDS_pept        405393..406301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0411"
FT                   /product="sulfate adenylate transferase, subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93175"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93175"
FT                   /db_xref="GOA:Q7MPF3"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPF3"
FT                   /protein_id="BAC93175.1"
FT                   /translation="MDQQRLTHLKQLEAESIHIIREVAAEFDNPVMMYSIGKDSSVMLH
FT                   LARKAFYPGKIPFPLLHVDTDWKFREMIEFRDRTAEKYGFELLVHKNPEGLAMGCSPFT
FT                   HGSSKHTDIMKTQGLKQALNKYGFDAAFGGARRDEEKSRAKERVYSFRDKNHTWDPKNQ
FT                   RPELWKTYNGQVNKGESIRVFPLSNWTELDIWQYIYLENIEIVPLYLAAKRPVVERDGM
FT                   LIMVDDDRMKLKEGEVIEEKSVRFRTLGCYPLTGAIESEANTLTGIIEEMLVATSSERQ
FT                   GRAIDHDQSGSMELKKRQGYF"
FT   CDS_pept        406319..407749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0412"
FT                   /product="sulfate adenylate transferase, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93176"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93176"
FT                   /db_xref="GOA:Q7MPF2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPF2"
FT                   /protein_id="BAC93176.1"
FT                   /translation="MNSAVQAQLAELGIEGYLNQHQHKSLLRFLTCGSVDDGKSTLIGR
FT                   LLHDSKQIYEDQLAAVHSDSQRVGTTGSRPDLALLVDGLQAEREQGITIDVAYRYFSTQ
FT                   KRKFIIADTPGHEQYTRNMATGASTCDLAVILIDARKGVLDQTRRHSFISNLLGLKHFV
FT                   VAVNKMDLVEFSQQRFEEIKAEYLAFSKNLRGETDIQIIPISALEGDNVVELSQQMAWY
FT                   QGPTLLEILEAVDVEKEKEAGEFRFPVQYVNRPNLDFRGFAGTISSGVVKVGDRITALP
FT                   SGKSSTVARIVTFDGDLEQAQAGLAVTLTLADEIDISRGDLIVHHGANVELTNHLAADV
FT                   VWMTEQPLQPGRDYDIKIAGKKTIGRVEHIHHQYDINNLSKHSAAELPLNGIGLCEWTF
FT                   NESIALDNYQDCADTGGFIIIDRLTNVTVGAGMVSESLTEVTKASSDFSAFELELNALI
FT                   RKHFPHWDAKDLSELLKK"
FT   CDS_pept        407846..409570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0413"
FT                   /product="putative sodium/sulfate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93177"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93177"
FT                   /db_xref="GOA:Q7MPF1"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPF1"
FT                   /protein_id="BAC93177.1"
FT                   /translation="MWEQGFVLALLLGIITCLLVTKIKPSYIFAGAAFAAFMAGMSDLT
FT                   AIAANFTNSSLLTLVLLILASTALEKTRLISWVSRSISEGRLLTVVAKLGFSTAFLSSF
FT                   TNNTAVVVSLIGAIKRNRQHAPSKLLIPLSYAAIFGGTLTLIGTSTNLIINSFVEDAGL
FT                   PSLSFFTPTLIGLAIVIGGVLVLIPLSYLLPDYDDQGQDELPYFLEAAVEPGSPLVGRS
FT                   ITENNLRALRKLFLAEVIRDGQTVPSVGPDFVLQAKDRLLFCGEVDSVSTLQEIPGLTL
FT                   FGQQHLNGQNFVEVVVSSSATFCNKTLKSSRFRDRFDAVVVAIRRGHERLEGGLGNITL
FT                   AAGDTLVVVPGKRFEAERQAHRKEFVLMNDLDSSARLDSHKSTLVLLGFMAVIAAALTG
FT                   LVPIIKGLAVYLLALVVFGIVQLNELRRRFPIDIVVIVGSALSIAQLMISSGFSERMGG
FT                   MFIEAFNGWGVFGALVATYFVTLILTELVTNNAAAALAFPLGYSMALGYGVDPMPFIMA
FT                   VLFGASASFISPYGYQTNLLVYSVGNYRLLDYLKIGVPISLVYSVLVLTLIPIFFPF"
FT   CDS_pept        409584..410207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0414"
FT                   /product="adenylylsulfate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93178"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93178"
FT                   /db_xref="GOA:Q7MPF0"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPF0"
FT                   /protein_id="BAC93178.1"
FT                   /translation="MSSVIAQKDENVVWHQHAVTKTQRADLKQQKPAVLWFTGLSGAGK
FT                   STVAGALENRLAEQGFHTYLLDGDNVRHGLCSDLGFSTQDRRENIRRIGELAKLMADAG
FT                   LIVLTAFISPHRAERQLVRDLLPEGEFIEVFVNTSLEVCEQRDPKGLYKKARAGEIANF
FT                   TGIDSEYEVPLNPEIDLPAGEKGIEALVDLLVEQLTLRGVISPR"
FT   CDS_pept        complement(410334..411236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93179"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93179"
FT                   /db_xref="InterPro:IPR021254"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPE9"
FT                   /protein_id="BAC93179.1"
FT                   /translation="MADSRPPVVIDVEPETKSSGYQEKKSSYIKDSASRIQTIAQTYGL
FT                   DALLQKDPPAKNALERAVFREEQRKEQRQKNLEQILKLAHVSCKDETAGEPDQDWLYRF
FT                   FDMAQEIHNSAMQKLWAQVLKREVTNPGSTSMKALKVLQDMTPKEAHTLQRAASLACSF
FT                   GGDASRKLLIGFRAQGGLFSFGKRDTTSNINIGSFQLPFSSLLVLIELGLLHGTELESG
FT                   EIEQQTPLMLTYQGKNLQLNATSKGVRLLYYRFTPTGNELCKLLGNKPNNSYYDQLVAL
FT                   LNQKFTVQSDAQSSIHHTV"
FT   CDS_pept        411423..411545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0416"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93180"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93180"
FT                   /db_xref="GOA:Q7MPE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPE8"
FT                   /protein_id="BAC93180.1"
FT                   /translation="MFCEGTMKYFGENKLKKHLSIALLLVAYLATLIYLSKFIA"
FT   CDS_pept        complement(411585..412082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93181"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93181"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPE7"
FT                   /protein_id="BAC93181.1"
FT                   /translation="MKRRLTLFLTLIFAAWLPVQAIAQQVTTLDWIDLVPEQERKMFDS
FT                   VGMPAADHSGTAAAQSKVGGVRPELNNKKVKIPGFVIPLEGDANKVTEFLLVPYFGACI
FT                   HVPPPPPNQIIYVKFPKGAPVQELWDVIYLVGTLKTETVSHELAETAYVIEGDAIEPYD
FT                   DM"
FT   CDS_pept        complement(412087..413346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0418"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93182"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93182"
FT                   /db_xref="GOA:Q7MPE6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPE6"
FT                   /protein_id="BAC93182.1"
FT                   /translation="MSATMTLAWKSLRNRKATAFLTVLTVAISVILLLGVEKIRTQAKE
FT                   SFANTISGTDLIVGGRSGQVNLLLYSVFRIGNATNNIDWKSYQDFANHRAVAWAIPISL
FT                   GDSHKGFRVMGTNHSYFEHFKYGSKQPLTFSQGKPFNGLFETVLGAEVAKQLGYQIGSE
FT                   IIIAHGISDVGFSRHDNLPFKVVGILAPTGTPVDKTVHVSLEAIEAIHVGWESGARLGP
FT                   SPDATQLEQKQFQPKQITAMMLGLKSRIQTFALQREINTYNQEPLSAIMPGVALHELWG
FT                   MMSVAEQALMAVSVFVVIAGLLGMLSSLLTSLQERRREMAILRAMGARPRHVFTLLISE
FT                   ASLLTLAGIVTGVAGVYGLLSIAQPIIQQQYGINITMTAISPHEWMLLAFVQTAGILIG
FT                   FIPAIRAYKQSLSDGMTIRI"
FT   CDS_pept        complement(413343..414047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0419"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93183"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93183"
FT                   /db_xref="GOA:Q7MPE5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPE5"
FT                   /protein_id="BAC93183.1"
FT                   /translation="MVNTSPAVIELQQVSFTWKEATQPILQIPHFSVARGEHVFIKGPS
FT                   GCGKSTLLSLLTGINQVQSGQLTILGTELAALSPSQRDKFRADNIGYIFQQFNLLPYLN
FT                   VLENVLLPCQFSRTRATHVEGDARAKAAQLLTRLHLPQSLHLKSVSELSIGQQQRVAAA
FT                   RALIGAPALVIADEPTSALDFDNRSAFIELLMEQANAANATLVFVSHDPTLERLFDRTV
FT                   DLRQLNQAGEAS"
FT   CDS_pept        complement(414114..414749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93184"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93184"
FT                   /db_xref="InterPro:IPR021253"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPE4"
FT                   /protein_id="BAC93184.1"
FT                   /translation="MLRKTSLAILVGLSFSALASAQEGFRQHDAHVHGQVEFNIAQDGH
FT                   DLLLEITAPGADVVGFEHAPENTEQENQLKAAVDKLSQADLMVQINEAAKCTIENVSVT
FT                   HTLGGEEHDDHEHHDDHKHHDDHEHHDDHEHHDDHEHHDDHGHEHDGHGAFTVEYQYHC
FT                   DNVAALNALETDWFKQFPATQAIQANVLTDKVQSALALSPAHSTVSLK"
FT   CDS_pept        414303..414431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0420"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93185"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93185"
FT                   /db_xref="GOA:Q7MPE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPE3"
FT                   /protein_id="BAC93185.1"
FT                   /translation="MLMSVVIMMFVVIMMFVVIMMFVVIMVFVVIMMLMVIVLFTA"
FT   CDS_pept        complement(414795..415088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93186"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93186"
FT                   /db_xref="InterPro:IPR019731"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPE2"
FT                   /protein_id="BAC93186.1"
FT                   /translation="MQHNLSLPFMTLRHTAIFAVVLSVFLSFASIAHDFDFNAEHHNSH
FT                   HCQLFANAHHGVNQAAISVPVLVPEYAQPQPVTAIAPYQPTSAYLARSPPFN"
FT   CDS_pept        414924..415124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0422"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93187"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93187"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPE1"
FT                   /protein_id="BAC93187.1"
FT                   /translation="MMGIGKQLAVMAVVVLGIKVKVMGNAGKAQKHAEYHRKDRSVAQS
FT                   HEREAKIVLHKPIETFESVTI"
FT   CDS_pept        complement(415226..415777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0424"
FT                   /product="predicted transcriptional regulator"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93188"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93188"
FT                   /db_xref="InterPro:IPR006513"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPE0"
FT                   /protein_id="BAC93188.1"
FT                   /translation="MKRKTLLTLALLSASFGAAAHNLSLGNPVPSVSVASYGEIVLQGK
FT                   GTAFQPWASSQMLGKVRVIQAIAGRSSSKEMNAPLMQAITAAQFSADHYQTTTIINQDD
FT                   AIWGTGSFVKSSAQDSKKEFPWSSMVLDENGVVASSWQLDKESSAIIVQDKQGKVLFVK
FT                   EGALSSDDITQVLELIKANI"
FT   CDS_pept        complement(415829..415957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0425"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93189"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93189"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPD9"
FT                   /protein_id="BAC93189.1"
FT                   /translation="MNEKSIPQSDGDLNSLTPFLLKKCYLQPDIFANSVLYSASTR"
FT   CDS_pept        416110..416319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93190"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93190"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPD8"
FT                   /protein_id="BAC93190.1"
FT                   /translation="MLREFAVYRPRQVARFVKTLFKGSFSINGIGEFEFDNGKVLLPDT
FT                   HNTQKLSVYREVNAEINALSLAAA"
FT   CDS_pept        complement(416424..417053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0427"
FT                   /product="Peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93191"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93191"
FT                   /db_xref="GOA:Q7MPD7"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPD7"
FT                   /protein_id="BAC93191.1"
FT                   /translation="MLNKQIMVDADNALAGRQEAMAVEPIHFVNGSDITAPATQGQQEI
FT                   LLGMGCFWGAERLFWQLDGVVSTSVGYSGGFTLNPTYQEVCSGQTGHTEVVRVIFDPQV
FT                   LPLEQLLEKFWERHDPTQGMRQGNDLGTQYRSAIYTFSDQQLDIALASQQAYQAALANQ
FT                   QHNTITTEIRPAGPYFYAETYHQQYLAKNPEGYCGLGGTGVCFPPA"
FT   CDS_pept        417285..419000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0428"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93192"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93192"
FT                   /db_xref="GOA:Q7MPD6"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPD6"
FT                   /protein_id="BAC93192.1"
FT                   /translation="MIKKVLPLLVSSLFASNLVAAPQVSLSLEGVSGAVEENIEAHLTS
FT                   IDEKDYSTSLRFQSRLDGIINGALNALGYYHAQIDYQISDDQEELTAHITLGEPVRVET
FT                   FDVRIEGEASNDKDFLQLLEKSPLKQGAILNHGDYDTLKSSIRNLALQKGYFKGDFIET
FT                   RLEVAADLNQAFVRLHYDSGMRYHFGQTTITGSQIEENRVRSLQPFKAGDPYLVAKVGE
FT                   YNQNLSNTDWFSSVFVEPDLSSLDDTRELPMKVSLAPQAKNQIETGIGYATDVEFRGTL
FT                   KWKKPWVNELGHSFDSSLSISKPEQTVTAGYQIPLEDVLHDYYRIQYAMKHVDSRDTKS
FT                   LESNLAVERHWLLDNRWHRTVFVRYLIENYEQGLQDDVAQFVLPGVSFSRSRVRGGSMP
FT                   SWGDKQSITFEYGDDNLLSETRVLRVQGRTTWIRSLGENHRGLARLEAGANLTEEFEKL
FT                   SPSLRFFAGGDNNLRGYGYESISPKDSSGALTGAQYIATSTLEYQYRLYGNWWAAAFVD
FT                   YGDAFNDAPDWKTGTGLGIRWASPVGPIRIDFAWGLDAKPGDEFRLHFTLGPEL"
FT   CDS_pept        418997..422752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93193"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93193"
FT                   /db_xref="GOA:Q7MPD5"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPD5"
FT                   /protein_id="BAC93193.1"
FT                   /translation="MIKVVFKWSKWISAGVMALLVLLLTLIALLLFTHPGLTSAIWVAE
FT                   KVVPQLQVGQVQGALFPKFTLRKVTFNDAELNIASSVDELTLAMNFQCLLEPKVCINEI
FT                   SIDGLALSLPQLPPSSESVEEPSEPLKSISTPVPVFLHRLALTNIQLDVLGNQISWGEL
FT                   SSALSMQGDRLVIAPTRFSDIDVTLAPSEPQAQSAAPNDAPRQDIELPEVWIPLQIVLQ
FT                   RFDVNRFTLHQETPLIVNHLALEAKAGKNRVDVETLELDMPQVSAQANAQVELKGEYPL
FT                   SLDLKAKLKETDLKGQNITLNASQSVAHLQLQSTLSGPVSAQLSATLEPLLVSLPFDVK
FT                   LSDLQTQWPLSGESDYQIKSTNLMTQGSLEGYQLALQSQLDGKEIPAITLDVHGSGDLQ
FT                   HIDLDKLNVETLGGELKGQVMANWQSLVNWQASLQLQNIQPGLQWPEAEGNISGKLATT
FT                   GSLTEKGGWKVALPELDIDGLLRGYPLNIEGSLHASDEEGNGEVYIDTERLTLSHGPNG
FT                   LTAKGQLKKEWQMDVDIHFTDLAKSVPDLSGSVVGDVDLRGALKEPDIQLALQAQNIQW
FT                   QQQASIEQLSLTGRVTPLPEPQADVTLKVAALRYQEQLIDSILLSVSGGEKQHQLSLDV
FT                   SSDLVSTSLAIHGGLQQKPQMVWSGELERMFATTQQGTWTLQQATAIKANIDQQQVDVA
FT                   AHCWQQQGSTLCLTKDIRVGEKGEAELALNQFDFAQIAMFLPPETKLDGSVDATVWAKW
FT                   APESSPQAKVSLHLPTGQVQQKIEQVVTLGWDDINLNAQLHQDQLNADWQINVSDNGDL
FT                   TGQLQVADVQASDPQLKAKLALSQFNLDFLAPLVGEYSALKALISTDLSVSGSVYHPQV
FT                   KGRFLVDDIQVNGDISPIDVKQGKLAIDFRGYDADLAANIVTPDGELNVSGEANWQQLD
FT                   NWHSKVRFFADSLKVDMPPMVKIKLVPDMTIEVNPTLAKVTGSLALPWGRIVVEELPPS
FT                   AVSVSKDQVLLNDQLEPIDKSSSMPFNVETDINISIGDDFKLAAFGLEGGLKGQLNVTQ
FT                   KDKGPFILGEVNIVDGTYRSFGQDLLIKEGKVLMNGPADQPYVAIKAIRNPENTQDDVI
FT                   AGVKVTGPATEPSITIFSEPAMPQANALSYLLRGQDIDGESGGGNAMTTALIGLSLAKS
FT                   GKVVGEIGQAFGVQDLQLDTAGSGEDSQVTVSGYIMPGLQVKYGVGIFKPLGEFTVRYR
FT                   LMKDLYLEGVSGVESAVDLLYQFEFD"
FT   CDS_pept        422789..423163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93194"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93194"
FT                   /db_xref="GOA:Q7MPD4"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPD4"
FT                   /protein_id="BAC93194.1"
FT                   /translation="MVSWRQGVVMQHLVFVYGTLRKGESNHHYLQHSEFLGGCQSGQEY
FT                   RLYDLGDYPAVGEGNRAVSGEVYLIDDATLQALDKLEDVPVEYRRETIATPFGQAWIYL
FT                   YQDSSKLVEEIASGDWCQRV"
FT   CDS_pept        423264..423623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0431"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93195"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93195"
FT                   /db_xref="InterPro:IPR021242"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPD3"
FT                   /protein_id="BAC93195.1"
FT                   /translation="MKALVLTFPLLLLVGCVQTPLPQSEQALDWHTFGVESALEGKMAL
FT                   SEARLLKLAEPRNLSANLLASYQAGYQEGKQQYCQQNAYMLGVIGKPYYGICDDVDPFF
FT                   KQDYISGQMSTAGGL"
FT   CDS_pept        complement(423713..424243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0432"
FT                   /product="inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93196"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93196"
FT                   /db_xref="GOA:Q7MPD2"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPD2"
FT                   /protein_id="BAC93196.1"
FT                   /translation="MSLNNVPAGKSLPDDLYVVIEIPANADPIKYEVDKESGAVFVDRF
FT                   MSAPMFYPCNYGYVNHTLSLDGDPVDVLVPTPYPLMPGSVIRCRPVGVLKMTDESGEDA
FT                   KVVAVPHSKLSKEYDHIQDVNDLPELLKAQITHFFERYKELESGKWVKVDGWEDVEAAR
FT                   KEILDSYQRAQNK"
FT   CDS_pept        complement(424230..424379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0433"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93197"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93197"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPD1"
FT                   /protein_id="BAC93197.1"
FT                   /translation="MKQSACNSRRFLLATLESPTHLVYSSACLRLNYHRSAQNKEKEIT
FT                   HEFK"
FT   CDS_pept        complement(424383..425399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0434"
FT                   /product="fructose-1;6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93198"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93198"
FT                   /db_xref="GOA:Q7MPD0"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPD0"
FT                   /protein_id="BAC93198.1"
FT                   /translation="MSGMRTLGEFIVEKQADFPHASGDLSSLLSSIRLAAKIVNREINK
FT                   AGLVDITGAAGVENIQGEVQQKLDVYANEKFKSALEARDQVCGVASEEEDEAVAFNKEL
FT                   NKNAKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRVSPIGTPPTQEDFLQPGHKQVAAGY
FT                   IIYGSSTMLVYTTGNGVNGFTYDPSLGTFCLSHENMMIPQNGNIYSINEGNYIRFPMGV
FT                   KKYIKYCQENVPEDGRPYTSRYIGSLVADFHRNLLKGGIYLYPSTQSHPQGKLRLLYEC
FT                   NPMAFLIEQAGGLASDGVNRILDLKPTELHQRVPFFVGSTNMVKKVEEFLEVYRDEA"
FT   CDS_pept        425648..427102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0435"
FT                   /product="UDP-N-acetylmuramate-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93199"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93199"
FT                   /db_xref="GOA:Q7MPC9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPC9"
FT                   /protein_id="BAC93199.1"
FT                   /translation="MWHKANNAARFSNGYHDNENEKKQSDGRIQFMHIHILGICGTFMG
FT                   GAAILARQLGHKVTGSDANVYPPMSTLLESQGIEIIEGFDPSQLNPAPDLVVIGNAMSR
FT                   GNPCVEYVLNHNLRYTSGPQWLQEFLLHDRWVLAVSGTHGKTTTSSMLAWILEDCGYQP
FT                   GFLVGGVLGNFGVSARLGESMFFVVEADEYDSAFFDKRSKFVHYHPRTLIMNNLEFDHA
FT                   DIFDDLEAIKRQFHHLVRTVPGNGRILAPKQDGALTDVLSRGCWSDQEFSGQDGEWQAV
FT                   KLSKDGSHFEVWLQGEQVGTVQWDLVGDHNVDNALMAIAAARHVGVTPDLACEALGRFI
FT                   NTKRRLELKGEINGVAVYDDFAHHPTAIELTLAGLRNKVGDKKIIAVLEPRSATMKRGV
FT                   HKETLAASLKQADEVFLYQPESIAWSVQDVAAQCQQPAFTSDNIDQFVANIAQRAEAGT
FT                   QILVMSNGGFEGIHGKLLTALENSTR"
FT   CDS_pept        427119..427763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0436"
FT                   /product="3-polyprenyl-4-hydroxybenzoate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93200"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93200"
FT                   /db_xref="GOA:Q7MPC8"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPC8"
FT                   /protein_id="BAC93200.1"
FT                   /translation="MSMRNQEKSITLAFTGASGAPYGLRLLQQLLAADYRVYLLISSAA
FT                   RVVLATEHGLKLPANPDAAQQALVAHLACDADKLVVCGKDDWFSPVASGSAAPKQMVVC
FT                   PCSAGSVAAIAHGMSDNLIERAADVVMKERGQLILVVRETPFSTLHLENMHKLSQLGVT
FT                   IMPAAPGFYHQPQSIDDLIDFMVARILEHLGIEQVLVPRWGYDHRNDGDSV"
FT   CDS_pept        427964..428992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0437"
FT                   /product="thiamine ABC transporter, periplasmic
FT                   thiamin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93201"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93201"
FT                   /db_xref="GOA:Q7MPC7"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPC7"
FT                   /protein_id="BAC93201.1"
FT                   /translation="MPNGERAVKHTLNLIALASITSMMGISSSALAADKTLTIYTYDSF
FT                   ASDWGPGPTVEKAFEAQCGCDVNFVALDDGVSILNRLRLEGSNTKADIVLGLDNNLMAE
FT                   AKATGLLAQHQVETTAITLPNGWADDTFIPYDYGYFAFVYNKGKLANPPKSLKELVESR
FT                   DDLKVIYQDPRTSTPGQGLMLWMKSVYGDDVTGAWQQLAKKTVTVTKGWSEAYSMFLKG
FT                   ESDMVLSYTTSPAYHLIAENDAQYAAAGFSEGHYMQVEVAAKVKSSQNSALADQFMSFI
FT                   LSDEFQSAMPTGNWMYPVTNVTLPEGYRSLTVPEKALSFSAEEVAKQRKAWIREWQSAL
FT                   TF"
FT   CDS_pept        429038..430609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0438"
FT                   /product="thiamine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93202"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93202"
FT                   /db_xref="GOA:Q7MPC6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPC6"
FT                   /protein_id="BAC93202.1"
FT                   /translation="MIIATFVVSALSALLLATPTLDLTAVWQDPYYRHVTQFSFLQATL
FT                   SMLLSVGLALPVAHALSRRHFVGRSLLLKLFASTLVLPVLVGVFGLLAIYGNSGWLASV
FT                   LASFDVKLPFSIYGLSGILLAHVFFNLPYAARLLLQTLESIPAEQHKLAAHLGMNSWQK
FT                   FRWVEWPRLRQQLPHVCGLVFMLCFTSFATVMALGGGPKSTTIELAIYQAIKFDFDLQA
FT                   GALLAIWQMLLCSLLVLALQRLTKPLPVSVGSHTRFVQLTPASKRHLMWDYAWIALATL
FT                   LVVPPLLFVVASGINSKLPDVISDGRFWSALGASLRVAFGAATLAVGAAIAILLTSRAW
FT                   RLRGLRYPADGIEMVGTIILVTPGLVVSTGLFLLLRSFADVFSLSLLIVIIVNSLMALP
FT                   YAIKTLAQPMLHCEQQYQYLAATLGLSGWNRFKIVEWRALRKPFANAFALCFMFSIGDL
FT                   SAIALFGSQDFRTLPLYLYQLLGSYQMEAAAVVSLTLLLLSVGCFALSESLLSSKSNQH
FT                   QEKAPC"
FT   CDS_pept        430603..431307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0439"
FT                   /product="thiamine ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93203"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93203"
FT                   /db_xref="GOA:Q7MPC5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPC5"
FT                   /protein_id="BAC93203.1"
FT                   /translation="MLTLQQVHYYYHQDLFAFDLEVEAGSIVALMGPSGAGKSTLLALL
FT                   AGFIAPQSGQMALDGRLLNTLSPAQRPFSMLFQEHNLFAHLTVRDNIALGLHPGLKLTS
FT                   QQQKQVEQAAKQVGIEAYLDRLPEQLSGGQRQRVALARCFVQPNPIWLLDEPFSALDPV
FT                   LRDEMLSLVKQLAQERAITVLMVTHHLSDARAIASHFAYIDKGTIAAHGPIASLNEKHS
FT                   HPELVEFFQAAV"
FT   CDS_pept        complement(431401..431958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93204"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93204"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPC4"
FT                   /protein_id="BAC93204.1"
FT                   /translation="MARKNQKAPWEPEEEYILVSKSEMKRDMDALQKLGEELVELKPSV
FT                   LAKFPISEELLDAIKDAQRFKNEARRRQLQYIGKVMRQEDPEPIQAALDKIRNKHSQNT
FT                   AVLHKLETLRERIVEQGDSAIDDVVALYPDADRQRLRQLARMATKEKQANKPPKAYREI
FT                   FQILKQLNDDAVSDSIENELKQ"
FT   CDS_pept        432076..433419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0441"
FT                   /product="pmbA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93205"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93205"
FT                   /db_xref="GOA:Q7MPC3"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPC3"
FT                   /protein_id="BAC93205.1"
FT                   /translation="MDVKQQVAQQRVELEAAVAKALALAAQHSDGAEVAINKTTGLSVS
FT                   TRMCEVENVEFNSDGALGITVYRGQRKGSASTSDLSEKAIEQTVLAALDIAQYTSEDPC
FT                   AGPAPAELMVKEIPDLDLFHPDTPDPDYAAKMAIAAEEHALNYSDKIKQSDGASYDSHY
FT                   GVRVYGNSHGLLASYASSRHSISCCVIGEGKNGEMERDYSYTVARHRDDMWRPEQVGRE
FT                   AAQKTIERLDARKLKTGKYPVMFAADVATGLIGHLVMAISGGNLYRKSSFLLDHLGKQV
FT                   LPEWFNISERPHILRGLASSPFDSEGVYTQDREIITDGVLATYLLTSYAARKMNMAPTG
FT                   HAGGIHNWFVQSTGQDFQQMLKELGTGLLVTEVMGQGVNVVTGDYSRGAAGFWVENGEL
FT                   QFPVSEITIAGNLKEMFQQIVAVGSDVETRSQVQTGSILLPSMKIAGE"
FT   CDS_pept        complement(433522..434877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0442"
FT                   /product="magnesium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93206"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93206"
FT                   /db_xref="GOA:Q7MPC2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPC2"
FT                   /protein_id="BAC93206.1"
FT                   /translation="MAEQIEFDQAHQALQEVSEALENGRFVHVRRQLQDMEPEDIAHLL
FT                   EASPRKSREVLWQLTDPEDYGEILDELSEDVKDSLVSKMAPEDLAEATEGMDTDDVAYV
FT                   LRSLPDNVSREVLAQMDAADRLRVETALSYSEDTAGGLMNTDVITIRGDVDVDVVLRYL
FT                   RMKGELPENTDALYVIDEESRLIGELPISILITTQPDVKVSEVMEDVDDAIAVTTSDSD
FT                   VASLFERRNWISAPVIDENQHLVGRITIDDVVDVIREDAEHSMMSMAGLNDDEDTFAPV
FT                   VKSARKRSIWLGANVLAALAAASVSNMFEATLDQMAAIAVLMTIVPSMGGVAGNQTVAL
FT                   VIRGLALGHIGDANKRELLMKEAAIGFLNGVLWALIIGGIVVAWKGNWLLGGIISAAMM
FT                   TNLIVAGIAGVTIPILLKKMNIDPALAGGMALTTVTDVIGLSVFLGLATILI"
FT   CDS_pept        complement(435092..435367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0444"
FT                   /product="phosphocarrier protein NPr"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93207"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93207"
FT                   /db_xref="GOA:Q7MPC1"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPC1"
FT                   /protein_id="BAC93207.1"
FT                   /translation="MELSRKVLIQNRLGLHARAAVKLVELAQSFAAEVTIDNEEDKTAA
FT                   ADSVMGLLMLESAQGQYVTIHASGEQAEQALDAICHLIEDKFEEGE"
FT   CDS_pept        435320..435454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0443"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93208"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93208"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPC0"
FT                   /protein_id="BAC93208.1"
FT                   /translation="MQAESILYEYFAAEFHDYSLLRFSKVVWRILTVCPIAAKYSPIC"
FT   CDS_pept        complement(435370..436233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0445"
FT                   /product="predicted P-loop-containing kinase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93209"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93209"
FT                   /db_xref="GOA:Q7MPB9"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPB9"
FT                   /protein_id="BAC93209.1"
FT                   /translation="MRLIVVSGHSGAGKSVALRVLEDMGYYCVDNLPVNLLESFIQSVS
FT                   ESKQNVAVSIDVRNIPKKLKELTTTLQKLKSSIDLSILFLDADKATLLKRYSETRRVHP
FT                   LSLSDECHTLDQAIDLEKKMLKPLKEIADILLNSSNQSLHDLSEDVRYRIEGKERNKLI
FT                   MVFESFGFKFGLPTDADYVFDVRFLPNPHWEPALRPMTGLDAPIKTFLESHDEVLELKR
FT                   QIQTFIEHWLPLLEKNNRSYLTVAIGCTGGKHRSVYLTQQIGEYFAAMGHTVKIRHTTL
FT                   EKRNKE"
FT   CDS_pept        complement(436246..436692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0446"
FT                   /product="nitrogen regulatory IIA protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93210"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93210"
FT                   /db_xref="GOA:Q7MPB8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPB8"
FT                   /protein_id="BAC93210.1"
FT                   /translation="MQLSTILSLDCTKSAVQCSSKKRALEIISNLVAEHTGQDSTELFE
FT                   CMLSREKMGSTGIGNGIAIPHARMTAADKAVAVLLQCEEPIDFDSIDNRPVDLLFALLV
FT                   PEEQCKEHLKTLSSMAERLSDKQVLKLLRSAQSDQELYDIMTNQ"
FT   CDS_pept        complement(436695..436982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0447"
FT                   /product="putative sigma-54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93211"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93211"
FT                   /db_xref="GOA:Q7MPB7"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPB7"
FT                   /protein_id="BAC93211.1"
FT                   /translation="MQINIQGHHVDLTDSMQDYVHSKFDKLERFFDHINSIQVVLKVEK
FT                   IHQIAEATLHVNQGEIHASSDDENMYAAIDSLVDKLVRQLNKHKEKLHSH"
FT   CDS_pept        complement(437006..438469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0448"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit"
FT                   /note="sigma54 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93212"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93212"
FT                   /db_xref="GOA:Q7MPB6"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPB6"
FT                   /protein_id="BAC93212.1"
FT                   /translation="MKPSLQLKLGQQLAMTPQLQQAIRLLQLSTLDLQQEIQEALESNP
FT                   LLEVEEHQEEAQLNGEDKAINEGSDSDDFSVEIDIPDSSDVIEKSEISSELEIDTTWDD
FT                   VYSANSGNTGIALDDDMPVYQGETTETLHDYLQWQLDLTPFSDTDRMIAFAIIDAVDDT
FT                   GYLTISPEEILESLNSVDIELDEVEAVRKRIQQFDPLGVASQNLQECLLLQLATFPTET
FT                   PWLAEAKMVLSHHIDALGNRDYKLIVKEAKLKEEDLRETLKLIQQLDPRPGSKINAIEP
FT                   EYVIPDVSVFKEHGKWSVAINPDSIPKLKVNQQYAQLGKGSSADSQYIRSNLQEAKWLI
FT                   KSLESRNETLLKVARCIVEHQHDFFEYGEEAMKPMVLNDVATAVEMHESTISRVTTQKF
FT                   MHTPRGIFELKYFFSSHVSTDSGGECSSTAIRALIKKLVTAENSAKPLSDSKIAALLAD
FT                   QGIQVARRTIAKYRESLGIAPSSQRKRLL"
FT   CDS_pept        complement(438523..439248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0449"
FT                   /product="ABC-type transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93213"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93213"
FT                   /db_xref="GOA:Q7MPB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPB5"
FT                   /protein_id="BAC93213.1"
FT                   /translation="MAVLSAKHLAKSYKKRKVVTDVSLQVESGQIVGLLGPNGAGKTTS
FT                   FYMIVGLVPRDEGSIKIDDRDISILPMHSRSKLGIGYLPQEASIFRKLSVEDNIMAVLQ
FT                   TRNELTREERQDKLEDLLEEFHIQHIRHSAGMALSGGERRRVEIARALAANPQFILLDE
FT                   PFAGVDPISVIDIKKIIEHLRDRGLGVLITDHNVRETLDVCEKAYIVSQGRLIAEGTPE
FT                   QVLNNEQVKQVYLGEQFRL"
FT   CDS_pept        complement(439248..439757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93214"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93214"
FT                   /db_xref="GOA:Q7MPB4"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPB4"
FT                   /protein_id="BAC93214.1"
FT                   /translation="MYKVDMKPLHLSLFALMLATSNAYALKSDTQQPVYIDSDSQQLDM
FT                   RSNQVIFDGDVSLKQGSININADKIVVTRDPESNTIKKIEAFGQPATFSQLMDDGKTLS
FT                   GSAKQLDYSIDNDQLTMKGQAELAQDNNVIKGSSIVYQIALQKLMADSSKNERVTTVLQ
FT                   PSQVNN"
FT   CDS_pept        complement(439723..440286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93215"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93215"
FT                   /db_xref="GOA:Q7MPB3"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPB3"
FT                   /protein_id="BAC93215.1"
FT                   /translation="MSFSRLIYLLLFFVVSWSCYYLYGQREAQSVQVAPNLELPMFSGE
FT                   SLNNISYNSDGIRSHQISSSHLDHYAKSGDTVFENPSLVIYRDGDTIEWKITARRAVLD
FT                   EEQVLTLSDHVRMQNLLPGASFEMLSTDKLEIDLSNRDFHADQPVLLIGPQFETTGEAM
FT                   KGNLKTNTATLYNHVQGRYETLTP"
FT   CDS_pept        complement(440283..440840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0452"
FT                   /product="low specificity phosphatase"
FT                   /note="HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93216"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93216"
FT                   /db_xref="GOA:Q7MPB2"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPB2"
FT                   /protein_id="BAC93216.1"
FT                   /translation="MTQFVETLYGPVEKAIVDIARDIKLLICDVDGVFSDGLIYMGNQG
FT                   EELKTFHTRDGYGVKALMNAGIEIAIITGRQSQIVENRMKALGISLIYQGQDDKVRAYY
FT                   DICDKLSILPEQTGYIGDDLIDWPVMEKVALQVCVADGHPLLAQRANYVTRIKGGHGAV
FT                   REVCDLILQARGELDAHKGLSI"
FT   CDS_pept        complement(440840..441811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0453"
FT                   /product="putative polysialic acid capsule expression
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93217"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93217"
FT                   /db_xref="GOA:Q7MPB1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPB1"
FT                   /protein_id="BAC93217.1"
FT                   /translation="MTLSFDYRAVAKQVLATEIRGLEQLSQYFDEQFEQACELILNNAG
FT                   KVVVMGMGKSGHIGKKIAASLASTGTSSFFVHPGEASHGDLGMIERGDIVLAISNSGES
FT                   SEILALFPVLKRLGIRIISMTGKPSSTMAKLADYHLQITVPEEACPLGLAPTTSTTATL
FT                   VMGDAMAVALLQARGFTAEDFALSHPGGALGRKLLLKLNDIMHTDEQLPRVSPNALVRD
FT                   ALLEISQKGLGMTAIVDQDNLLLGIFTDGDLRRILDKRVDIHSAQIGEVMTKHPTVANP
FT                   SMLAVEGLNLMQQKKINGLMLCQDGKLVGALNMHDLLKAGVM"
FT   CDS_pept        complement(441833..442876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0454"
FT                   /product="putative sodium/calcium exchanger protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93218"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93218"
FT                   /db_xref="GOA:Q7MPB0"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPB0"
FT                   /protein_id="BAC93218.1"
FT                   /translation="MASIFVGKRSKLAVNHSTYHYFLELIMLEAVALLIVGLILLVWSA
FT                   DKLVFGSAALARNIGISPLVIGMTILAMGSSAPEMMVSATAALDGKTDTAVGNVLGSNI
FT                   ANIALILGITALVRPLSINSAVVRRELPLMIGVTVLAGILLWDSHLGFYEGVLLFVLFT
FT                   LFLVAMLQISRREQKTGDAFLEEQESEIPQGVSNPKAAMWIVIGLILLPLAADMLVDNA
FT                   VIIAKYFGMSDLVIGLTIIAVGTSLPELAASLAGALKGEDDMAVGNIIGSNVFNILAVM
FT                   GIPGILNPSFISEYAMGRDFWVMLAISLLLVVMALGKSRRISRTEGGILLTCFIGYQAY
FT                   LLMNMAA"
FT   CDS_pept        443145..443948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0455"
FT                   /product="ABC-type transport system, ATPase component"
FT                   /note="involved in resistance to organic solvents"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93219"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93219"
FT                   /db_xref="GOA:Q7MPA9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPA9"
FT                   /protein_id="BAC93219.1"
FT                   /translation="MSHNDLVTIHGLTFSRGQRKIFDNIDLRIPKGKVTAIMGPSGIGK
FT                   TTLLRLIGGQILPESGEIWFDGVNIPSLSRSKLYHARKKMSMLFQSGALFTDLNVFDNV
FT                   AFPLREHTQLSDSLIRTLVLLKLEAVGLRGAAELMPSELSGGMARRAALARAIALDPEL
FT                   IMYDEPFVGQDPITMGVLVELIRNLNSALGVTAVVVSHDVPEVMSIADWVYLLADGKVI
FT                   AKGTPEELRNNSDPRVQQFLLGEADGPVPFRFPAQPIEKDLFHDA"
FT   CDS_pept        443941..444729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0456"
FT                   /product="ABC-type transport system, permease component"
FT                   /note="involved in resistance to organic solvents"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93220"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93220"
FT                   /db_xref="GOA:Q7MPA8"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPA8"
FT                   /protein_id="BAC93220.1"
FT                   /translation="MPNLVDMISVLGRRFLSLCQSFGKASLMLAGALAGRPQPRKTLPL
FT                   LVKQIYNVGVQSLAIIVVSGLFIGMVLSLQGYVILVDYGAEGSLGQMVALSLLRELGPV
FT                   VTALLFAGRAGSALTAEIGLMKATEQLSSMEMMAVDPLKRIIAPRLWAGIISMPLLAMI
FT                   FMAVGIWGGQLVGVDWKGIDHGSFWSAMQASVELGQDIGNSMIKCVVFAITVTWIALFN
FT                   GYDAIPTSEGISRATTRTVVHSSLAVLGLDFVLTALMFGN"
FT   CDS_pept        444732..445220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0457"
FT                   /product="ABC-type transport system, periplasmic component"
FT                   /note="involved in resistance to organic solvents"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93221"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93221"
FT                   /db_xref="GOA:Q7MPA7"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPA7"
FT                   /protein_id="BAC93221.1"
FT                   /translation="MQQTRKTELWVGSFVLAGICAILVMIFQVADVKGLGSGNTYTLKA
FT                   QFDNIGSLKVRSPVKVGGVVIGRVSDISLNPETLVPVVSLSINSLYNQFPETSSVQILT
FT                   SGLIGEQYIGLVPGFVFEDEQMLKDGDFIEDTKSALVLEDLIGQVLYSVGNKDETKKD"
FT   CDS_pept        445201..445860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0458"
FT                   /product="ABC-type transport system, auxiliary component"
FT                   /note="involved in resistance to organic solvents"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93222"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93222"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPA6"
FT                   /protein_id="BAC93222.1"
FT                   /translation="MKLRRTNSMKRFFLTCLSLLMSLNVLASTAVDKAEPYQMMKQVSE
FT                   QAFARLKAEQPKIQQDPDYLKVVVEEELMPYVNEKYAALKLLGTNLKGAKREDVTAFID
FT                   AFRAYLVSSYAQVLTQYTDQKILFGPEPKVEDGQRITSVKVDIIDTPRPNIKLEFKLRR
FT                   ENNGDWLAFDMVAEGISLLSSKQSEWNGKIRQDGILAVANELEALAKQPIRFEAKN"
FT   CDS_pept        445860..446177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0459"
FT                   /product="putative anti-sigma B factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93223"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93223"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPA5"
FT                   /protein_id="BAC93223.1"
FT                   /translation="MSHPQWQQSTDEKVSLSGNLDREQVPSLWRFAQTWKPRNSQVEFS
FT                   LKTVQRVDSAGMVMLIHLLEHAKKQNCHIMLSFVPAQLRTLFQLSNVEAVVAKHIQSYQ
FT                   G"
FT   CDS_pept        446181..446435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0460"
FT                   /product="predicted transcriptional regulator"
FT                   /note="BolA superfamily"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93224"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93224"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPA4"
FT                   /protein_id="BAC93224.1"
FT                   /translation="MDSAKVQQLLEEALNLEELHVKGEGSHYEVVAVDACFEGMSRVKK
FT                   QQLIYKPLMDYIQRNDIHALSIKAYTPAEWARDKKLMSL"
FT   CDS_pept        446445..447710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0461"
FT                   /product="UDP-N-acetylglucosamine enolpyruvyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93225"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93225"
FT                   /db_xref="GOA:Q7MPA3"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MPA3"
FT                   /protein_id="BAC93225.1"
FT                   /translation="MEKFRVIGSTQPLMGEVTISGAKNAALPILFASILAEEPVEVANV
FT                   PHLRDIDTTMELLKRLGAKVERNGSVHVDPSSIDEYCAPYDLVKTMRASIWALGPLVAR
FT                   FGQGQVSLPGGCAIGARPVDLHITGLEQLGATITLEDGYVKAHVDGRLQGAHIVMDKVS
FT                   VGATITIMCAATLAEGTTVLDNAAREPEIVDTAKFLNTLGAKISGAGTDTITIEGVERL
FT                   GGGKHAVVADRIETGTFLVAAAVSGGKVVCHNTQAHLLEAVLAKLEEAGALVETGEDWI
FT                   SVDMTGRELKAVNIRTAPHPGFPTDMQAQFTLLNMMAKGGGVITETIFENRFMHVPELK
FT                   RMGAKAEIEGNTVICGDVERLSAAQVMATDLRASASLVIAGCIAKGETIVDRIYHIDRG
FT                   YDKIENKLNALGAKIERFRESN"
FT   CDS_pept        447850..448575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0462"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93226"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93226"
FT                   /db_xref="GOA:Q7MPA2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPA2"
FT                   /protein_id="BAC93226.1"
FT                   /translation="MIALVRLLATALFAVVMFVFGCGYCLLSPRNPKHVFTFGRLFAKM
FT                   SRVFGIKLELRLPEDAYQRGQHIYIANHQNNWDLFTVSAAVTPKVVTVGKKSLAWLPLF
FT                   GQLYWLTGNILIDRANKTKAKGTIDQVVASMKASEVSVWMFPEGTRSRGRGLMPFKTGA
FT                   FHAAIGAGVPIIPIVCSSTDQLKLNRWNNGHVIVEMLDPISTEGYGKEHIRELAEICRE
FT                   KMKAKLESLDEEVKLRNQQ"
FT   CDS_pept        complement(448661..449098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93227"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93227"
FT                   /db_xref="GOA:Q7MPA1"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPA1"
FT                   /protein_id="BAC93227.1"
FT                   /translation="MYKQILVPVDLNDKGFSDRAVELAVWHARQANAQLHLLNVLPGIH
FT                   MSMVASYFPKDAAQKMKQDVVQQLKNFADQHIADEIVYKVHVAEGKPYATILEYAEKLG
FT                   ADLIIMPSHKRSKIDKVVLGSVASKVVENSPINVLVVKPQA"
FT   CDS_pept        complement(449177..451756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0464"
FT                   /product="TRAP-type uncharacterized transport system, fused
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93228"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93228"
FT                   /db_xref="GOA:Q7MPA0"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="InterPro:IPR021814"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MPA0"
FT                   /protein_id="BAC93228.1"
FT                   /translation="MTTNTTPSQDVQEMVAQADTGARNPAGLQGRILWFVPLCWSLFQL
FT                   WYASPLPFIFDFAVLNDTQARAVHLTFAIFLAFTAYPALKSSPREHIPALDWVLALLGS
FT                   FSASYIYIFYTELAGRSGAPTTMDVVVAVTGMVLLLEATRRALGPPLMLVAALFLFYTF
FT                   AGPYMPDVIAHKGASINKAMSHLWLTTEGVFGVALGVSTSFVFLFVLFGAMLERAGAGA
FT                   YFIKVAFSLLGHMRGGPAKAAVVASGLSGLVSGSSIANVVTTGTFTIPLMKRVGFPGTK
FT                   AGAVEVAASTNGQLTPPIMGAAAFLMVEYVGISYVEVIKAAILPALISYIALIYIVHLE
FT                   ACKAGMTGLPRRHNPTMLQSLISFTGTILGLCVVSAVVYYGIGWTKDVFGDAATPMVTI
FT                   ALLVAYVGLVKISANHAQDGALEIDAELTEVPDPGPTIKSGLHFLLPIVVLVWCLTVER
FT                   FSPGLSAFWATVFMIFILLTQRPLMALMNKSDDIAQQTKAGWTDLLESLVSGARNMIGI
FT                   GVATAAAGTVVGVVTLTGIGLVMTDFVEFISGGSVIMMLIFTAVISLILGMGLPTTANY
FT                   IVVSTLMAPVIVTLGAQHGLIIPLIAVHLFVFYFGILADDTPPVGLAAFAAAAIAKSDP
FT                   IRTGIQGFAYDIRTAILPFMFVFNTQLLLMGIDTWWHLLLTILSSIIAMLIFSAATQGW
FT                   WFTKNKWWETLLLLILTFSFFRPGFWWDMIYPAKVLSPGIEIEQITQKLDVGQSLELRV
FT                   AGTNLEGDFTEKTVRLPFDDNATTALERLQSMGLSLVEDQGKMLVDMVEFDSPAEASGI
FT                   DFDWEIKWVVEEADRPMKEWVFVPCLLILIFMAANQKRRIRSQLIQA"
FT   CDS_pept        complement(451952..452920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0465"
FT                   /product="TRAP-type uncharacterized transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93229"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93229"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP99"
FT                   /protein_id="BAC93229.1"
FT                   /translation="MALNTLIKVGAIAAAVMGAGAVHAQEFITIGTGSVTGVYYPTGGA
FT                   ICKLVNKDRKDHNIRCSVESTGGSIYNVNTIRSGELDFGIVQSDWQYHGYKGTSKFEEQ
FT                   GPYTKLRAMFSLHTEPFNIIARSDAGIDKLEDLKGKRVNIGNPGSGDHATMSVVMDAMG
FT                   WNNDSFKLASELKGSERSQALCDNKIDAFIYMVGHPNGSIKEATTSCDAKLVSATGPQI
FT                   DKIVADNPYYAYSTVPAGMYRGTDKDVKSFGVAATLVTTADVSDDVAYNVAKAVFENFD
FT                   TFKRLHPAFATLKKEDMVSAGISIPLHPGAVKYYKEVGLLK"
FT   CDS_pept        complement(453286..453918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0466"
FT                   /product="arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93230"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93230"
FT                   /db_xref="GOA:Q7MP98"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:3V4G"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP98"
FT                   /protein_id="BAC93230.1"
FT                   /translation="MTTFLALFAIHCANRTVICLKFTVIQLTDCNQLLALSEYLCENMQ
FT                   NVKKWNVDFMRPSEKQDNLVRAFKALLKEERFGSQGEIVEALKQEGFENINQSKVSRML
FT                   TKFGAVRTRNAKMEMVYCLPTELGVPTVSSSLRELVLDVDHNQALVVIHTGPGAAQLIA
FT                   RMLDSLGKSEGILGVVAGDDTIFITPTLTITTEQLFKSVCELFEYAG"
FT   CDS_pept        454129..455061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0467"
FT                   /product="malate/lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93231"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93231"
FT                   /db_xref="GOA:Q7MP97"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR023958"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP97"
FT                   /protein_id="BAC93231.1"
FT                   /translation="MKVAVIGAAGGIGQALALLLKNRLPAGSDLALYDIAPVTPGVAAD
FT                   LSHIPTPVSIKGYAGEDPTPALEGADVVLISAGVARKPGMDRADLFNVNAGIVKSLAER
FT                   IAVVCPNACIGIITNPVNTTVPIAAEVLKKAGVYDKRKLFGVTTLDVIRSETFVAELKG
FT                   QDPGEVRVPVIGGHSGVTILPLLSQVEGVEFSDEEIAALTKRIQNAGTEVVEAKAGGGS
FT                   ATLSMGQAACRFGLALVKALQGEEVIEYAYVEGNGEHASFFAQPVKLGKEGVEEILPYG
FT                   ELSDFEKAALDGMLETLNGDIQIGVDFVK"
FT   CDS_pept        complement(455011..455145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0468"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93232"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93232"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP96"
FT                   /protein_id="BAC93232.1"
FT                   /translation="MLSRILSTTNKKADPTIGFVFLTLTFADLLYEVHANLNVTVKRF"
FT   CDS_pept        complement(455184..456104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0469"
FT                   /product="geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93233"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93233"
FT                   /db_xref="GOA:Q7MP95"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP95"
FT                   /protein_id="BAC93233.1"
FT                   /translation="MKQFKPNSINDVSLINQLGFYIISGGGKRLRPLLAVLSARALGYQ
FT                   GNAHTTAAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQ
FT                   MMTELGSMKILKLMSDAVNIIAEGEVLQLMNCNDPDTTEESYMQVIYSKTARLFEAATQ
FT                   IGAILNDAPAEVETALQNYGKYLGTAFQLIDDVMDYTSDGEEMGKNVGDDLAEGKPTLP
FT                   LLHAMRHTNAENAQMIREAIENANGMERLDDILAVMQQAGSLTYTEAKAMEEADKAIAE
FT                   LQVLPESEYKQALIALAHMAVKRSK"
FT   CDS_pept        456428..456739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0470"
FT                   /product="ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93234"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93234"
FT                   /db_xref="GOA:Q7MP94"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP94"
FT                   /protein_id="BAC93234.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQTLRLEKLDVETGATVEFDKVLLVANGE
FT                   DIKVGAPLVEGGKVVAEVVQHGRGDKVKIVKFRRRKHSRKQQGHRQWFTEVKITGINA"
FT   CDS_pept        456760..457017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0471"
FT                   /product="ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93235"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93235"
FT                   /db_xref="GOA:Q7MP93"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP93"
FT                   /protein_id="BAC93235.1"
FT                   /translation="MAHKKAGGSTRNGRDSESKRLGVKRFGGESVLAGNIIVRQRGTQF
FT                   HAGNNVGLGKDHTLFALTDGKVKFEVKGPKNRKFVSIEAE"
FT   CDS_pept        457173..458339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0472"
FT                   /product="GTP1/Obg family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93236"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93236"
FT                   /db_xref="GOA:Q7MP92"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP92"
FT                   /protein_id="BAC93236.1"
FT                   /translation="MKFVDEAVIKVQAGDGGNGVVSFWREKFVTKGGPDGGDGGDGGDV
FT                   YIQADENLNTLIDYRFQRFYEAERGQNGSGGNCTGKRGKDITLRVPVGTRAVDIHTNEI
FT                   VAEVAEHGKKVMVAKGGWHGLGNTRFKSSVNRAPRQKTMGTKGEIRELRLELLLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLIPSLGVVSVVPEKSFVVADIPGLIEGAA
FT                   DGAGLGIRFLKHLERCRVLLHMIDIFPIDQSDPVQNALTIIDELEQYSEKLANKPRWLV
FT                   FNKVDLVSEEQADEIIQEVIDALGWEEQYFKISAVNRQGTKELCYKLADFMEQLPREEQ
FT                   EVSEEEKVNFMWDYHPDANQGEVITEDDDDWDDWDDEEDDGHVIYVRE"
FT   CDS_pept        458499..459266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93237"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93237"
FT                   /db_xref="GOA:Q7MP91"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP91"
FT                   /protein_id="BAC93237.1"
FT                   /translation="MASTQRAISRLVAQAGQMLLAHGAESTLVGDIMHRIGIASGVSEV
FT                   EVALSANALVVTTVMDGHCITTTRSCVDRGINMKAVTEIQRICIMMEKGVLDPMMAQRK
FT                   LNNISPERYNRWLVVFMIGISCASFARLAGGDWAVFAMTFLASACGMIVRQEIGHRHFN
FT                   PLLNFAATAFVTTLISAQAVILEIGNLPTVVMASSVLMLVPGFPLINSVADMLKGHINM
FT                   GIARFVMASLLTLATSLGIVAAMSVTGIWGWSS"
FT   CDS_pept        459254..459730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93238"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93238"
FT                   /db_xref="GOA:Q7MP90"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP90"
FT                   /protein_id="BAC93238.1"
FT                   /translation="MVELMELLVGLLNDMFFAAIPAVGFALVFNVPPRALIYCALGGAI
FT                   GHGSRYLMMKFGIPIEWATFFAATLVGMIGVYWSRRLLAHPKVFTVAALIPMVPGVFTF
FT                   KAMIAMVEINHLGYTPELVAVCMENFLKAMFIIAGLAVGLAVPGLLFYRRRPIV"
FT   CDS_pept        459740..460228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0475"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93239"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93239"
FT                   /db_xref="GOA:Q7MP89"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP89"
FT                   /protein_id="BAC93239.1"
FT                   /translation="MIISMIAAMAKQRIIGKDNQMPWHLPADFAWFKRCTMGKPVVMGR
FT                   KTYDSIGRPLPGRLNIVISRDESLVIEGVTMANSIAHALALAGDADEVMIIGGGSIYAE
FT                   CLPKADKLYLTFIDATIDGDTQFPDWGEQWCESHREHYSADEKNRYAMDFVILERDNC"
FT   CDS_pept        complement(460369..461178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0476"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93240"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93240"
FT                   /db_xref="GOA:Q7MP88"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP88"
FT                   /protein_id="BAC93240.1"
FT                   /translation="MANYIVGDIQGCFDELMLLLAQCQFDKNVDTLWVAGDLVARGPKS
FT                   LETLRFIKSLGDSAKVVLGNHDLHLIAVSLGIRNNKAKDKTAPIFASEDGNELLHWLRQ
FT                   QPLLAEHPKFVVCHAGISPQWDLATARLCAEEVESLLRSENYRWLIENMYCNQPDLWQD
FT                   NLSGLDRYRYIINAFTRMRFCFADGRLDMDCKLPPSEVKESELMPWFTLPQRRALDKPV
FT                   LFGHWAALEGYISEEVIGLDTGCVWNGSLTMIRWEDKQVFSQKALEN"
FT   CDS_pept        complement(461193..461573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0477"
FT                   /product="apaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93241"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93241"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP87"
FT                   /protein_id="BAC93241.1"
FT                   /translation="MDVSQPRIQIQVHTKYVEEQSNPELARYIFAYIITIKNHSSESVQ
FT                   LLSRRWLITDANGKQISVEGDGVVGQQPFIDAGDEYTYSSGTALDTPVGVMQGQYIMHD
FT                   AQGKEFVVEIEPFRLAVPNILN"
FT   CDS_pept        complement(461633..462439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0478"
FT                   /product="dimethyladenosine transferase"
FT                   /note="rRNA methylation"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93242"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93242"
FT                   /db_xref="GOA:Q7MP86"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP86"
FT                   /protein_id="BAC93242.1"
FT                   /translation="MRNDVHMGHKARKRFGQNFLNDPYIIDGIVSAINPRPGQNLVEIG
FT                   PGLGAITEPVGREVDKFTVIELDRDLAERLRTHPELADKLTIHEGDAMRFDFTQLVKPN
FT                   NKLRIFGNLPYNISTPLMFHLFEFHKDIQDMHFMLQKEVVNRLAAGPGSKAYGRLTVMA
FT                   QYYCKVVPVLEVPPTAFVPPPKVDSAVVRLVPYETLPHPANNLQWLERVCREGFNQRRK
FT                   TVRNCYKSLMSEQVLEELGVNPGMRPENLTLQQFVAMANWLDANHK"
FT   CDS_pept        complement(462436..463458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0479"
FT                   /product="pyridoxal phosphate biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93243"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93243"
FT                   /db_xref="GOA:Q7MP85"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP85"
FT                   /protein_id="BAC93243.1"
FT                   /translation="MRLSKSSTRKKTMVKRLVVTAGEPAGIGPDLVLALSKEHWPHQLV
FT                   VCADKKMLAQRAEQLGINVTLLDYDASTAPSPQQAGTLVVEHIDMPSTCVAGQLNEENG
FT                   HYVLKTLERAALGCMKSEFDAIVTGPVHKGVINRAGVAFSGHTEFFAELSNTPLVVMML
FT                   ATEGLRVALVTTHIPLAYVSKAVTAERLQKIIDILHRDLVEKFAIAEPKIYVCGLNPHA
FT                   GEDGCLGREEIETITPTLEKIRQEKGIHLLGPLPADTIFNEKYLNDADAVLGMYHDQVL
FT                   PVLKYKGFGQSVNITLGLPFIRTSVDHGTALDLAGTGQANTGSFRTALQHAIELVEKKQ
FT                   "
FT   CDS_pept        complement(463415..464746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0480"
FT                   /product="parvulin-like peptidyl-prolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93244"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93244"
FT                   /db_xref="GOA:Q7MP84"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP84"
FT                   /protein_id="BAC93244.1"
FT                   /translation="MMTLSKETKRYMDYKMNIWKTLLLGMLVTGSAVSAPVELDKVAVI
FT                   VNDGVILQSDIDTATKTLRANAKKSGQALPDADVLNEQIVDKLIIDTLQTQEADRIGVR
FT                   IDDTRLNQAIEEIARNNNQTIDELSAAIASEGVSYEEFREQIRKEMAASEARNALVRRR
FT                   INILPAEVDNLAELLSKETNASVEYRIGHIQLRFTDGQDKSALEAQAKELVEKLKQGAD
FT                   FSTMAYTYSKGPKALQGGDWGWMRKEEMPTIFADQIKMQNKGSIIGPFRSGVGFHILKI
FT                   EDVKGLETVAVTEVNARHILLKPTVILSDEGAQRELNEFIRRIRAGEATFGELAQQYSQ
FT                   DPGSAAQDGELGYQTPDLYVPEFKHQVETLPVGTISEPFKTVHGWHIVEVLDRREVDRT
FT                   DSAMKNKAYRILFNRKFNEEVGAWMQELRAGAFVEIINEEENDG"
FT   CDS_pept        complement(464752..467082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0481"
FT                   /product="organic solvent tolerance protein OstA"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93245"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93245"
FT                   /db_xref="GOA:Q7MP83"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP83"
FT                   /protein_id="BAC93245.1"
FT                   /translation="MQHFSRTFLAASIATALFAPYAQAEAILNNSVQEMPTTDQCLVDA
FT                   EKNDANAEIVIQADNLQAINGDKAIYSGDVEVTQGNKKITAESVTLHQQENIVVAEGNV
FT                   TFNDGEVKASSSKVTNNMTSETFSLENTEYQFLCQQGRGQAAYIAKTGQAVYELEDGSI
FT                   TSCPADDNAWRLVASSIEVDQDEETATFYHPRFEVLDVPVFYAPYLTLPIGNTRKTGFL
FT                   FPSVNYGSSDGLEIEVPFYWNIAPNYDLTLTTLYMQQRGVKQDADFRYLSDGWGSGELK
FT                   GEYLPGDEKYNDEDRWGYQYKHDGIINKQWLVSLDYSQVSDIDYFRDLSSDLGNREDGQ
FT                   LMQQGKVAYRSDFWDMSLQVRDFQILLQDNNQPYRLLPQVKFNFYTPLLGNYLNFDVKS
FT                   ELTQFDIQDASKPNALRAHVEPGLTIPLSTSWATWTTEARLLATYYQQDLDRLTDPTLK
FT                   SQLDETVARVIPEYRSHARIYLEREAKLFEGYTQSLEPQIQYLYVPEEEQGNIYNYDTT
FT                   LLQTDYYGLFRSRKYSSIDKIAAANQLSYGASTRFFDDEYKERLNISFGQIYYIDKKTK
FT                   LTGNQEETSNYSSWAVETDFNYEDFLFYHGGIQYDIDLNAMQLANSTLEYQFTDGFIQG
FT                   NYRYVTKDYIEDTISFDELDKITRKGISQAGIVGAYNINRHWSASGQYYYDLTEEIDLE
FT                   WMASLRYQSDCWYIGFTYTNQLVKWRNDVVGGDSNNPVYDTNISVNFGIQGFATKNKAE
FT                   TAAKELDSTDNAITYGRPFYLNN"
FT   CDS_pept        467230..468093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0482"
FT                   /product="DnaJ-domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93246"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93246"
FT                   /db_xref="GOA:Q7MP82"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP82"
FT                   /protein_id="BAC93246.1"
FT                   /translation="MQIFGKILGAFFGFLFGGVFGALFGLFIGHQFDKARRLSQAGFKT
FT                   AGFGQGPSQAQRQEEFFKSAFAVMGHVAKAKGQVTKEEIQLASAMMDRMSLHGEQRRAA
FT                   QDAFREGKERDFPLEQLLERVKIATSGRFDLLQFFLELQISAAFADGDVHPSERNVLHK
FT                   IARGLGFSSEQLERRLQMQEAAFRFQRQGGFGGQQHQSHHSSSHGGWQQASQTDRLADA
FT                   YKILGIDANADGKEVKRAYRKLMNEHHPDKLMAKGLPPEMMNMAKEKSQEIQSAYDLIK
FT                   KEKGFK"
FT   CDS_pept        complement(468178..468984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93247"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93247"
FT                   /db_xref="InterPro:IPR006869"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP81"
FT                   /protein_id="BAC93247.1"
FT                   /translation="MLCRGYFPMRRYLLLIFTLFSVASYAAPKSDLWPYWQPSDEQSTI
FT                   KVSHQAWQTLLDRYLIRQGENTLFRYAQVSTQDHQTLKQYLTTLAKQNPLTLNRAEQYA
FT                   YWVNLYNAITVDLILDNYPLKSITKLGGLFSFGPWNEEVITINSKPLTLNDIEHRILRP
FT                   IWNDPRTHYAVNCASLGCPNLQPQAFTADNTPALLDAAAKEFINSAKGVSRQGNKAQLS
FT                   SIYDWFADDFGGKAGLFSHIGRYAPQYQDFSGQIEYDYDWNLNQAQ"
FT   CDS_pept        complement(469094..469717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0484"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93248"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93248"
FT                   /db_xref="GOA:Q7MP80"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP80"
FT                   /protein_id="BAC93248.1"
FT                   /translation="MEIRGTHMQGFKQHTGLVVPLDAANVDTDAIIPKQFLQKVSRLGF
FT                   GKHLFHDWRFLDDAGEQPNPEFVMNHARYQGASILLARENFGCGSSREHAPWALADYGI
FT                   RAMIAPSFADIFYGNSINNQMVPVRLTEQEVDELFQYVQATEGAQIEVDLEALKVRANG
FT                   KEYSFEIDDFRRHCLLNGLDHIGLTLQHEDKIAAFEADIPAFLR"
FT   CDS_pept        complement(469708..471108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0485"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93249"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93249"
FT                   /db_xref="GOA:Q7MP79"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP79"
FT                   /protein_id="BAC93249.1"
FT                   /translation="MGKTLYEKVYEAHVAVAAEGETPILYIDRHLVHEVTSPQAFDGLR
FT                   EKGRQVRQVSKTFATMDHNVSTTTKDINASGEMARIQMETLIKNCQEFGVTLYDINHKY
FT                   QGIVHVMGPELGITLPGMTIVCGDSHTATHGAFGSLAFGIGTSEVEHVLATQTLKQARA
FT                   KTMKIEVQGKVADGITAKDIVLAIIGKTTAAGGTGYVVEFCGEAITDLSMEGRMTVCNM
FT                   AIELGAKAGLIAPDKTTFDYIKGRKFAPTGADWDAAVEYWKTLKTDEDAKFDAVVTLNA
FT                   ADIKPQVTWGTNPGQVIAVDEPIPAPESFSDPVEKASAEKALAYMGLEAGKSLSEYKVD
FT                   KVFVGSCTNSRIEDMRAAAVVAKGRKVASHVQALIVPGSEQVKAQAEAEGLDVIFKEAG
FT                   FEWRLPGCSMCLAMNNDRLGPHERCASTSNRNFEGRQGRDGRTHLVSPAMAAAAAIAGH
FT                   FVDIRDWK"
FT   CDS_pept        complement(471128..472219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0486"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93250"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93250"
FT                   /db_xref="GOA:Q7MP78"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP78"
FT                   /protein_id="BAC93250.1"
FT                   /translation="MTDKTYKIAVLPGDGIGPEVMAQAHKVLDAIEKKHAIHFEREEHD
FT                   VGGIAIDNHGCPLPQSTVTACEESDAVLFGSVGGPKWEHLPPNDQPERGALLPLRKHFQ
FT                   LFCNLRPAQIHSGLEAFSPLRADISGRGFDIVVVRELTGGIYFGQPKGREGEGANEKAY
FT                   DTEIYHRFEIERIAKIAFESARLRRKKVCSIDKANVLQSSILWREVVEEIAKDYPDVEL
FT                   SHMYIDNATMQLIKDPAQFDVMLCSNIFGDIISDECAMITGSMGMLPSASLNESKFGLY
FT                   EPAGGSAPDIAGKNIANPVAQILSAALMLRYSLGEEAAAQDIENAVSQALAAGELTADL
FT                   AGDKPALSTAEMGDKIAQYILNS"
FT   CDS_pept        complement(472306..473853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0487"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93251"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93251"
FT                   /db_xref="GOA:Q7MP77"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP77"
FT                   /protein_id="BAC93251.1"
FT                   /translation="MNDQVIIFDTTLRDGEQALSASLTVKEKLQIAYALERLGVDVIEA
FT                   GFPVSSPGDFESVQTIARNIKNSRVCALSRAVEKDIDAAAEALKVAEAFRIHTFISTST
FT                   IHVQDKLRRSYDDVVEMGVRAVKHARKYTDDVEFSCEDAGRTPIDNLCRMVEAAINAGA
FT                   RTINIPDTVGYTVPSEFGGIIQTLFNRVPNIDKAIISVHCHDDLGMSVANSIAAVQAGA
FT                   RQVEGTINGIGERAGNCSLEEIAMIIKTRQELLGVRTGINHEEIHRTSKLVSQLCNMPI
FT                   QANKAIVGANAFSHSSGIHQDGMLKNKNTYEIMTPESIGLKNQALNLTSRSGRAAVKSH
FT                   MDAMGYKEDEYNLDALYQDFLKLADRKGQVFDYDLEALMHFSNLREEDDYYKLNYLSVQ
FT                   SGSVMATTSIKLLCGDEEKCEAAVGNGPVDALYQCIYRLTGYDIVLDKFDLTAKGEGED
FT                   GLGQADIIANYKGRKYHGTGISTDIVEASGQALLHVINSIHRADEIAEMKQKKIATV"
FT   CDS_pept        474430..475221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0488"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93252"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93252"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP76"
FT                   /protein_id="BAC93252.1"
FT                   /translation="MMKRREKIMSNKSAWYAVLTLSCLTLLGCQSTSTERKVSSVSSAQ
FT                   LSKNAEVLQQQLELTLSSQEQKTFLTAMATLLESESSEMAGGEEKEGLRASQWRIASSD
FT                   PKTKTFLVGTDIYPGVTLKGELSLLDLPFSATTVVNLRSGPSAKSNKVGQLQTGDVFIA
FT                   LAKVPGAPWLLVERQGMIEGYVHQGYVQSRIEPRDILSVKPNAALTPKTRSASQKILWT
FT                   GSYQCRDLQYQLNGANQARSGNLMACRKDKNIWYIQSIDPS"
FT   CDS_pept        complement(475204..475335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0490"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93253"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93253"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP75"
FT                   /protein_id="BAC93253.1"
FT                   /translation="MGDQEDSERDKGSGEERREHEQSALFAINKEKKSPSRKLTGID"
FT   CDS_pept        475276..475410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0489"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93254"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93254"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP74"
FT                   /protein_id="BAC93254.1"
FT                   /translation="MLSSFFSASFVPLAIFLIAQALSRIHGVVTKSPNSFHGIVTLVS"
FT   CDS_pept        475438..475995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0491"
FT                   /product="membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93255"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93255"
FT                   /db_xref="GOA:Q7MP73"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP73"
FT                   /protein_id="BAC93255.1"
FT                   /translation="MATMKSINTLRLPIQRIADFDFALSSFCLKHRFNYQVATISKAIS
FT                   HSGDGHLYALIGLAAWLAIPSLGTWFLLCGLLAFVIELPIYWGLKNSFKRRRPEEYSAY
FT                   LPAFITPSDRYSLPSGHTAAGFVMATITSYFFPELTWFAFSWATLIGLSRILLGVHFFS
FT                   DIVIGALLGHACATLALILVME"
FT   CDS_pept        476000..477046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0492"
FT                   /product="glycosyl transferase"
FT                   /note="related to UDP-glucuronosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93256"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93256"
FT                   /db_xref="GOA:Q7MP72"
FT                   /db_xref="InterPro:IPR005262"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP72"
FT                   /protein_id="BAC93256.1"
FT                   /translation="MKILYGVQGTGNGHIARARAMANAFAAQHCQVDFLFSGRDPKRYF
FT                   SMEAFGQYKTCRGLTFATKNGRVDYWQTALENSLLTLKQEVQQQDLSQYDLVISDFEPV
FT                   SAWAAKRQNKPCIGLSHQNAFRYSVPLRGASWLDKQVLRHFAPANIHLGLHWYHFDQPI
FT                   LPPIVHTLCYQTEQSDEILVYLPFEQLESICELLWRFKSQSFICYHPDVLAEEMEGNIS
FT                   LRALDHHSFQLDLHRCKGVIANGGFELPSEALTLGKKLLVKPLEGQFEQQSNVATLETL
FT                   GLATVMDTLDSQVVRRWLQDALAEKVIYPQVAPAIVEWILKGEWSCHQTLCEQLWQQVD
FT                   FPSYVSIS"
FT   CDS_pept        477399..478358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0493"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93257"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93257"
FT                   /db_xref="GOA:Q7MP71"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP71"
FT                   /protein_id="BAC93257.1"
FT                   /translation="MLDKKDAMSAIASYRMESTLRGVDLNLLTVFDAVMQEQNITRAAH
FT                   NLGMSQPAVSNAVARLKVMFNDELFMRQGRGIQPTQRARQLFGPVRQALQLIRNELPSS
FT                   VFQPESSTRLFKLAICSPCDMRFAPRIMADIHNKAPNVQLHLDAEFDRMLSERMRYQEI
FT                   DFVIDYARFDEQGFSSTEIFKDELVVVTSKQHPRIQGKVTEAQLMQERHAKLSRIHGQR
FT                   SFSEQAYRDLDVAAYFEGTSLSNVLYVVGQSELVTIAPRWIVENAANNAQLQILDFPFE
FT                   NREISGFLSWHESSEKDKGHIWLRDLLMVTCGEVVAAV"
FT   CDS_pept        478501..480351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0494"
FT                   /product="long-chain acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93258"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93258"
FT                   /db_xref="GOA:Q7MP70"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP70"
FT                   /protein_id="BAC93258.1"
FT                   /translation="MPANRAYMCKPKVRDMANLDFHIVKRIRKQIAQGAERVALKHKVG
FT                   AVWQGISWKQFGQQIDELSLALLAQGIEVQDKIAIFSNNMPQWTVADFAALQLRAVTVP
FT                   IYPTNTAAQAAYILQNADVKVLFVGEQPQFDAAVKIFDECEQLNLIVAMSDDIDLGEHH
FT                   FAIHWKAFIQQGQQEARAELERRLEQANFEDLLTLIYTSGTTGQPKGVMLDYSNIAAQL
FT                   EGHDRRLSLTENDVSLCFLPLSHVFERAWTFYVLYKGGTNCYLQDTMQVRDALSDIKPT
FT                   VMCAVPRFYEKIFSAIHEKVSRAPLMRKIMFTWAVNMGAKMSVCHQEGRQPSLMLKKAH
FT                   ALADKLVLSKLRALLGGNINFMPCGGAKLDETIGRFFHAIGINVKLGYGMTETTATISC
FT                   WDDKCFNPDSIGMSMPGAQVKIGENNEILVRGPMVMRGYYKLPEETEKTFDEHGFLKTG
FT                   DAGHIDEHGNLFITDRIKELMKTSGGKYIAPQMIEGAIGKDHFIEQIAVIADTRKFVSA
FT                   LIVPCFDSLEEYAKELNIKYHDRVELIKHHQVVEMLEKRVNDLQKELAKFEQVKKFKLL
FT                   PKAFSMDEGELTPTQKLRRKVINDKYQDEIEEMYSEKKEK"
FT   CDS_pept        480810..482534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0495"
FT                   /product="thiamine pyrophosphate-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93259"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93259"
FT                   /db_xref="GOA:Q7MP69"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP69"
FT                   /protein_id="BAC93259.1"
FT                   /translation="MTAMLSGAEMVVQSLIEENVEQIFGYPGGSVLDIYDALHAKTEQI
FT                   KHVLVRHEQAATHMADGYARATGKPGVVLVCSGPGATNTITGIATAYMDSIPMIVISGN
FT                   VPNSLIGNDAFQECDIVGVSRPVVKHSFLVKRAEDIPETIKKAFYIATTGRPGPVVIDL
FT                   PKDVMNPLIKLPYEYPKSISMRSYKPTTSGHKGQIKKALKALLEAKKPVLYIGGGAIIS
FT                   GAHESILKLAETLNLPVVSTLMGLGAFPGTHKNALGMLGMHGKYEANMAMHNADLIFGV
FT                   GVRFDDRTTNNLEKYCPNAKIMHIDIDPSSISKNVKVDLPIVGSAEQVLETMVTLLEEQ
FT                   GAENDTQALASWWDEIEGWKARDCLAYDTSSERIKPQQVIETLHKLTNGDAYVASDVGQ
FT                   HQMFAALYYPFNKPRRWINSGGLGTMGFGLPAGMGVKFAMPEEEVVVVTGDGSIQMNIQ
FT                   ELSTAMQYDIPVKIINLNNRFLGMVKQWQDIIYQGRHSNSYMSSVPDFAAIAEAYGHVG
FT                   IRIETPDQLESELKRALDMKDRLVFVDINVDETEHVYPMQIKGEGMDKMWLSKTERT"
FT   CDS_pept        482536..483030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0496"
FT                   /product="acetolactate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93260"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93260"
FT                   /db_xref="GOA:Q7MP68"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP68"
FT                   /protein_id="BAC93260.1"
FT                   /translation="MRHIISLLMENQPGALSRVVGLFSQRGYNIESLTVSPTDDETLSR
FT                   LNITTMTDEMQLEQIQKQLHKLIDVLKVQEVTEFDHIERELMMVKVKASGFARAEVKRT
FT                   ADIFRGQIVDVTASQYTVQLAGTSEKLDAFIQAISEVTEVIEVARSGVVGIARGERALK
FT                   A"
FT   CDS_pept        483183..485063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0497"
FT                   /product="GGDEF family protein"
FT                   /note="with 2 transmembrane domains"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93261"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93261"
FT                   /db_xref="GOA:Q7MP67"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP67"
FT                   /protein_id="BAC93261.1"
FT                   /translation="MKIRKLLGILILTSAFFAALIAIYYQDKYQDLLNANIENTAKEAL
FT                   NQLSYTEREYNNLYDQVASVLQLLTYNQTLTDFVVDPNPQSERALMSLWESVVVNQKWY
FT                   TEIRLLDTEGMEQLRLNYDVSRNYFFPAAKMQNDANEAYFVYAKTLENSEIGAWGITLD
FT                   TRDEQLIKPYVPVISIFTPVTIRGERKGYLALNLNVDYIADRLNYSPVKDFDIEIVNDR
FT                   GYFVISEEEEKQFGDLLPERAAFRFSDQYPQAWLQFRHQKAGYSYDEQDLVVHNSVSFG
FT                   QDRDLYLLIDMDQQQLMERSKIAVNDLTREALFVLCLILVVALPSLTIVLHYRQRNLES
FT                   KLARAALNGMTAVMISDTSHRIILVNHEFEVMFGHQGDKIEGKSAQQLIFLNDELETVI
FT                   KAWSELQKNEVWEGEIRCQTKLNHIITVIMRIQAVKNSLNQVSYYITSLVDISARKELE
FT                   ERLRNLSERDELTQIWNRRKFEQQLAQHTSLIERYPATPMACLALVDIDYFKRVNDEQG
FT                   HDEGDRVIREVAKILQNGLRNTDVLARVGGEEFAIIMPHTTVSAAEVVLNRLRVAVSIS
FT                   KQVDVTISVGYTELTSNSTLSYKCADIALYDSKSSGRNKVSLCYNDEDLA"
FT   CDS_pept        485309..485440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93262"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93262"
FT                   /db_xref="GOA:Q7MP66"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP66"
FT                   /protein_id="BAC93262.1"
FT                   /translation="MLNHFLVRLTIGTLVVLGFKLSAIYFLLLILLLNTHHKEFFGW"
FT   CDS_pept        complement(485544..486206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0499"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93263"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93263"
FT                   /db_xref="GOA:Q7MP65"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP65"
FT                   /protein_id="BAC93263.1"
FT                   /translation="MSSPTLTDKVSKMICQDILHGELKPGQKLVVADLKDKYNVGASPI
FT                   REALVQLSWSKYVKLEPQKGCWVAPVCENELRDLYESLRVVAPVLLKKAIACGNENWEL
FT                   EVLTAYHKLSRAQNLDTTPDWTEWEERHNHFHTTLLAGAEARNMFDFFRDLANQIKRYR
FT                   YFALSQHQGNKHSLFDIEEHEMIMKLALAKNSEEAARLLDSHLDSSMKMIESAIQAA"
FT   CDS_pept        complement(486374..487861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0500"
FT                   /product="pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93264"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93264"
FT                   /db_xref="GOA:Q7MP64"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP64"
FT                   /protein_id="BAC93264.1"
FT                   /translation="MGHVKALGYKHRLSNCNYIDRRVSSMKKTKIVCTIGPKTESVEKL
FT                   TELVNSGMNVMRLNFSHGDYVEHGTRIANFRQVMENTGKQLAILLDTKGPEIRTIKLEN
FT                   GDDVDLVAGQEFTFTTDTSVVGNKDIVAVTYPGFAADLSAGNTILVDDGLIEMEVIATT
FT                   ATEVKCKVLNNGALGENKGVNLPGVSVNLPALSEKDKNDLKFGCEQGVDFVAASFIRKA
FT                   SDVKEIREVLAANGGANIQIISKIENQEGVDNFDEILELSDGIMVARGDLGVEIPAEEV
FT                   IFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAIMDGTDAVMLSGET
FT                   AKGKYPVEAVTIMAQIANRTDSVLKAELGSRLDSPRLRITEAVCKGAVDTAEKLAAPLI
FT                   IVATEGGKSARSVRKYFPTANILALTTNKKTAAQLVLTKGVTPVVVDSIDNTDAFYVAG
FT                   KELALESGLGSKGDIVVMVSGALVASGTTNTASVHVL"
FT   CDS_pept        488217..488978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0501"
FT                   /product="transcriptional regulator of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93265"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93265"
FT                   /db_xref="GOA:Q7MP63"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP63"
FT                   /protein_id="BAC93265.1"
FT                   /translation="MSKRNTQLRRHSISKLVNEKGEVSVDELAHKFDTSEVTIRKDLAS
FT                   LEKNGQLLRRYGGAIAIPKEVIHEEMSQNISDRKLKLAEKAAELIRDHNRIVIDSGSTT
FT                   GALIQQLNSKRGLVVMTNSLHVANALNELESEPTLLMTGGTWDNHSESFQGKVAESVLR
FT                   SYDFDQLFIGADGVDLTRGTTTFNELVGLSKVMAEVSREVIVMVESDKVGRKIPNLELA
FT                   WEMIDILITNNDLLPEHKAEMEANGVRVICA"
FT   CDS_pept        489047..490879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0502"
FT                   /product="glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93266"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93266"
FT                   /db_xref="GOA:Q7MP62"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP62"
FT                   /protein_id="BAC93266.1"
FT                   /translation="MCGIVGAVAQRDVAEILVEGLRRLEYRGYDSAGVAVVDSQSNLTR
FT                   IRRLGKVQELADAVDQAEVVGGTGIAHTRWATHGEPSEINAHPHQSGDISVVHNGIIEN
FT                   HETLRELLQSRGYVFESQTDTEVIAHLVEWELRTAASLLEAVQKTVKQLEGAYGTVVLD
FT                   RNDPSRIVVARSGSPIVIGFGVGENFLASDQLALLNVTRRFMYLEEGDVAEITRREVAV
FT                   YDALGERVEREIAESNAEHDAGDKGQYRHFMQKEIYEQPTALINTMEGRITADSVVTEA
FT                   IGVNAAEILSKVEHVQIVACGTSYNAGMTARYWFEDIAGVSCDVEIASEFRYRKFVTRP
FT                   NSLLITLSQSGETADTLAALRLAKEKGYMAAMTICNVAGSSLVRESDFAFMTRAGVEIG
FT                   VASTKAFTTQLAALLMLVTALGKQQGRISKEKEKEIVEALHALPKQINAALSFEKDIEA
FT                   LATDFADKHHTLFLGRGEFYPIAMEASLKLKEISYIHAEAYAAGELKHGPLALIDADMP
FT                   VVVVAPSNDLLEKLKSNVEEVRARGGLLYVFADADAGFEGDETMKIITMPHVSEITAAI
FT                   YYTIPMQLLSYYVALIKGTDVDQPRNLAKAVTVE"
FT   CDS_pept        complement(490982..491524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0503"
FT                   /product="mannitol operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93267"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93267"
FT                   /db_xref="InterPro:IPR007761"
FT                   /db_xref="InterPro:IPR038026"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP61"
FT                   /protein_id="BAC93267.1"
FT                   /translation="MIQFMAEHTNESDIIERLNHAPSVRGFFVETVDILTEAVDGLVQR
FT                   IFRKDNFAVQSVVGPLLQDSGPLGDVSVRLKLLFGLGVLSDHHYHDIEDIIKLKNKLNS
FT                   DSTEYEFTDPQILEPIKKLHLVQKMGMVQLEVDDPDDDIELSFYQLQLQRKQQIIRSGL
FT                   SLAIVEICHELGKDSPF"
FT   CDS_pept        complement(491568..492716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0504"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93268"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93268"
FT                   /db_xref="GOA:Q7MP60"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP60"
FT                   /protein_id="BAC93268.1"
FT                   /translation="MKNAVHFGAGNIGRGFIGKLLADANVSVTFADVDAPLVDQLSHRQ
FT                   EYKVKVVGSECQIDTVTHVTAVNSASEEVIDRIVQTDLVTTAVGPNVLDIIAKTIAQGI
FT                   AKRFAAGNLAPLNIIACENMVRGTTHLKGEVYKHLDASLHAQVDELVGFVDSAVDRIVP
FT                   PAEAANDDPLEVTVESFSEWIVDEQQFKGEVPSIAGMEKTHNLMAFVERKLFTLNTGHC
FT                   ITAYLGCLQGHRTIREAIENPAICDQVKQAMMESGEVLIRRYGFDREMHQAYIEKILAR
FT                   FANPFLVDEVDRVGRQPIRKLGMNDRLIKPLLGTIEFGTANQHLLKGIAAALKYQNDSD
FT                   PQAVELQRSLQQVGVKKTLAKYTSLAEDSVEVAKIETLYNQL"
FT   CDS_pept        complement(492822..494825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0505"
FT                   /product="PTS system, mannitol-specific IIABC component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93269"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93269"
FT                   /db_xref="GOA:Q7MP59"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP59"
FT                   /protein_id="BAC93269.1"
FT                   /translation="MANRYYNIHQNIKRGILMISPDAKIKIQNFGRFLSNMVMPNIGAF
FT                   IAWGFITALFIPTGWLPNETLAAMVGPMITYLLPLLIGYTGGKLVGGDRGAVVGAITTM
FT                   GVIVGTDIPMFMGAMMVGPMGGWAIKRFDNYIDGKVKSGFEMLVNNFSAGIIGMLCAIL
FT                   AFFFIGPFVKVLSGGLAAGVNFLVSAHLLPLTSVFVEPAKILFLNNAINHGIFSPLGIQ
FT                   QASEAGQSIFFLIEANPGPGLGILLAYMVFGKGTARQTAGGASIIHFFGGIHEIYFPYI
FT                   LMNPRLILAAIAGGMTGVFVLTVFNAGIVSPASPGSIFAILLMTQKASILGVLASIASA
FT                   TGVSFAVAALLMKTQTSTEEEGNEAALEKATSQMKNMKSASKGRANVTNQNKSDVDLAT
FT                   VHSIIVACDAGMGSSAMGASMLRKKIQDAGLNIHVTNLAINSLPESADIVITHKDLTDR
FT                   ARKHAPNAYHISLTNFLDSEMYNQLVTKLFAAQQLSAANDDNVVKVSVLAANDDTFEAQ
FT                   PPSVFQIQRENIHLGLKANSKEEAIRFAGNKLVELGYAEPEYIEAMFEREALVPTYLGE
FT                   SIAVPHGTVEAKDRVKKTGIVICQYPSGIQFTDDKDDVAKLVIGIAAKNDEHIQVITTI
FT                   TSALDEPEAIERLTSTDDIEEILDILGGKQAA"
FT   CDS_pept        complement(495253..496335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0507"
FT                   /product="extracellular solute-binding protein, family 7"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93270"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93270"
FT                   /db_xref="GOA:Q7MP58"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP58"
FT                   /protein_id="BAC93270.1"
FT                   /translation="MPTIKPNRSFLKRAIIASTALLSFSLFAAEEVHRLKLAETWGPNT
FT                   PILGDASKNMAKLAEEMSNGRLQIRIDSANKHKAPLGVFDMVKSGQYDLGHSSSYYWKG
FT                   KVPNTLYFSSMPFGMITTEQYAWFYYGGGMELMQKVYAPHNLLSFPGGNSDIQMGGWFK
FT                   KEINSVEDLKGLKMRIPGFAGEVLARVGAKPTNIAPGELYTSLERGTIDALEWVGPAFD
FT                   LRMGFHKIAPYYYTAWHEPGSETQFLVNKKTWERLPKDLQVILETAFRVAAFDMYNQAI
FT                   DANANSWATMQSEYPDIKVRDFPPVVLQAMRQATNELLEEEAAKDPLAKEIITSQENYL
FT                   KKVRAWTAISSKAYLDTNPQ"
FT   CDS_pept        496322..496480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0506"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93271"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93271"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP57"
FT                   /protein_id="BAC93271.1"
FT                   /translation="MIVGMTSSFVLLFANRFKLDDFFVNRIKNSLMDCDKTNICHIEQN
FT                   MHIASVI"
FT   CDS_pept        complement(496598..498355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0508"
FT                   /product="putative hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93272"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93272"
FT                   /db_xref="GOA:Q7MP56"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP56"
FT                   /protein_id="BAC93272.1"
FT                   /translation="MAINSPFRLPRKTPFGIGENVAEWMTGLSKLDKFYAQRPPHCDTQ
FT                   TFLRYTLEVLGIDYQIVKGSLANVPQIGPTVVVANHPLGCVEGVILAELLLMMREDVQI
FT                   LANQYLKTVPELDTLFIGVDVFDSQQAAKSNMKALRDANKHLAQGGLLLVFPAGEVSQL
FT                   VDRKQKRLEDKEWSRSVSALIRRHKAHALPVFIDGQNSQRFYLAGKIHPLLRTLMLGRE
FT                   LLNKKQQAIPIAIGQPIKFKEVQHLTDEQLVSYLRLNTYLLSAEPPLHPPMDHDTNPPL
FT                   APITEPLDKQKWLLDLAMLPEDALLLRQGNFSVYCTTAKYIPSILHEIGRQREINFRAV
FT                   GEGTGYAIDIDRFDHHYHHLFVWDDENQHLVGAYRLGLVDKLLEKSGLDGLYSRTLFDY
FT                   DAPFLTQLGQSIEMGRSVITSPYQRSMNALLLLWKGIATFVSQHPQYTHLFGPVSISND
FT                   YSPTARQLLAQSMTLHHYDAASAELVKPLNPIPDHHPKWNTSMLTALGDLQLLSRVISR
FT                   IDEGKGVPVLLRQYLGLNGKLVCFNVDPAFNNALDGMIVVDLRDVPEKTLGKYMTPAKA
FT                   RHYLSLHQA"
FT   CDS_pept        498755..499471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93273"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93273"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="InterPro:IPR016907"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP55"
FT                   /protein_id="BAC93273.1"
FT                   /translation="MREMTTKAALILGVSLIVGLGVLGYLVQQTAIQYKALDRIVTVKG
FT                   LSEREYPADTVIWPIRFTVASNDIQDLFTKVDTQSTLITDFLNKRELSDSVQWSAPAVI
FT                   DKKAQQYGGEANAEYRYLAIQTITVYSNKVDSVRQAISLIGQLGKKGIVFNQDSYDSPI
FT                   VYSFTRLNEIKPEMIEEATHNAREVAEKFAKDSNSSLGKIRTASQGQFSIMDRDHNTPH
FT                   IKRIRVVSTVQYYLSD"
FT   CDS_pept        complement(499898..500749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0510"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93274"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93274"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP54"
FT                   /protein_id="BAC93274.1"
FT                   /translation="MENYSMFNNEASQNNLKETAVSQHPLHNFINPFDRQNEFLVLTDS
FT                   QKTDGRFTRRQHTPSSLIQLNSWADFQPMTKPFEPNSEIYVLPSHPLSESTRQTHFMGA
FT                   SLVEYDNIYQYIEKKAQELGFRQQRTQNLIIVTMLLAKNFDLMIGGVPIGGKWIADKLG
FT                   TNTYKVSDRLKDLEDMNLIRRCSRLSKKDKTKLTGFIELTPFFLLSFTSFFSNKDHINY
FT                   EQYLASKAATQKGELSYQIYGEKGHFEYKDIIYTLKVRLLELTRNPTVCDQVKVAAYKA
FT                   LL"
FT   CDS_pept        501249..501929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93275"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93275"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP53"
FT                   /protein_id="BAC93275.1"
FT                   /translation="MNVRSRKNKNLRLTTKKTFLGRPIQTEHGPLYLDYLEKMHNTIDI
FT                   ALDEYPRLMAIRVDLRFPKLRKNEMSGNVMTDFLRSLQSQIDHSGKRKKREGSVRVHPC
FT                   KVRIAWVRERSSSINDHYHLVLMFNKDRFNWLGKTQTQQENLGSFIVEAWARVAGVDYE
FT                   EANGLVHFSKRKNSDSVVIHRLNCNSDAFDDAFDEFFKHISYLAKENTKHFGSGRRNFG
FT                   HSHK"
FT   repeat_region   501815..501838
FT                   /gene="rpt1T12"
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="TGATGCGTTTGA"
FT                   /note="2 units of 12 bp in-tandem repeat"
FT   CDS_pept        501990..502658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93276"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93276"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP52"
FT                   /protein_id="BAC93276.1"
FT                   /translation="MTHQLNVAHQRAHTITHDRTFNGKPLYYFEDGLVLEYLEEIDRVL
FT                   TEALNKYPRIYAVHINLNLPSDFGGDYLTVFAHFFRILESETNELCKDKYTDRTYRYQQ
FT                   TVIRYIWTKASESTSDHHHLILLFDRDLFQNLGTGREGWGRFLYKKVRKAWDSVVEAYY
FT                   RQPCSGLGYSPTNEGFELLSDAEVFPLQLNEFFYRISRLAKPITNLNDHRNKSFGCSHD
FT                   "
FT   CDS_pept        complement(502236..502391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0513"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93277"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93277"
FT                   /db_xref="GOA:Q7MP51"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP51"
FT                   /protein_id="BAC93277.1"
FT                   /translation="MKEIPIKEQDKMMVIAGGLTRLRPDIANNRLLVSISSIGVFVLTE
FT                   LISLRF"
FT   CDS_pept        502683..503318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93278"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93278"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP50"
FT                   /protein_id="BAC93278.1"
FT                   /translation="MPMSFTHKKALLMANRTYLPSITLDRTFEDYPLYYSDKGLYESAL
FT                   TSMVDVFEQALSQFDIALATRLDLFLPEDHQDTDLSILNDYFNLLKEKLDTDSLFYVWR
FT                   KREDKVPSHNYRVMLFSDYSQHFGPAICWDKRNELVGHLKTAWQEAIEKHYSGEARSLV
FT                   FLNDRGNYGVGTRCRSKDVNIKNTVFHRMSSLAEAWEEKRYCFGSSLE"
FT   CDS_pept        503386..503592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0515"
FT                   /product="predicted transcriptional regulator"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93279"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93279"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP49"
FT                   /protein_id="BAC93279.1"
FT                   /translation="MKMKFLRLKDVMSLTGLGRSTIYKFMADETDFPKSVPLGGRAVAW
FT                   VESEIEEWMEQRLALRDNPESFQ"
FT   CDS_pept        503675..504112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0516"
FT                   /product="ribonuclease HI"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93280"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93280"
FT                   /db_xref="GOA:Q7MP48"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP48"
FT                   /protein_id="BAC93280.1"
FT                   /translation="MSYSIYVDGAAPNNQHGCTRGGIGLVVMDEDNEIVHEESFTINRK
FT                   TDNAELELLALIEALEYAEDGDVIYSDSDYCVKGFNIWMDDWKDRCWRRADKKPVKNRH
FT                   LWQQVDELSSRKYVEVEKVKAHSGVEGNERADLLAVEAAAL"
FT   CDS_pept        504132..505373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0517"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93281"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93281"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP47"
FT                   /protein_id="BAC93281.1"
FT                   /translation="MGCTPQAVILIYHYYCWLREFLLTFQYCPRNELSLMLNEKFRMPV
FT                   IKLGNPFLPSPDEVSAFLGLPVSPREKIKWLNASVVKSKLPTDRTLDNISKEGIRWKSI
FT                   RQFAWQLARVFVRKGWSLNVSLPDGGIHKSDLSFWWSHTLKGVQQGLSSTSGELNLGLL
FT                   VSYIDKRCVAYQRQLAFIQDAPDINENNQHELISGYYLPVLDFTLLSEQEKALVKNWLK
FT                   SPSELASKETEQAMLCFCYDFWLSLMSVIDVMFLEDWDKHYAEYTPSVHAQQYGLFGQV
FT                   FNREERTFLGKFFGLIKEQTNQTYAQLSEYVVLPVSEYERNGLLKRDVQQARFKEWRSG
FT                   KSLPSVEALSTFFANMDAGRQGADLLIYALFMRALDKVGSRSLPDIYTKVGSRSLPDIY
FT                   TTSRYQRYFQHYAP"
FT   repeat_region   505260..505331
FT                   /gene="rpt1T13"
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="AAGGTGGGTAGTCGCTCTCTACCTGATATCTACACG"
FT                   /note="2 units of 36 bp in-tandem repeat"
FT   CDS_pept        complement(505824..506051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93282"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93282"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP46"
FT                   /protein_id="BAC93282.1"
FT                   /translation="MNKSTLLIATALVFSTSSAFAGGTLGGNPSADSGAVNVSVGKCTQ
FT                   YKMDVKAAQDAGKEASTITVPKGCEAIKEK"
FT   CDS_pept        complement(506099..506458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93283"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93283"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP45"
FT                   /protein_id="BAC93283.1"
FT                   /translation="MNTLIRTIMMALLLFSITACSEQDAAQTVTADVEVSISTNPHWGT
FT                   LVFDIQAITDSTVITGVVINRGNCRLPAGTTSELSRNVQLKFGETYTGYSNNCTVDSVK
FT                   EIEVTSSVGTFVYTF"
FT   CDS_pept        complement(506482..506811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93284"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93284"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP44"
FT                   /protein_id="BAC93284.1"
FT                   /translation="MALPTIREWSDEQRQVLNAVHTALLHNRMLKISSQVLQQEKALIE
FT                   PLGLSVQCDALLLLFRLSGQHTIRTLALPLIDEASVSTFSFTYPTDFNVERFMREHAEI
FT                   RASQI"
FT   CDS_pept        complement(506915..507223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93285"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93285"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP43"
FT                   /protein_id="BAC93285.1"
FT                   /translation="MSNKTSIEGLSALLHTLMLIPQHRWITVRELQQQLALLDIHRTTR
FT                   SIKRYLDDIIVDVFNVECDSMSMPHVYRKTSEQLLKLNKQEMALLATDQQVLTTAGS"
FT   CDS_pept        complement(507362..507538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93286"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93286"
FT                   /db_xref="GOA:Q7MP42"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP42"
FT                   /protein_id="BAC93286.1"
FT                   /translation="MTSLLLQTIKLVTALITLFSLSPFFGAIGALSTLGFLVVLLIGLL
FT                   AAIAELSDKHKPR"
FT   CDS_pept        complement(507542..507985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93287"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93287"
FT                   /db_xref="InterPro:IPR021248"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP41"
FT                   /protein_id="BAC93287.1"
FT                   /translation="MSKLNFTASSLPVSKKLHKLLSEQFTAHLLINEALTTSRYLVFNF
FT                   RDKSYSAEEGGFHPVEMAICQTSTGEWSIEYITDFAYMGNYYPELERNLDFDFRIGQFF
FT                   VAYRGWLPMQGSRDAKELYRLWENNFLAYVDMDAYNEIAITPQ"
FT   CDS_pept        complement(508037..508480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93288"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93288"
FT                   /db_xref="InterPro:IPR021248"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP40"
FT                   /protein_id="BAC93288.1"
FT                   /translation="MVMIEQHYGELSIDDALHTSLEALLNRYTLPENAERLVLNCRQMS
FT                   YYRHRQGLHPIEVQFKRESASSTWLVVFFASFSYPDDNSTTVEPELYFHLANRWCYQPD
FT                   VGSTDLSHPEVQELLSVWMKAFARHLSRNVFDDVQLTMVGTFH"
FT   CDS_pept        complement(508471..508944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0525"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93289"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93289"
FT                   /db_xref="GOA:Q7MP39"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP39"
FT                   /protein_id="BAC93289.1"
FT                   /translation="MNPKTSDYQKQQRYQENEILEHAAEILATRYVRGDALTNPDATKE
FT                   YVRCKLGSHEREVFALLLLDNQNRLIEFKELFQGTVDAASVYPREVVKAVLEVNAAAVI
FT                   FAHNHPSGDSTPSQADRRITERLKDALALVDVRVLDHIVTGNTCTSFAERGWL"
FT   CDS_pept        complement(509345..510262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0526"
FT                   /product="transcriptional regulator of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93290"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93290"
FT                   /db_xref="GOA:Q7MP38"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP38"
FT                   /protein_id="BAC93290.1"
FT                   /translation="MSRVKLQRRMVTKSKKPSAVKGRKWRNMVTKQLERLRRIEACLKH
FT                   SDKIHLKEIARLLEVSEMTVRRDLSSNAAHSFPLEYYGGYIRRGDPIIHDEVTEDLEQM
FT                   PSEVSSQATPPQKARNTTVFPPVKVNNYISAIVSDFIEMNDVVYFDNGVLNADIIGSIP
FT                   DHVKFTGVTASMNVFLALKNKPNCKAILQGGDYNAVHDIFVSTSNDVLTPMIFQKVFIS
FT                   SAGVHDRFGVTASDMLVANIANLVMERSMKKYLIVEKKTINQTATYKIGNLLNFHYLIS
FT                   DDALPHKLEAACNEARLQVLTPTG"
FT   CDS_pept        complement(510225..510884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0527"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93291"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93291"
FT                   /db_xref="GOA:Q7MP37"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP37"
FT                   /protein_id="BAC93291.1"
FT                   /translation="MNHYIDHTLLLANATTKQINTLCDEAHEHQFFSVCINPDFVEHCA
FT                   ERLNTSNVKICTVIGFPLGANTTAVKVFETQNAISLGADEIDMVVNISDVLDGKWDVIE
FT                   KEIVAIKEACGPKLLKVIFETCLLTNEQIVKLCNISKRAGADFVKTSTGFSTGGATVEH
FT                   IKLMRDTVGKQMGVKASGGVRTKETAQAMIDAGASRVGASASVSIVTGEAPTTNGY"
FT   CDS_pept        511102..512031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0528"
FT                   /product="sugar kinase"
FT                   /note="ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93292"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93292"
FT                   /db_xref="GOA:Q7MP36"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP36"
FT                   /protein_id="BAC93292.1"
FT                   /translation="MKTIAVIGSNMVDLISYTDRMPKEGETLEAPSFKMGCGGKGANQA
FT                   VAAAKMGADVVMVSKVGDDMFADNTIRNFQSYGINTQYVSKVPQTSSGVAPIFVNSTSQ
FT                   NSILIIKGANEFLKPDDIDKAESTLVECSLIVLQLEVPLETVYAAIEFGNKHSIPVLLN
FT                   PAPAVPELDIEYACRCDFFVPNETELEILVNKPVETVEQIKEAATILLNKGLNNIIVTM
FT                   GSKGALWLSKDGKDVFIEPTKVNAVDTSGAGDAFIGCFSHYFMQTGDVQKSLEKASLFA
FT                   AFSVTEKGTQFSYPSIEQFEEFETKHSK"
FT   CDS_pept        512115..513443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0529"
FT                   /product="fucose permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93293"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93293"
FT                   /db_xref="GOA:Q7MP35"
FT                   /db_xref="InterPro:IPR005275"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP35"
FT                   /protein_id="BAC93293.1"
FT                   /translation="MIKNNTIQGSDGYLDKTPVFQFILLSCLFPLWGCAAALNDILITQ
FT                   FKSVFELSNFASALVQSAFYGGYFLIAIPASLVIKKSSYKMAIMIGLSLYIFGCAAFFP
FT                   ASHMATYTMFLAAIFAIAVGLSFLETAANTYSSMLGPKSHATLRLNISQTFYPIGAIAG
FT                   ILLGKYLIFQDGASLESQMATMSPDQIHAFRLEMLEYTLKPYKYIIFILIGVLALFMFT
FT                   QYPKCKVAQQSGKKAPSIGKTLKYLSTNNRFKKGIIAQFLYVGMQVAVWSFTIRLALEM
FT                   SDINERAASNYMVYSFVCFFIGKFIANILMTKFSAEKVLIVYSLIGMAFLAYVSLVHDF
FT                   SAVYVAVGVSVLFGPCWATIYAGTLDTVDNEYTETAGAVIVMAIVGAAVVPAIQGLVAD
FT                   AIGMQLSFLVNFICFGYVGYYFLGEMKNKNQSEKQTQLAEQTN"
FT   CDS_pept        513467..514510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0530"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93294"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93294"
FT                   /db_xref="GOA:Q7MP34"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP34"
FT                   /protein_id="BAC93294.1"
FT                   /translation="MAFLFRRRFMYIIPLNKAQFNQQETILIQSEDFKVSAFKYNSGVE
FT                   GLKIENAKGYLTILPYMGQMIWDAKFLGEDICMENMFSEPKPSNEIVATYGCFAFHSGM
FT                   IRNGCPSPEDDHPLHGEMPCANMDKVWLEVDEYQITLKGEYEYVMGFGDHYLATPSVSI
FT                   EKGASMFEIKMKVQNLASVPMPLQYMCHMNTAYFPEAKMTQNIPDSAVKLRKSIPGHVK
FT                   PTQQWLDFNDTLKAQSAPIHQLSAPDMYDPEIVYFMDNLSQHTDNAEFEMTIPNGKTLI
FT                   TRFDTTEFNYATRWILYNGDQKVGAYVLPATCRPEGYLAAEKNGTLIQLQPKEVREFTV
FT                   KTGIIEK"
FT   CDS_pept        514731..515789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0531"
FT                   /product="transposase"
FT                   /note="IS5 family"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93295"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93295"
FT                   /db_xref="GOA:Q7MP33"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP33"
FT                   /protein_id="BAC93295.1"
FT                   /translation="MHEDKELFDKLNLSVYEIVFYRALVENEASVHELGYHALRNLAIE
FT                   LTVQLRNSATLDWQKRDSVRARMRNLVCRLLRRRPYPLETMFRIHCMQQWYSLGDEATE
FT                   DALYEIASMRQFARLSLDKAIPDRTSIMNFRHMLEKHKLTRKSFKTVNQWLSDCGVMMT
FT                   QGTLVDATIIEAPSSTKNKNNERDPDMHQTRKGNEWYFGMKAHIGVDANSGLTHTLVTT
FT                   AANEHDLNQLNKLLHGEEEFVSGDAGYQGAEKREELEDADVEWLIAERPSKVRALKKHP
FT                   RKNKTAIRIEYLKASIRAKVEHPFRIIKCQFGFIKTRYKGLMKNDSQLAMLFALANLFK
FT                   VDQMLRRQPRSV"
FT   CDS_pept        complement(516058..518760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0532"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93296"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93296"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP32"
FT                   /protein_id="BAC93296.1"
FT                   /translation="MNIVRCFLAVSISLSLMACGNESSDKPDALPQIPPPPAGGYEPDF
FT                   SDFETVANIDLGELKELTGQALIDGLEKQLNDSLLTRSSTAQFEIIPQWGYDTNLRVVD
FT                   VNGYYALETTLAAGKVGKPSASELNGFSFKISLPNGVVKQATLSYQLSLAKPLGFGETA
FT                   KSPDYIYLPGLTSGAPEVQNNKPTAAGTGFTYKFSTDRYGYLNAKYADPTNGDLTNAQL
FT                   QYAEKGIKPTQGQWDLIQQNITVNDFNQDTAQANGSVTTYFNREVVAPKSGSTTDRILV
FT                   DDTHPYNLQALVEVYRYYKHGADDISAVQEQKVRIKNLSFAWNNDEVALPPPVDDKPDL
FT                   AGYPNIKAIDLEPLAGMQGSDLVAGIEQQLNKNLPEGTTGTFKVIPKWGFDGASNWDSE
FT                   NLTVEMIQGQYVLQTTIAAQAVGQPADGKEAIRNGFSFLIELPNGKVKEATMSYLYRLS
FT                   TPLGNGDPSKSPDYIFLPGFTSGDPLVANSASQPGEGFTYKLNTDRYGKLSTRFTDATD
FT                   NKFYNSVLQQNGADIRIDANLWHLVQQKLQTNDFVGSASTADGSLDMIYKTGVMTAKAG
FT                   AVTARTQVDAHHDYKLAALMEIYRHWKHSADKESDLKEQVVQIKNITFAWKNDDINEPT
FT                   TPPAANYCSTKGFTQSRALDLASINGLTGQDLLDKIGQQLGDLPAGTLTFGNSRDNIRV
FT                   VENAGELALEVTYAAAETGQMATANGTDFAVPFPTGNSKLRGACFAYDLNVAIATNENK
FT                   DVILLPSILLNSGNTLLSDHRYATNKYKRFSAKFVNPPHADLSWLDYSGNNYVNANTWY
FT                   KMNQHLQFGDNGSGTLDFQMNDVTYFKPNAGKFDGEAFENVNHQLVDASDVDHVQFTAN
FT                   FDTYRHDAGGTNIQTIQYKNIAIGWNTTK"
FT   CDS_pept        complement(518760..521150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93297"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93297"
FT                   /db_xref="GOA:Q7MP31"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR012970"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR038970"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP31"
FT                   /protein_id="BAC93297.1"
FT                   /translation="MVRQSLLALTITSALLGCNSDSAGTSSDVTAPDSKFTEVRAHWAA
FT                   NYIGDASLPFDDQLTQATANISRNAAQWMQQFQSSRTNVNAGLWLDLPLATATEQDKKQ
FT                   LGDQLYKSYQRLFTMAQAYQLPKSDLYQSVELLDVITEGLAILNQHFYKVGVEEWGNWW
FT                   HWQLGISRVANNILVLMYQELPASLVTNYIDAIEYFVPNPTHLSEGAGASASSMPRPFE
FT                   STGANRVQNVQVVLVRALLANDQDAFQTAVDALEPVITFVESGDGFYSDGSFIQHTDIP
FT                   YNGSYGNELLEGLGLLLGTIASAPWNEQTEQYSAIYSLLLEAYAPFLVDGRMMDMVNGR
FT                   AVSRLSGQNHKIGHAVLNSMLFFIESAPSNVKKQLQSVIKTNIENDTFLDFYANPRFFR
FT                   NQQLARQLADDTTVNMLTDRRQHKQFPAMDRIVHHRPDWSFAIAMHSNRVGNYECINGE
FT                   NLKGWYSADGVTYLYNQQLDHYTNYWPVVDPYHLAGTTTIDSSRENCSGQLRGDGKRQD
FT                   QIQWSGGTSLDQYGIAGFDFTNWDDTLSAKKSWFMFDEQIVALGSNVTNPAALTNLENR
FT                   KIIASAQVKANGISVEPAASFEGDLERLDITVDGQNNPISYLLLKPQTATVTKACRSGN
FT                   YNTIGTNNAAVNACFTQAELKHDSSDQYQYVLFPNSTKSVVDREAIAPSIHVLSNSENV
FT                   HAVEHTQLKLVGLNFWQPGQAGAVEAFSPMSMLYRTNSDKSLTVSISNPTRSSLSVKFK
FT                   FDDTYITKGDLENRITTNNDGSFTIDLTDLQGRSYQFALIKEQ"
FT   CDS_pept        complement(521150..523570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93298"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93298"
FT                   /db_xref="GOA:Q7MP30"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR012970"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR038970"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP30"
FT                   /protein_id="BAC93298.1"
FT                   /translation="MKTTSLSALIAVIGCTGLHAEPVFANTTTDVDAAPLRVSTQDYYS
FT                   IVRHRWASYFLGDQTMAFDQQLTNEITKINHQAKQWLDQLTIDENGLWADLPLQTDNAE
FT                   QKRKLGIQLYATYQRIFTLARAYKLPGGELENDPQLLAMLVESLAFLHDNFYHVGTAEW
FT                   GNWWHWQLGIGRVANNTLVVLYDELPQEIISNYVDASRYFVPRPTHLSEGYGAPYSSAP
FT                   LMFESTGGNRTDNAQVVLIRGILDNNENEIKSAVESLSSIIPFVTEGDGFYQDGSFIQH
FT                   KDLPYSGTYGQVMVEGLGMLMGLVANTPWQANDPNLQKIYPLLLEAFAPLLVDGKMMDM
FT                   VNGRAISRISGQNQKVGQAMLSSMLLYLPGAPENYKQQLGEFLKSQLQRSENGIAQPTI
FT                   FSSYQLAQQLLTDNQIKPQAPRSTHTQFAEMDRIVHHRPTWSFGIAMHSDRVGNYECIN
FT                   GENLKGWHTADGMGYLYNQGSAHYNNYWPLVDSFKLPGTTTLQVERSLCSGQLSAQRDG
FT                   RQGSMDWTGGASLEQYGIAGMQFVSWNQDLEAKKSWFMFDDEIVALGADIRNKSANDAV
FT                   TTLENRKIPENSKVTFNGKLLADNRSVEQPLTSLSIEFDSSKPSVQYLSLDEQPIKVSK
FT                   VCRQGNWADIGTNKGELTGCFIEATLQHSAETNGSYAYAIVPSLSNNFDSAKQLPIDVV
FT                   ANNSQVQAVAHNRLGLFAANFWDDSQAGIITADNSMSIILKSTENSIAVSVSDPSRSWW
FT                   DRDFSLEGQYKIVVDSENRVSLKDSRHFSVDLSGLDGSSYSFQIQKIHSGEAK"
FT   CDS_pept        complement(523603..524544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0535"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93299"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93299"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP29"
FT                   /protein_id="BAC93299.1"
FT                   /translation="MKNTTRLAALLSASATILCSPALARTWVEVGTEYEQYFDETDQGA
FT                   TYNYERLNAYTPYVRFSHSPTNNEWNIWGRAFKKYYTNEELFPNGEVNAQVDRLELHYT
FT                   QMNRKGAWRFRPGVGVRYNGYDIDRYETEYRLYPQFDYFFNSNSQAFLSGHWYIGDSKG
FT                   IRMGDTQPQNYTDWGYEAEFGWLYRFANGSSIKPHFYTEYDSYENNFDIDYWQFRLVYS
FT                   QKIGRATINPFIRYGLGRDITDRSHSDPERWGLKRDNNYSRAGVFGNVGISGKWNLIYE
FT                   TYYQVEDQHGTWGEELPDRDKFFAKFGIQRIF"
FT   CDS_pept        525048..525866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0536"
FT                   /product="transcriptional regulator of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93300"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93300"
FT                   /db_xref="GOA:Q7MP28"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP28"
FT                   /protein_id="BAC93300.1"
FT                   /translation="MCVEKARGDAVMKTAIERRLEIANMVGVRGKMHVDELAEYFNVTG
FT                   ATIRADLRFLDENGYIVRSHGFALVNRDVLSKLAMSATSKNQSGSTDFYEYVAHAFYGA
FT                   LEEKSTIFVDSSPLIRKSLKYLKDLKGATVVTRDLNLIQKVPHITDCKFFVTGGRVNTE
FT                   YMKMTGSHMINSLRQYRFNNALIHVESFNTKLGVFSKSEFDADMIRLLCDLSEKITIVV
FT                   ESSAFSNNDSFWTCEPNKIDTVITDYNLDDETKKSLELNNVKILKLNINK"
FT   CDS_pept        525878..526366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0537"
FT                   /product="phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93301"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93301"
FT                   /db_xref="GOA:Q7MP27"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP27"
FT                   /protein_id="BAC93301.1"
FT                   /translation="MANIVLARIDERLIHGQIRLQWGKHSGANTILVANDEIAQMEPLQ
FT                   APFKASAGSDFAVLFRTIEQTIANLPKAGMDRKILLLCKNPTDFARIVQGGIKLPEINI
FT                   GNMHFHEGRVVVNKYINVDKHDMAAFNVLRDHGSVSTIQHMPESNKECIFEMTKDLQI"
FT   CDS_pept        526385..527158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0538"
FT                   /product="phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93302"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93302"
FT                   /db_xref="GOA:Q7MP26"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP26"
FT                   /protein_id="BAC93302.1"
FT                   /translation="MLMEAILVAVWAALCGIDKFDVFTGIHRPLVTGTVVGLILGDLQM
FT                   GLIAGATFELAWLGLVANAGVQPPDTTVGAIVGTMFAIKLDMTPEAAIGMAIPFALAMQ
FT                   TCVLFLFTSCAPMMQKADEYAESLNLKGIDKLIYIGLSARALLYGVVGFCAIYFGVTGA
FT                   EFIQEYLPQSIVKGMAIAGGMMPAVGFAMLLRTMFNVAILPYFFLGFVCSTYFNMPILG
FT                   TALVFTCVAILDYMNNKKSDTPQATTQTQVFDDEL"
FT   CDS_pept        527148..528032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0539"
FT                   /product="phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93303"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93303"
FT                   /db_xref="GOA:Q7MP25"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP25"
FT                   /protein_id="BAC93303.1"
FT                   /translation="MNSNAEMTMNPDQYHEDAVSSVISNTDSYSDQAVKKVITKQDLWK
FT                   IGFRGLLMEGNFNFNRMQAGGFCYSISPALKKIHQNPEDLKKALKNNLQFYNANPKMFT
FT                   LPLGLAIAMEESKEKPSTIASVKAATMGSVSGVGDALDHSVMLPLTLAIGSSIALQGNP
FT                   LGVLVFFVLYQAYRIPMYFWLLFLGYNAGVSALEKLSDQAEKLGRAANIVGLGVIGSMV
FT                   AKYVKVSTVIELEAGAADISLQTGMLDKLMPNLLPMALVWLMYYLVKKGKSPTALIFGI
FT                   LFAGVSGHLVGIF"
FT   CDS_pept        528045..528485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0540"
FT                   /product="phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93304"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93304"
FT                   /db_xref="GOA:Q7MP24"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP24"
FT                   /protein_id="BAC93304.1"
FT                   /translation="MIGIIVSGHINFATGMQSAVEAIVGEQDSLEFIDFVPTMTTEQLE
FT                   EQMLSSIEKMNDGSGVLILTDVPGGSPCNRGVAIMLNRSDVKVVAGCNLPMITNACFER
FT                   DGVSLAELTEIVCEIGAQSMKDMAKEIAMLENNNSDSFEDEL"
FT   CDS_pept        528665..529705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93305"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93305"
FT                   /db_xref="GOA:Q7MP23"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP23"
FT                   /protein_id="BAC93305.1"
FT                   /translation="MNNGQILEQMKRVYSWQRDNRTRFVTRSTGKKRFLKATDWERGVF
FT                   WLSVAQAWQATKDNEYLDGLLDFTLNTGFRPGPLPRFADDHVCMQAYLPLYPLFDMPEA
FT                   VEYATKALDIMVDEPKPGREDWWWCDSLFMAPPVFAGLTVATGDDKYLNYMDKAWWDAV
FT                   DNLFDAETNLYYRDKRYIPNAEGTELREANGEKVFWSRGIGWVLAAVPRILAHMPSDYP
FT                   TRQRYLDMYCALAAEVIKYQQADGFWRTSLLDPESFPAPESSATSLFCYGLAWGIEQGH
FT                   LDRETYLPVVNKAWTALEGCIHENGMIGWVQLPAFNPRDVEFEHNIDYGAGAFLLAATA
FT                   MLALTE"
FT   CDS_pept        529773..530495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0542"
FT                   /product="endoxylanase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93306"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93306"
FT                   /db_xref="GOA:Q7MP22"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP22"
FT                   /protein_id="BAC93306.1"
FT                   /translation="MSKLVYVTALLLGSSLATNVYASADSEYLIEYSAQSPVIDGNPTD
FT                   TAWDDANTLTQFSFPWRSQLAPATEFKALWNADGLFFRYRVSDENIAIGTDPKRAILDS
FT                   DRVEMFLAKDKQLTTYYTMEIDPKARVFSAKASYDSENKKIGQLDSTWTWPGLETQATI
FT                   VDGGYIVETKIPFMTLTSLGLWQDEQQTELNCALMRAEFTQQADGKLDMGWMTWIDPNT
FT                   PKPNFHNPYTFGLCKLVK"
FT   CDS_pept        530553..531194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0543"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93307"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93307"
FT                   /db_xref="GOA:Q7MP21"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR022133"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP21"
FT                   /protein_id="BAC93307.1"
FT                   /translation="MKIALTMENSQAAKNEIILKELQYVAVQSGDEVFNVGMCDAEDHH
FT                   LTYIHLGIQASILLAAKAVDFVFTGCGTGQGALMACNAHSNVVCGYALEPSDAFLFTQI
FT                   NNGNALSLAYAKNFGWAAELNVRGIFEKVLMSGCERGQGYPVERALPQQQNAAILNTVK
FT                   SAVAKDYLEGLKALDVELVRTACAGERFQKCLFENSQVDEISDFVREILN"
FT   CDS_pept        531291..532778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93308"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93308"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP20"
FT                   /protein_id="BAC93308.1"
FT                   /translation="MTKFIQASERPYIPCEHPDLNQYLQLFKQNLIRCKLKRRGFVDLD
FT                   EQIIAVFKQNTELKVQCEALVDYVAEAFEHYAVWDYSHAYYPGVSSQQTARLDAMEGSS
FT                   RVLPTLAAWLHANPNTALKSSTLSEAQFNLVDWIKCAFLAGTNPHHSGYWGNIEDYDQR
FT                   ICESADLALALWLSKEQVWQTLASDEQQQIVTWFTQVNHVETVDNNWHLFPLTVQLVMK
FT                   DLTGEDHVEHHRYARVKEFFVGDGWFRDGAKGNYDYYNAWGFHYSLYWLAQIDPEFDPH
FT                   FIRHSLRTFSDKYRYFFTPQGFPLFGRSACYRLSATAPLIATLDVCGANLPNEYLGQFK
FT                   RAFKTNLCYFISNGALQKGRPTQGLFADDIRLTDNYSGPASSFWSLRALNIALFCGDRI
FT                   GLWEAKEQPLEIEKESFMFSLNGPNMLVVGIQETQEVNVIFKNDYIKEQTPQSRKLASQ
FT                   SILKKWQERLVGRAERPKNNLLRKGVTSYSSKLFHFF"
FT   CDS_pept        complement(532848..533078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0545"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93309"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93309"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP19"
FT                   /protein_id="BAC93309.1"
FT                   /translation="MAKKRTPMNKIKEVLRLKYDCGLSNRSIASCLKLGPSTISELLTR
FT                   FKQSQLSWPLPESCSDADITQALYHGKKASN"
FT   CDS_pept        complement(533252..534139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0546"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93310"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93310"
FT                   /db_xref="GOA:Q7MP18"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP18"
FT                   /protein_id="BAC93310.1"
FT                   /translation="MRQHPRQHEPHNKLSEAERQQILDICNTPEYADLPPNIIVPMLAD
FT                   EGVYIASESTFYRVLKANNQLGKRTRNQAGTSPSRPKVQKACKPNQVWSWDISYLPSKI
FT                   RGKHYYLYLIMDIFSRKVVGAEVYDQELGEYAAELLQRTTWREKCVQGNITLHSDNGAP
FT                   MRSYTMLAKMYDLGIASSYSRPRVSNDNPYSESLFKTIKYCPSWPMDGFSSIEDARCWV
FT                   GHFVDWYNNEHKHSGIKYVTPQQRHCGEDNEILRQRMQVYRRAQLTHPGRWSRQTRDWS
FT                   YIDEVYLNPEKCAA"
FT   CDS_pept        534147..534305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0547"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93311"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93311"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP17"
FT                   /protein_id="BAC93311.1"
FT                   /translation="MISTEFRVQRWNVRIDNPTVEQAFVFVAPLRTASSTSVTILSRSE
FT                   IGISLPR"
FT   CDS_pept        complement(534289..534801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93312"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93312"
FT                   /db_xref="GOA:Q7MP16"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP16"
FT                   /protein_id="BAC93312.1"
FT                   /translation="MPANPVPIDVKTKGQTWLLPPYNWSHRRIAKELDVSPSVVSKWRN
FT                   ELVESGLLSTEPPLENTTTDYSAEQRFFIVIETATMSERELAEYCRSKGLFVDDVKTWR
FT                   ALSIKAQSTTSASMSHKENKLLRDERRKVKALEKELARKDKALAETAALLVLREKFNAL
FT                   WEINEED"
FT   CDS_pept        534852..535229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93313"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93313"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP15"
FT                   /protein_id="BAC93313.1"
FT                   /translation="MTDRNAPKYALFTQKTCYELLNQQLKRLNKLKSSLLLVLERPEIP
FT                   IHTNGSENDLREQVKRRKVSGGTRSDLGRQCRDTFSSLKKTYQKLDVSFWEYLNDRISQ
FT                   SNIIPTLGSLVLQKAHLASTY"
FT   CDS_pept        complement(535254..536063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0550"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93314"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93314"
FT                   /db_xref="GOA:Q7MP14"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP14"
FT                   /protein_id="BAC93314.1"
FT                   /translation="MSPNAQGRTMEKATQPEAVSSVMKVFSILQALSEQKDIGVSELSQ
FT                   RLMMSKATTYRFLQTMKMLGYVAQEDEADKYSLTLKLFELGAKSLEYVDLIAIADKQMC
FT                   IIAEQTNEALHLGALDEDGIIYIHKIDSGYNLSMQSRIGRRNPLYSTAIGKVLLAERET
FT                   EFVKQALADVTFVKHTDKTLENVDQLIEELTLVREQGYGQDNEEQEPGLRCIAAPVYDR
FT                   FGQVIAGLSISFPTIRFDEERLSYYVELLQTAANRISEQLGYHLENQ"
FT   CDS_pept        536143..536289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0551"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93315"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93315"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP13"
FT                   /protein_id="BAC93315.1"
FT                   /translation="MVGFVKCVDFLKRRFKNNYTPFHLIAILAAQSEMYAEDLSASDVV
FT                   MKE"
FT   CDS_pept        536292..537053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0552"
FT                   /product="dehydrogenase"
FT                   /note="with different specificities related to short-chain
FT                   alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93316"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93316"
FT                   /db_xref="GOA:Q7MP12"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP12"
FT                   /protein_id="BAC93316.1"
FT                   /translation="MILNSFNLQGKVAIVTGCDTGLGQGMALGLANAGCDIVGVNIVEP
FT                   TETIALIEQTGRKFVDVRANLMKLDDIPAIVDRAVTEFGRIDILVNNAGIIRRNDAIDF
FT                   SEQDWDDVMNINVKSVFFLSQAVAKQFIAQGEGGKIINIASMLSFQGGIRVPSYTTSKS
FT                   GVMGVTRLMANEWAKHNINVNAIAPGYMATNNTTALRADETRNKEILDRIPAGRWGEPS
FT                   DLAGPCVFLASSASNYINGYTIAVDGGWLSR"
FT   CDS_pept        537086..537643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93317"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93317"
FT                   /db_xref="GOA:Q7MP11"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="InterPro:IPR026267"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP11"
FT                   /protein_id="BAC93317.1"
FT                   /translation="MVDVFSQPLSIAQIVGLLSFALGLSTFYQKDDRRLKIVMLVFNFN
FT                   HLIHYLLMGSMMSVLSSLLSALRTATAVCLSTGRCTIKGAERIAVTVFISAGAVFGLTL
FT                   MDSVWELWPIVGTAIGTYALFMLKGIVMRLAFLVGASCWLINNILIGSIGGTLLELCVI
FT                   TINLVTIGRLLRDKKRLAVAGG"
FT   CDS_pept        537766..538698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0554"
FT                   /product="sugar kinase"
FT                   /note="ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93318"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93318"
FT                   /db_xref="GOA:Q7MP10"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP10"
FT                   /protein_id="BAC93318.1"
FT                   /translation="MNHIKRVAVIGECMVELRRNNGVLEQGFGGDTLNTAVYLSRLTHE
FT                   HGVASSYVTGLGRDAFSQQMLSAWQVEALDTEHVFISEDKLPGIYVIETAADGERSFFY
FT                   WRNDSAAKYWLRGQEIPQLAHALRHHQMIYLSGISLAILPSDCCDALLELLRLLRAQGA
FT                   TIAFDNNYRPALWPSQQQAQSVYRQVLALTDIAFLTFDDEQALYGDETEQQAVDRTQTL
FT                   GVKEIVIKRGAEPCMVVTQVGIESIASQPVEKIVDTTAAGDSFSAGYLAKRLLGGSTGE
FT                   SALAGHTLAGAVIQQRGALIGTDAMPTII"
FT   CDS_pept        538713..539336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0555"
FT                   /product="2-keto-3-deoxy-6-phosphogluconate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93319"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93319"
FT                   /db_xref="GOA:Q7MP09"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP09"
FT                   /protein_id="BAC93319.1"
FT                   /translation="MKTLNQRLSDIKVVPVIAIEDAGKAAKLAQVLIENGLPCAEVTFR
FT                   TEQAAQAIANMREAYPEMLIGAGTVLNSKQVDQAIEAGVDFIVSPGFNPTTVKYCQQRG
FT                   VAIVPGVNNPSLVEQAMEMGLTTLKFFPAEPSGGTAMLKALSAVYPVKFMPTGGVNPSN
FT                   VKDYLAISSVLACGGTWMVPSHLIDNEQWDELGELVVQVASIIK"
FT   CDS_pept        complement(539463..539903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0556"
FT                   /product="putative Tn5 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93320"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93320"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP08"
FT                   /protein_id="BAC93320.1"
FT                   /translation="MAGAERQRMTEPENLERMVSILAFVAVRLIQLRECLTLAAQLRGR
FT                   GLKEQAEAIESQPSTNVLTQDEWHILYLNVNKRGGRYPKKLPKEVPTLKWAYQAVAKLG
FT                   GFYDSKCTGIASWATMWLGWDKLQDMLSGYYLSKETAALLNY"
FT   CDS_pept        539992..540162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0557"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93321"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93321"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP07"
FT                   /protein_id="BAC93321.1"
FT                   /translation="MKLGRNDPCHCGSGKKFKRCCMSSVSKQHAQVFDDVETMLAMNPN
FT                   LGRDSNMEMLC"
FT   CDS_pept        540196..540471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0558"
FT                   /product="putative transposase A"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93322"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93322"
FT                   /db_xref="GOA:Q7MP06"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP06"
FT                   /protein_id="BAC93322.1"
FT                   /translation="MATIQAQCRFCNQTEHVRKHGTGVTGFQRFRCIECKRSFQLDYVY
FT                   EAYKPNVKKQIIDMAMNSSGVRETSRVLKVGYNTVLRTLKNSRQGK"
FT   CDS_pept        540468..540893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0559"
FT                   /product="putative transposase B"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93323"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93323"
FT                   /db_xref="GOA:Q7MP05"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP05"
FT                   /protein_id="BAC93323.1"
FT                   /translation="MTSIPFDKANISLICEVDEQWSFVGKKKNRRWLWYAWEPRYKRII
FT                   AHAFGKRNTDALRSLLTLLKPFDISFFFTDDFSVYAKELPKEKHVVGKRFTQRIERTNL
FT                   TLRSRLKRLVRRTIGFSRSEEMHDKVIGTFIEREFYF"
FT   CDS_pept        complement(540909..542138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0560"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93324"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93324"
FT                   /db_xref="GOA:Q7MP04"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP04"
FT                   /protein_id="BAC93324.1"
FT                   /translation="MAKRVVPLTNTQVKQAKESDKEYTLSDGDGLQLRVKTNGTKLWIL
FT                   KYTHPITKKRNNISFGSFPDVSLAEARKRRSEAKTLLALNIDPKQHKDEQLLKERAELE
FT                   NTFGKFSDRWLALKRESVKPETADKAYRALEKHILPKLGDVPIQDIKPRTVLSILEPVK
FT                   AQGTLETVKRLCRIINEVMRLAVASGDIEVNYLADITKLFPAPKRQHMVTIEPERLPEL
FT                   MQAIAGANITLSTRCLLEWQLHTMTRPIESATARWQDIDFENKVWVVPEERMKMKRPHT
FT                   IPLTDQTLALLEIMKPISGHREFIFPSNKDPKSHVNSQSANMALKRMGFEGQLVSHGLR
FT                   ALASTTLNEQGFNPDVIEAALAHVDKNEVRKAYNRAEYLEQRRKLMCWWSDHITASAEG
FT                   NVSLARRKGS"
FT   tRNA            complement(542304..542379)
FT                   /gene="tRNA-Met-1"
FT                   /product="tRNA-Met"
FT   CDS_pept        complement(542525..544456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0561"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93325"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93325"
FT                   /db_xref="GOA:Q7MP03"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP03"
FT                   /protein_id="BAC93325.1"
FT                   /translation="MVCISHTNSFTRLRSWIPSMDHNPQSQLKLLVIRGKEQGYLTYAE
FT                   VNDHLPAEIVDSEQVEDIIQMINDMGIKVVETAPDADDLALSDETNITDEDAAEAAAAA
FT                   LSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIAKRIEDGINQVQSSVAEYPGTIP
FT                   YILEQFDKVQAEELRLTDLISGFVDPNADETAAPTATHIGSELAESDLEDEDNTDIDDE
FT                   DEDEDEDGDSSSDSEEDVGIDPEMALEKFTQLRNSYQNLQLAVNEHGRESAQTAQAHEL
FT                   MLDVFKEFRLTPKQFDHLVNELRTAMDRVRTQERLIMKSAVEIAKMPKKSFIALFTGNE
FT                   SNEEWLDQILASDKPYVEKIKLHEEDIRRSIAKLRAIEEETSLSVNNIKDISRRMSIGE
FT                   AKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFS
FT                   TYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPLPEELAERM
FT                   QMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATATSLKAATKD
FT                   VLAGLTPREAKVLRMRFGIDMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSE
FT                   TLRSFLDE"
FT   repeat_region   543769..543792
FT                   /gene="rpt1T14"
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="CATCTTCGTCTT"
FT                   /note="2 units of 12 bp in-tandem repeat"
FT   CDS_pept        complement(544499..546295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0562"
FT                   /product="DNA primase"
FT                   /note="bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93326"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93326"
FT                   /db_xref="GOA:Q7MP02"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP02"
FT                   /protein_id="BAC93326.1"
FT                   /translation="MYLPFSFLLGFMAGHIPRSFIDDLLARLDIVDIIDARVKLKKKGK
FT                   NYGACCPFHNEKTPSFSVSQEKQFYHCFGCGAHGNAIDFMMEFERLEFVEAIEELASYL
FT                   GLDVPREQRSTNTKFSQAPQASSSQKRSLYDLMASISQFYRNQLKLSSGKIAIDYLKNR
FT                   GLSGEIVQKFGIGYIADEWDLVRKNFGQHPEAQEMLVAGGMLIENEKGNRYDRFRGRVM
FT                   FPIRDRRGRVIGFGGRVLGDGTPKYLNSPETPIFHKGKELYGLYEVLQAYREPPQILVV
FT                   EGYMDVVALAQYGVDYSVASLGTSTTGDHLQVLFRQTSTVVCCYDGDRAGREAAWRAME
FT                   NALPYLNDGRQLKFMFLPDGEDPDSYIRQFGKAQFEQQVTNAMPLSEFMFSSLAQQVDM
FT                   SSKEGMAKLTTLAVPLIDKVPGGTLRLYLRELLGRRLGLVDERQLQQLIDRQGQTDKKP
FT                   QPHRELKRTPMREVVALLIQRPSFSQLVPDLTPVKHLTIPGLSLLIEVLERCQARPNIT
FT                   TGQLLESWRGSQNEQLLSRLAGWEIPLDDDNEEDIFLDSLDKILAQCVEKQIENLQAKD
FT                   RSIGLSADERRELMALMLDLKA"
FT   CDS_pept        complement(546349..546792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93327"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93327"
FT                   /db_xref="GOA:Q7MP01"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP01"
FT                   /protein_id="BAC93327.1"
FT                   /translation="MALIEQLKEEQKLAMKAKDKQRLGTIRLALSAIKQREVDEQITLN
FT                   DDDILAVLTKMVKQRRDSVTQFEAAGRQDLADAEKAEITVLEEFMPQPLNEDEVAALID
FT                   SAIAESGAAGMQDMGKVMAVLKPQIQGRADMGKVSGLVRAKLA"
FT   CDS_pept        complement(546821..547036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0564"
FT                   /product="ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93328"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93328"
FT                   /db_xref="GOA:Q7MP00"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP00"
FT                   /protein_id="BAC93328.1"
FT                   /translation="MPVVKVRENEPFDVALRRFKRSCEKAGILSEVRRREHYEKPTTVR
FT                   KRAKAAAQKRHAKKLARENARRVRLY"
FT   CDS_pept        547265..548284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0565"
FT                   /product="metal-dependent protease"
FT                   /note="with possible chaperone activity"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93329"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93329"
FT                   /db_xref="GOA:Q7MNZ9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNZ9"
FT                   /protein_id="BAC93329.1"
FT                   /translation="MRILGIETSCDETGIAIYDDEKGLLAHKLYSQIKLHADYGGVVPE
FT                   LASRDHVKKTIPLIKEALKEANLTAKDIDGVAYTAGPGLVGALLVGATIGRSLAYAWGV
FT                   PAVPVHHMEGHLLAPMLEDNPPPFPFVAVLVSGGHSMMVEVKGIGEYKILGESIDDAAG
FT                   EAFDKTAKLMGLDYPGGPLLSKLAEKGTPGRFKFPRPMTNVPGLDMSFSGLKTFTANTI
FT                   AANGDDEQTRADIAYAFEEAVCATLAIKCKRALEQTGMKRIVIAGGVSANRRLRAELEK
FT                   LAHKVGGDVYYPRTEFCTDNGAMIAYAGMQRLKNNEVSDLAVEARPRWPIDQLTPVMK"
FT   CDS_pept        548406..549224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0566"
FT                   /product="putative beta-ketoadipate enol-lactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93330"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93330"
FT                   /db_xref="GOA:Q7MNZ8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNZ8"
FT                   /protein_id="BAC93330.1"
FT                   /translation="MKTFVIDDKSMAYQDVGQGPVLLFGHSYLWDSQMWAPQIEFLSQS
FT                   YRCIVPDLWAHGESESAPTRCNSLVDYAQHLLALMDHLQIETFSIVGLSVGGMWGAELV
FT                   SQAPARVTSLVMMDTFIGLEPEVTHQKYFAMLDAIAQSQMVPAPIVEAVVPLFFANDTK
FT                   EQKPQLVSDFEQRLASLSGERAVEVARVGRMVFGRRDVIEDAEKFALPTLIAVGQQDKP
FT                   RPVFESYLMHDVITGSQLVEIPNAGHISNLEQVEFVNQMLETFLAAVYAQ"
FT   CDS_pept        complement(549314..549925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0567"
FT                   /product="predicted membrane protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93331"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93331"
FT                   /db_xref="GOA:Q7MNZ7"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNZ7"
FT                   /protein_id="BAC93331.1"
FT                   /translation="MDAMAVTMTIIAYLLGSISSAVLICRVLRLPDPRGVGSNNPGATN
FT                   VLRIGGKGAAAAVLLCDMLKGTIPVWSAYYLGIEPVLLGVIAIAACLGHMYPLFFHFQG
FT                   GKGVATALGAIAPIGLDLTGMIMATWLLVAILFRYSSLAALVTVLLAPMYTWMIKPQYT
FT                   LPVGMLCCLIVLRHHQNIRRLFTGEEPKIGEKKLQMPKSQ"
FT   CDS_pept        550049..550408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0568"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93332"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93332"
FT                   /db_xref="GOA:Q7MNZ6"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNZ6"
FT                   /protein_id="BAC93332.1"
FT                   /translation="MALDKVFIEQLEVITTIGVYDWEQQIKQKLVLDIEMAHDNRPAGK
FT                   SDDVADALDYAQVSEAVLNHIENGRFLLVERVAEEVAELIMTQFSVPWIRIRLAKPGAV
FT                   PQARAVGVVIERGQA"
FT   CDS_pept        550405..550887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0569"
FT                   /product="7;8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93333"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93333"
FT                   /db_xref="GOA:Q7MNZ5"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNZ5"
FT                   /protein_id="BAC93333.1"
FT                   /translation="MNTVYIGVGSNIEREKHARAAWQELTLLGEALQASPIYECAAVGF
FT                   DSHAFFNFVIRLNTSMTLEELASQLRQIELRWGREENAAKYQDRTLDLDIVLFGECISS
FT                   QKPELPRSDIFKYPFVIQPLYDLQPDLVIPGDGRTVEEIWQTARDLDTLKAVDFSL"
FT   CDS_pept        550903..551706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0570"
FT                   /product="putative undecaprenol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93334"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93334"
FT                   /db_xref="GOA:Q7MNZ4"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNZ4"
FT                   /protein_id="BAC93334.1"
FT                   /translation="MSYFEAFVLALIQGLTEFLPISSSAHLILPSAILGWEDQGLAFDV
FT                   AVHVGTLAAVVIYFRKEVITLFAALFASIFKGERSKEAKLAWMIVIATIPACIFGLVMK
FT                   DVIEVYLRSAYVIATTTIIFGLLLWWVDKNASLLDDEYQAGWKKALFIGIAQALAMIPG
FT                   TSRSGATITAALYLGFTREAAARFSFLMSIPIITLAGSYLGLKLVTSGEPVHVGFLLTG
FT                   IVTSFISAYLCIHLFLKMISRMGMTPFVIYRLILGVGLFAYLLMA"
FT   CDS_pept        complement(551770..553080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0571"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93335"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93335"
FT                   /db_xref="GOA:Q7M7K5"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7M7K5"
FT                   /protein_id="BAC93335.1"
FT                   /translation="MQIRQLNREQSTIACYNVQSDKQIFEVTRVEVYLVGGAVRDKLLG
FT                   IPVYDQDWVVVGATAEQMLNAGYSPVGKDFPVFLHPKTKQEYALARTERKTGQGYKGFE
FT                   CFFSPDVTLEEDLLRRDLTINAIAMDSQGVLYDPYGGQQDLQDRILRHVSEAFVEDPLR
FT                   VLRVARFAAKLAPLGFRVADETMQLMQSIVASGELSALTAERVWQEWHKSLLTPAPQQF
FT                   LAVLRQCGALAVVLPEIDALFGVPQPEKWHPEIDTGIHTLLVAEQAAKLSSSAVVRFAA
FT                   QVHDLGKGVTPPSEWPSHKMHCHTGLKLIKQLCERVRVPNEFRDLALMVCEQHSNIHRA
FT                   AELKPQTMVKIFNKLDVWRKAERLNDILLCCQADHAGRQGLQDHPYPQAERIQLAYQAA
FT                   LSVEVQSVIQDGFKGPAIRDEQERRRIEAVKAALLNA"
FT   CDS_pept        553092..555248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0572"
FT                   /product="putative general secretion pathway protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93336"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93336"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032389"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNZ3"
FT                   /protein_id="BAC93336.1"
FT                   /translation="MYKDFFGFSELPFSIVPNSRYLYLSQRHREAITHLQAGLGDGGGF
FT                   AMLTGEVGTGKTTVAKSMLANLDGQTCAALLLNPTFSSVELLEAICDEFGLSYAANASL
FT                   KQLNQRIYQFLLENHQQNIQTLLVIDEAQHLAADVLEQLRLLTNLETETRKLLKVLLVG
FT                   QPELQQLLQTTQLRQLAQRITGRYHLLPLNPQETADYIAFRIHTAGGNRTLFDHASAKV
FT                   IAQYSHGIPRLINLICDKALQLSYHQGDKKITKATVERACQNVMAFQAEIYQQTSNRSS
FT                   FPWGKVSVVAACVAGVLAIASYWPLIPTDNVVPTVPPVERDKPATELPILPSVPDILVN
FT                   DEQWLGESAVARMTTRAQGLEDLYKLWGYRATRIDTLCEQPSTSIFQCQVRQLNWQELQ
FT                   QTPHPLLLTLQHEGQRAYVVLLEVNSERVVLLTGEQRLTFTVPQLMSLWRGEVTDLWPM
FT                   PLRETLRLGMHGEAIAVLDQLLAKALNDEPLKTTQFNAELMQRVEWFQRWQAMTEDGIA
FT                   GQRTLARLQHMVSLSEPWRDFTKAEKQGEEQAMRYPEFPSLAPLPRTYPLAETGDAINV
FT                   ADQTSPTLVASPSIPSEEKKTADERLFENLDLSGLSPELAQKVENALLVETQTDHSPQT
FT                   ESTVSRLDLSAEKWHGRLPPLNLQTHMYSSDPKRRWLKINGAEFHQGEWIDNQIQLVEI
FT                   SAQSVIVEFQGEQIEIPALYEWKG"
FT   CDS_pept        complement(555322..555933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0573"
FT                   /product="SH3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93337"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93337"
FT                   /db_xref="GOA:Q7MNZ2"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016476"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNZ2"
FT                   /protein_id="BAC93337.1"
FT                   /translation="MKKLIVTVLLTLLAVPSVFAQDRYIADELFTYMHSGPNNTFRIIG
FT                   SVDAGSKVKLLQTNSETGYSEVVDERGRKGWVQAKFITRQESMAVRLPRLEKELKEVKS
FT                   QLANARQNADTEKAGLVDSLDTRNQQISDLEKKYSEISDQLASVQTENRQLRAKLDTQK
FT                   DDLLLKYFMYGGGVAGIGLLFGLILPYMIPRRKKSNSGWA"
FT   CDS_pept        complement(556117..557376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0574"
FT                   /product="pho4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93338"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93338"
FT                   /db_xref="GOA:Q7MNZ1"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNZ1"
FT                   /protein_id="BAC93338.1"
FT                   /translation="MDILANYGTVLIIVAAVFGFMMAIGIGANDVANAMGTSVGSKALT
FT                   VKQAIIIAMIFEFAGAYLAGGEVTDTIRKGVIETSLFAHQPDVLVFGMMSALLAAGTWL
FT                   LLASYMGWPVSTTHSIIGAIIGFACVSVGTEAVDWSSVQGIVGSWIITPLISGFFAYVI
FT                   FVSAQRLIFDTEKPLMNAKRFVPVYMFITTMVIALVTIKKGLKHVGLHLSSTEAWFWSA
FT                   GVSGLVMLGGYLYIQKKFANREDDHGFAGVESIFSVLMVITACAMAFAHGSNDVANAIG
FT                   PLSAVVSTIEHMGEVTAKSTIAWWILPLGGFGIVVGLATMGHKVMATVGTGITELTPSR
FT                   GFAAQLATASTVVLASGTGLPISTTQTLVGAVLGVGFARGIAALNLGVVRNIVASWVVT
FT                   LPAGALLAVVFYYAMQAIFG"
FT   CDS_pept        complement(557511..558197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0576"
FT                   /product="phosphate transport regulator"
FT                   /note="distant homolog of PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93339"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93339"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNZ0"
FT                   /protein_id="BAC93339.1"
FT                   /translation="MTMPMNTIMGLFAKSPIKPLQRHVVCVNECCGHLINFFEVCSEGD
FT                   WEKAAEIRAQISHLEKEADVLKREIRLKLPRGLFLPVDRTDMLELLTQQDKLANLAKDI
FT                   AGRVYGRKLMIPEALQPNFIAYVQRCLDAANQAQNVINELDELLETGFKGREVTLVAEM
FT                   INQLDVIEDDTDAMQIGLRQQLMTIESEMNPIDVMFLYKILEWVGGIADQAQRVGARLE
FT                   LMLSRS"
FT   CDS_pept        558176..558313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0575"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93340"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93340"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNY9"
FT                   /protein_id="BAC93340.1"
FT                   /translation="MYSLAWSFNLINITLKEHTPFRGEMLSDGYKGAHVNALNPSLKLF
FT                   "
FT   CDS_pept        558397..559914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93341"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93341"
FT                   /db_xref="GOA:Q7MNY8"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNY8"
FT                   /protein_id="BAC93341.1"
FT                   /translation="METEIELKFFVSPEFSETLREKIAETKVLQHSCRDLGNTYFDTPD
FT                   NWLRQHDTGLRIRRFDDVFVQTVKTAGRVVAGLHQRPEYNAEHTCNTPNLHLHPGDIWP
FT                   QGKDIDTLQSELMALFSTNFTREQWLIGMPDGSQVEVAFDQGMVSAEDKQDPICEVELE
FT                   LKSGQTEALFTLARHLCESGGMRLGNLSKAAKGYRLALGYQGDEVKPLSLVDTGKMDNV
FT                   EYCLINSLEHALSHWHYHEQIYVERESVEALHEISHAISFIRQTLTIYGGVVPRRASAI
FT                   LRQELKWLEEELAWLSEHAHLTELLDDKGNVLRKLDARKFLVAELTQQFEELPDREEVL
FT                   TLLTSARYTGLLLDLSRWILTRGWQPFLDDKAREKMASAIRDFSVKQLDRTWAELMEAF
FT                   PAERSMSAQEYIDQRYRLMRNLYTGVGFASLYDAEERNSFRMPWADLIHGIDDLLMLRH
FT                   LLPLVEKLEGEEKEQLERWLVRQERSMLHAMDQTRAIGVEAEPYWRH"
FT   CDS_pept        complement(559948..560700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0578"
FT                   /product="Kef-type K+ transport system, predicted
FT                   NAD-binding component"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93342"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93342"
FT                   /db_xref="GOA:Q7MNY7"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNY7"
FT                   /protein_id="BAC93342.1"
FT                   /translation="MKSNDIKENTKPMSLLSLILSFMALFVISGLLFFPLDAETRQVLI
FT                   GLDFIICSIFLLQLSVDLIRAADKRQYLKTHWIDILASLPMIEPLRFARLFHILRVILV
FT                   LRSSRFILNQLKENRKETTIATILLLLVVLVTVGSGMMLFIEGKNPASNIQTGTDALWW
FT                   AFVTISTVGYGDHYPVTDGGKLLAVVIIMSGVGLFGMISGLITSILTTPSQQQTNRSIN
FT                   KEKMLETLLEQQHEILERLKRLEEEQKK"
FT   CDS_pept        560725..560853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0579"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93343"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93343"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNY6"
FT                   /protein_id="BAC93343.1"
FT                   /translation="MAFLTRKVFKQSAQRQHLLDTTIKELVEKQQWKSWLLSPGKG"
FT   CDS_pept        560817..562073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0580"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93344"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93344"
FT                   /db_xref="GOA:Q7MNY5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNY5"
FT                   /protein_id="BAC93344.1"
FT                   /translation="MEKLAFKPWERVISDIRLVPKMILLMVFSTVLIVGKQLWDASTFY
FT                   QALLAATQNEQLAQQHYDEYMVQVAWQTGLLIVMFVVLLMAAASVMLRQTRYLNDAIKL
FT                   MAQRNLSVPFGMACKDEYGDVARELEKTRQQLHDMIKMQINASDELAGLTEVMTLSMSE
FT                   TKESAQEEFNEIDQLATAMSEMTSTVQTVADHANNASSLTEQASQQAKKGQQFLQGTVS
FT                   KMSQLSSDIASSAQAVNQVEERVGAIGSVVGTIQGISEQTNLLALNAAIEAARAGEAGR
FT                   GFAVVADEVRNLAQRTQTATVEIQDMITQLQTSASSAVDLMEKSVVQAAEGVELVSNAG
FT                   TELDGIVGQVTSINDMNLQIATAAGQQSSVAAEMDQNLSNVRELVEASVVVVSELLETS
FT                   EMMQGNAEELDKKIKSFKV"
FT   CDS_pept        562179..565031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0581"
FT                   /product="glutamine synthetase adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93345"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93345"
FT                   /db_xref="GOA:Q7MNY4"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNY4"
FT                   /protein_id="BAC93345.1"
FT                   /translation="MSLPSPLLPVAELAMQNAQQSGYLEHWPQALITQFQFISGLSKFV
FT                   VETVQRDAQLAEGLPEMLAQESRQEAYRTRLAEQLQACHDEVAGHRVLRQFRNREMVYI
FT                   AWKDFTQAWSLEASLSHLSELAEAMIFETYQWQYQLCCQEWGTPTNAQGEAQPMLIIGM
FT                   GKLGGGELNFSSDIDLIFTYPENGETQGARRSIANAQFFTRLGQRLIKALDQQTFDGFC
FT                   YRVDMRLRPFGESGPLVMSYAALEDYYQEQGRDWERYAMIKARVMGREMYPEYQELRQM
FT                   LRPFVFRRYIDFSAIQSLRRMKSMISSEVRRRGLSNNIKLGAGGIREIEFIAQVFQLIR
FT                   GGREPALRQRGLLVTLEAIKQLQLLEEAQVCHLVEAYKYLRRLENLLQAMADKQTQTLP
FT                   DNELEQLALAVAMGYSQWQALQNDVQQHMAKVHAVFVTLIGDEEDEVSPVERHFNELWD
FT                   MAHNPEVIEQILQNDLACQNAATMSEQIIQFKADLAKKTLGPRGREVLNRLMPKLFSAI
FT                   FADADAQFGLPRVLHLLHNIATRTTYLELLDEHPAALTQLVRLCTASPMISEQLARYPI
FT                   LLDELIDPQQLYNPIALDAYRTELRDFLARIPEDDVEQQMDALRQFKQICSLRIAAADI
FT                   AGVLPVMKVSDHLTYLAEAIVEAVVHQAWQQVAEKYGEPTHLKDREGKGFAVVGYGKVG
FT                   GWELGYNSDLDVVFLHDCPVNVYTDGKKEIDGRQFYLRLAQRIIHIFSTRTASGILYEV
FT                   DTRLRPSGASGLLVCPVDAFEEYQHNDAWTWEHQALVRARMIYGDEHLASEFHRVRHQV
FT                   LAKPREQAKLQKEVADMRAKMRDHLGGKKSDRFMLKQDQGGITDIEFLAQYLVLNYSAE
FT                   KPKLTRWCDNVRIFETLIAQGVMEEAQAMLLTQAYTTMRDEIHRRNLLNLDADVALDKF
FT                   VALRQGVSKAWQEWLESSTI"
FT   CDS_pept        565046..566515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0582"
FT                   /product="ADP-heptose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93346"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93346"
FT                   /db_xref="GOA:Q7MNY3"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNY3"
FT                   /protein_id="BAC93346.1"
FT                   /translation="MLHSAQQKNWRPRMKPILPDYNNAGVLIIGDVMLDRYWYGPTSRI
FT                   SPEAPVPVVKVENNEERPGGAANVAMNIASLGGHARIVGLTGMDEPAKVLTETLNSLKV
FT                   KCDFVALPEYPTITKLRVMSRGQQLIRLDFEDKFEGTNPELVLTRMERALPHVQAVILS
FT                   DYAKGALEHVEALIAKARAANVPVFIDPKGTNFEPYRGATLLTPNMSEFEAVVGKVTSD
FT                   DDLVEKALGLIEKFELGALLVTRSEHGMTLVRPDQKPFHLPTQAKEVYDVTGAGDTVIS
FT                   VLAASVAAGKPLDEACALANAAAGVVVGKLGTSTLSTIELAEAIHGSRDTDFGVIAEAA
FT                   LIDAVKAAQAKGEKVVMTNGCFDILHAGHVSYLNNAAKLGDRLIVAVNTDESVKRLKGP
FT                   GRPVNPTDRRMAVLAGLGAVDWVVPFSEDTPQRLISEVLPDLLVKGGDYKPEDIAGGKE
FT                   VIAAGGEVKVLNFEDGCSTTEIIDAIKGGRG"
FT   CDS_pept        complement(566628..567953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0583"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93347"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93347"
FT                   /db_xref="GOA:Q7MNY2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="InterPro:IPR028351"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNY2"
FT                   /protein_id="BAC93347.1"
FT                   /translation="MKKLLPLLIGAALGSLSSSVWADSLAEIYDLAKQNDPQLLSVQAK
FT                   RDAAFEAVTSSRSTLLPQINLTAGYNLKRGDTDLDAGATIDNDQNALTAGINFSQELYQ
FT                   RSSWITLDNAEKSARQADAAYAATQQGLILRTAQAYFEVLKAQDNLEFVRAEKAAVARQ
FT                   LEQTKQRFEVGLSAITDVHDAQAQYDGVLADEVLAENSLTNSYEALREITGQEHKNLNV
FT                   LDTKRFSASRSNASAETLIEEAQEKNLSLLSARITKDIAKDNISLASSGHLPSLTLDGG
FT                   YNYADVSNSAQSDGTTNNFNVGVNLVVPLYTGGNTTSQTKQAEFNYVSASQDLEATYRG
FT                   VVKEVRAQNNNINASIGALRAYEQSVVSARSALEATEAGFDVGTRTIVDVLDATRRLYD
FT                   ANKNLSNARYNYILSVLQLRQAVGTLSEQDVLDVDAGLIAKK"
FT   CDS_pept        568170..568817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0584"
FT                   /product="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93348"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93348"
FT                   /db_xref="GOA:Q7MNY1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNY1"
FT                   /protein_id="BAC93348.1"
FT                   /translation="MRCEMQQDDKQHAVFTPEDVEVLSKEPLFQGFFKMIKYRFRHKLF
FT                   AGGWSNVIEREMFERGHAAAMLPYDPIRDQVVLIEQIRVGALEHQHPWQLEIVAGMIDR
FT                   DESADDVVRREAQEEAGLEVGQLVSVVSYYPSAGGCSEKLDVFIGEVDASKAHGIHGLD
FT                   YEDEDIRVHVMTREQAYDLVKQGKIENGASIIALQWLELNHLQLKSQWLEIE"
FT   CDS_pept        568814..569266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93349"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93349"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNY0"
FT                   /protein_id="BAC93349.1"
FT                   /translation="MMGLAAAKQPYYVDLAGLMRTYETNYAKLNALLPFNAEVGDVRCY
FT                   QVVNMIYQMTVKEVTKYTTIVEICQSDDIPLFPLPTMSVRLYHDARVAEVLSSGEHVRF
FT                   KAKYDYPNEKLMQKDEKHQLNAFLGEWLTFCLKSGISRTPITFKEE"
FT   CDS_pept        569285..570109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0586"
FT                   /product="cyclic AMP phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93350"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93350"
FT                   /db_xref="GOA:Q7MNX9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNX9"
FT                   /protein_id="BAC93350.1"
FT                   /translation="MQHTSSDTLSENSIKLLQITDTHLFASDEGSLLSVKTLQSFQAVV
FT                   EQVMARHVEFDYLLATGDISQDHSAASYQRFADGIAPLEKACFWLPGNHDYKPNMSSVL
FT                   PSPQITTPEQVELNAHWQLILLDSQVVGVPHGRLSDQQLSMLEHHLQASPEKNTLILLH
FT                   HHPLLVGSAWLDQHTLKDAEAFWQIVERFPMVKGIVCGHVHQDMNVMHKGIRVMATPST
FT                   CVQFKPQSDDFALDTVSPGWRELTLHANGEITTQVQRLASGSFLPDFTSSGY"
FT   CDS_pept        570099..570701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0587"
FT                   /product="predicted esterase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93351"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93351"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNX8"
FT                   /protein_id="BAC93351.1"
FT                   /translation="MVTDMSHPKPSLLLYIHGFNSSPLSMKANLMREYCQQHRPDIKVV
FT                   VPQLPSFPQAAAECLLEIVQQHKATHRIGLVGSSLGGYLSTWLNAEFGFRAVVVNPAVK
FT                   PYELLADYLGPQTNSYTHESYTLEARHIDELKALEVKEVANPESFWLLQQTEDEVLDYR
FT                   QAVEKYAGSAQTVEEGGDHSFVGFERYPERIIHFLGL"
FT   CDS_pept        570938..572818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0588"
FT                   /product="topoisomerase IV, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93352"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93352"
FT                   /db_xref="GOA:Q7MNX7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNX7"
FT                   /protein_id="BAC93352.1"
FT                   /translation="MTEQYNAGAIEVLNGLEPVRRRPGMYTDTARPNHLGQEVIDNSVD
FT                   EALAGHASKVQVILHADQSLEVIDDGRGMPVDIHPEEKVSGVELILCKLHAGGKFSNKN
FT                   YQFSGGLHGVGISVVNALSKRVEVTVRRDGQVYEIAFEHGDKVSDLTVTGTCGRRNRGT
FT                   SVHFWPDTKYFDSPNFSVTRLVNNLRAKAVLCPGLEITFSDRVNGKEHQWLYQDGLKDY
FT                   LIEGVKGYTLLPEEPFTGQFSAETEAADWAVIWQPEGGEMITESYVNLIPTAQGGTHVN
FT                   GLRQGLLDAMREFCEFRNLLPRGVKLTGEDVFDRCSYVLSVKMQDPQFAGQTKERLSSR
FT                   QTAAFVSGVVKDTFSLWLNEKPQLAEQLAEVCIANAHRRMRASKKVVRKKIASGPALPG
FT                   KLTDCSVQDLARTEIFFVEGDSAGGSAKQARDREFQAVMPLRGKILNTWEVSADQVLAS
FT                   QEVHDISVALGIDPDSDNLEGLRYGKICILADADSDGLHIATLLCALFTRHFRALVEAG
FT                   HIYVAMPPLYRIDCGKEVFYALDDAEKDGVLERLSQKRAKINVQRFKGLGEMNPLQLRE
FT                   TTMDPNTRRLVQLTIDDSDATMEMMDMLLGKKRADDRRSWLQNNGDMAEV"
FT   CDS_pept        572822..575107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0589"
FT                   /product="topoisomerase IV, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93353"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93353"
FT                   /db_xref="GOA:Q7MNX6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNX6"
FT                   /protein_id="BAC93353.1"
FT                   /translation="MSTEITYDGVEQLPMRKFTEDAYLNYSMYVIMDRALPYIGDGLKP
FT                   VQRRIIYAMSELGLSAAAKYKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPL
FT                   VDGQGNWGAPDDPKSFAAMRYTEAKLSKFADVLLGELGQGTVEWQPNFDGTMKEPKMLP
FT                   ARLPHILLNGVTGIAVGMATDIPPHNVREVADATIHLIDNPAAPLMDLMQYVKGPDFPT
FT                   EAEIITPSSDLEKMYRSGRGSVKMRAVWCKEGSDIVITALPHQVSGAKLLEQIAAQMRA
FT                   KKLPMVEDLRDESDHENPTRIVIVPRSNRVDCDQLMNHLFASTDLEKSYRVNLNMIGLD
FT                   NRPQVKGLVQILTEWITFRRETVRSRLQYRLDKVLARLHILEGLLIAYLNIDEVIEIIR
FT                   TEDDPKAVLMARFGITDIQADAILDTKLRHLAKLEEMKIRGEQDELEKERKKLEELLGS
FT                   ERRLNTLLKKEIRADAEKFGDDRRSPLVVREEAKALTERDLMPNEAITVVLSEKGWIRH
FT                   AKGHEVDCQGLSYKAGDSYLAHACGKSNQQAVLLGSDGRSYSLESHTLPSARGQGEPIT
FT                   GRLNITPGSSIRQVIMGEEEQLWLIGSDAGYGFVCKGSDLLSKNRSGKALVSLPENAEV
FT                   MTPSAVLDLDNDDILAITNQGRMLMFPIKDLPQLGKGKGNKIINIPAAKAKAKEEILSH
FT                   LIALPKGASLTLYAGKRKLGLKPADLDNFRGERGRRGGLLPRGLQRVTRIELEQSDSSD
FT                   SSETATDA"
FT   CDS_pept        complement(575183..576250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0590"
FT                   /product="protease DegS"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93354"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93354"
FT                   /db_xref="GOA:Q7MNX5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011783"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNX5"
FT                   /protein_id="BAC93354.1"
FT                   /translation="MLNFLMRSVVLGLVTALLVLLAVPSLRSNVITTTLDVSPQDASSL
FT                   QISFNQAVRNAAPAVVNIYSRKYVENDRSKLSTQGLGSGVIVSEKGYIITNYHVVAQAD
FT                   QIVVALQDGRVAAAQLVGKDRRTDIAILRIEGSNLPVIPLNSNYKAKVGDVVLAIGNPY
FT                   NLGQTTTFGIISATGRSSISADGRQAFIQTDAAINEGNSGGALVNTKGELVGINTASFQ
FT                   QATDLETYGISFAIPFPLANKIMEKIIADGRVIRGYIGIDGQDINAVTARLLGNEHIGG
FT                   IVVLGVDPNGPAANAGFEAQDIILSIDDKKIQGRQSVMDIVTDLRPGTTVDVGIIRKGQ
FT                   EMTLKVTIAEDNREI"
FT   CDS_pept        complement(576382..577749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0591"
FT                   /product="protease DO"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93355"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93355"
FT                   /db_xref="GOA:Q7MNX4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNX4"
FT                   /protein_id="BAC93355.1"
FT                   /translation="MKKPLLVLTALSLSLSSALAPLPATAALPFSVSGQELPSLAPMLE
FT                   RVTPAVVSIAVEGKQVERSRIPDQFQFFFGPDFPTEQVRERPFRGLGSGVIINANKGYI
FT                   VTNYHVIKGADEIRIQLHDGREYDAELIGGDEMSDVALLKVDGAKDLTEIKLADSDKLR
FT                   VGDFSVAIGNPFGLGQTVTSGIVSALGRSGLNIENFENFIQTDAAINSGNSGGALVNLN
FT                   GELIGINTAILGPNGGNVGIGFAIPSNMMKNLTDQILEFGEVKRGMLGVQGGEITSELA
FT                   EALGYNSSKGAFVSQVVPDSAADKAGIKAGDIIVSLNGKKIDTFSELRAKIATLGAGKE
FT                   IELGVVRDGKDKRFDVTLGESQQTKAKADKMHEGLAGAELANTTSDDRIAGVKVINVAD
FT                   NSPAAQYQLQKDDIIIGVNRQRVKNLADFRAIVEKQTGVLALNIQRGERTIYLVIR"
FT   CDS_pept        complement(577906..578355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93356"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93356"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNX3"
FT                   /protein_id="BAC93356.1"
FT                   /translation="MPWMYAIVGLLVGAIVGVVVSRLTTPEYKKQKNIKKELDVAKYEL
FT                   EQQRQELIDHFSQTAELLETLGKDYSKLYQHMAKTSAELLPNLPAQDNPFDKVALSAKE
FT                   DNTEENVTDEVTEQPKDYANGATGLFNDQKKVILDAPEAITAKAS"
FT   CDS_pept        578491..579618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0593"
FT                   /product="predicted ATPase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93357"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93357"
FT                   /db_xref="GOA:Q7MNX2"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNX2"
FT                   /protein_id="BAC93357.1"
FT                   /translation="MPCFGMRTMSPLEKYEHDLAHNGFQKDAAQYNAVRALDRLFHQYL
FT                   DYCAQPQPQQTRWQKLLGKQPPAKLPPQGLYFWGGVGRGKTYLMDTFFEALPTQRKMRV
FT                   HFHRFMYRVHDELKRLGDVENPLEKVANVFKKEADIVCFDEFFVSDITDAMILGTLMQA
FT                   MFRRQMILVATSNIVPQELYRNGLQRARFLPAIALIEQHCEVLNVDSGIDYRLRTLEQA
FT                   EIYHYPLDEQANLNLNLYYQQLVGEGKAKLHSVDINHRQIAVIEASDGVLHATFAQLCQ
FT                   TARSQNDYIELSKIYHTVLLADVPQMDNKIDDAARRFIALVDEFYERHVKLIISAEVAL
FT                   EQLYLQGQLEFEFKRCQSRLVEMQSHEYLAREHLA"
FT   CDS_pept        579870..580298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0594"
FT                   /product="ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93358"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93358"
FT                   /db_xref="GOA:Q7MNX1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNX1"
FT                   /protein_id="BAC93358.1"
FT                   /translation="MKTFVAKPETVKRDWYVVDAEGKTLGRLASEIASRLRGKHKAEYT
FT                   PHVDTGDYIIVINAEKVTVTGNKAAAKTYYRHTEFPGGIKSITFDKLIVRKPEMVIELA
FT                   VKGMLPRGPLGRAMYRKLKVYAGAEHNHVAQQPKVLDI"
FT   CDS_pept        580314..580706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0595"
FT                   /product="ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93359"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93359"
FT                   /db_xref="GOA:Q7MNX0"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNX0"
FT                   /protein_id="BAC93359.1"
FT                   /translation="MAENQYYGTGRRKSSAARVFIKPGSGNIVINKRALEEYFGRPTSC
FT                   MVVKQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRPALRAAGYV
FT                   TRDARCVERKKVGLRKARRRPQFSKR"
FT   CDS_pept        581037..581627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0596"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93360"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93360"
FT                   /db_xref="GOA:Q7MNW9"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNW9"
FT                   /protein_id="BAC93360.1"
FT                   /translation="MSNAPLNNGRRRFLTATTAVVGGLGAAAVAVPFIKSWNPSAKAKA
FT                   AGAPVEVDVSKIEAGQMIRVEWQGKPVWVVRRTQEVIDNLKTIGGQLRDPQSEMEQQPT
FT                   YAQNEFRSIKPEFFVAVGFCTHLGCSPTYLPDSFAEQVQGVKSGFFCPCHGSKFDMAGR
FT                   VFQGVPAPLNLVVPKHMYLSDTTILIGVDEGDA"
FT   CDS_pept        581627..582892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0597"
FT                   /product="ubiquinol-cytochrome c reductase, cytochrome b"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93361"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93361"
FT                   /db_xref="GOA:Q7MNW8"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNW8"
FT                   /protein_id="BAC93361.1"
FT                   /translation="MQALLDWVEKRIPAMNAYKKHLSEYPMPKNFNFWYLFGSLAMLVL
FT                   VNQILTGIWLTMNYVPSGEGAFASIEYIMRDVEYGWLLRYMHSTGASAFFVVVYLHMFR
FT                   GLIYGSYQKPRELLWIFGMLIFLVLMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVIG
FT                   DDLTLWIRGDYIISGATLNRFFALHVIALPIVLLLLIVLHILALHEVGSNNPDGIETKL
FT                   PKGSMGPDYKTQFKFHEYYSNKYDIIDSIPFHPYGTVKDMVGVAGFLFLFCYVLFFNPE
FT                   MGGYFLEPPNFEAANPLKTPEHIAPVWYFTPFYAILRAVPDKLLGVVAMGLSIVFLFLL
FT                   PWFDRCKVRSYRYRSKIHLINIIQFTISFIALGILGALPATPTYTLLAQIFSLGYFMFF
FT                   ILLYVYSKNEATKPLPERVTFK"
FT   CDS_pept        582889..583626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0598"
FT                   /product="ubiquinol-cytochrome c reductase, cytochrome c1"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93362"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93362"
FT                   /db_xref="GOA:Q7MNW7"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNW7"
FT                   /protein_id="BAC93362.1"
FT                   /translation="MKKWIVILFAMLPSLAMAAGAGVPLDKANVDLSDKASLQNGAKLF
FT                   MNYCFACHSTQYQRYERVADDLGIPADLMKENLMFNPESKIGDLMVNAMPAKQAAAWFG
FT                   APPPDLTLVARVRGADWLYTYLRTFYVDPSRPFGVNNLVFPSVGMPHVLEELQGIPNPV
FT                   YGTKVVDGKEIQVVVGVESDGTGELSKGEYDKAVLDLVSFLVYSGDPVKAERHALGWWV
FT                   MAFLVLFTIVVVLLKKEYWRDVH"
FT   CDS_pept        583724..584359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0599"
FT                   /product="stringent starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93363"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93363"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNW6"
FT                   /protein_id="BAC93363.1"
FT                   /translation="MALAANKRSVMTLFSSASDLYSHQVRIVLAEKGVSVEVELVDETN
FT                   LPAELIELNPYKSVPTLVDRELALYDSKIIMEYLDERFPHPPLMPVYPVARGNSRLMMY
FT                   RIERNWYSLAEKIVKGNAEESEKARNKLRNDLLTLSPIFAEFEYFMSEEFSLIDCYLAP
FT                   LLWRLPLLGIDLIGPGSKEIKAYMNKVFERDSFLASLTEAEREMRLVR"
FT   CDS_pept        584363..584839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0600"
FT                   /product="stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93364"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93364"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNW5"
FT                   /protein_id="BAC93364.1"
FT                   /translation="MEIAQMTARRPYMLRAFYDWLVDNDLTPHLVVQATLAGVRVPQEF
FT                   IQDGQIILNIAPRAVGNLELGNDTISFNARFGGRPHSVIVPLYAVLAIYARENGAGTMF
FT                   EPEEAYTSIPGAEQEEDDGIWLEEEHSAPQPSIDFDDEPEPPRPKGRPSLRVVK"
FT   CDS_pept        complement(584917..585510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0601"
FT                   /product="putative hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93365"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93365"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNW4"
FT                   /protein_id="BAC93365.1"
FT                   /translation="MLRYVLLFITTWALSGCAGLFIAGAATTANLVTDTRTTKEIWQDN
FT                   NIEFEIAAIGNKTPYRGKVRIVASSYNGTVVLMGQASTAEERSGFEQQARSIKGVQVLH
FT                   NQVKVKAPLSVSQISNDSWITTKVKSALLTDESLNSVKIKVITEDGDVFLFGYVNSEQA
FT                   EKATEIARNISGVKQVVRAFQYGENATQVNHASQ"
FT   CDS_pept        complement(585513..586103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0602"
FT                   /product="phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93366"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93366"
FT                   /db_xref="GOA:Q7MNW3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNW3"
FT                   /protein_id="BAC93366.1"
FT                   /translation="MLDSIKDSFTESIQIQIAAAEALPDAITHAAQAMVATLLNGHKIL
FT                   CCGNGGSAANVQQFVSCLLNRFETERPSLPAMALTADNTTLTAVANDYHYQEIFSKQVR
FT                   AFGQPGDILLAISTSGNSKNIIKAMEAAVTRDMTIIALTGKDGGEMAGLLGENDVEIRI
FT                   PSHRTARIHEVHMVTLHCLCDLIDQVLFPAHEE"
FT   CDS_pept        complement(586107..586475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0603"
FT                   /product="predicted endonuclease"
FT                   /note="distantly related to archaeal Holliday junction
FT                   resolvase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93367"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93367"
FT                   /db_xref="GOA:Q7MNW2"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNW2"
FT                   /protein_id="BAC93367.1"
FT                   /translation="MGLFSRRAIGNQYESLAKEYLQRQGLRFIEANFTTKVGEIDLIFK
FT                   EAQTIVFVEVKYRKNSCYGDAAEMVNPAKANKLIKTAYLWLNKHGYNACNTAMRFDVVA
FT                   IHSNGHDINWIANAITQG"
FT   CDS_pept        complement(586462..588273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0604"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93368"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93368"
FT                   /db_xref="GOA:Q7MNW1"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNW1"
FT                   /protein_id="BAC93368.1"
FT                   /translation="MMNPKRLSVPRLLTPVALAITLAACSSGPKTPTSVDITLEPTLSV
FT                   QNYMINADSSEGSLQADWLIMAAKAALQNGDLAQADLLIKRLARMPLSEVQQAEWQLTR
FT                   AAYHLKLNQADNVIELLNFKAWWKLPNEQWKDYYTLRVEAYTALQQPFEANRQLVTLSQ
FT                   YVDESQQAEIAQQIWANFTGYSQYEITQLHPDASEEVLDGWLQLAIYMKTMSANVPQLK
FT                   NTLEHWFAENTAHPAALYTPAEIQSILDLEIVQPVHTALLLPLSGKYAKQAQLIRDGFI
FT                   FAMMNDKDRDPEATLKVIDTNLYQPHQLKQQLTDEQIDFIVGPLRKDVIEVLQGELSDD
FT                   SGQVSIPSLALNIPDELQTGTGICYLTLSPEQEVAQAAKHLFANGYKYPLIFAPQGNLG
FT                   QRVVSAFEAEWKKYSTNKVAVSYFGDKRQLQRDVNSVFGLQESQQRIAQMEGLMKLPME
FT                   TQPRSRRDIDSVYIAARSSELTLIKPFIEVAVNPDAKPPKLFSNSMSNSGEKQYEDLTG
FT                   IVYSDIPMLLEVNPALDSQMEQLWPDQSNFQKRLQALGMDAYKLMAELPQMKVVPNHAV
FT                   NGQTGVLTIDDQCVVHREISWKEHGAL"
FT   CDS_pept        588342..589205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0605"
FT                   /product="predicted methyltransferase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93369"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93369"
FT                   /db_xref="GOA:Q7MNW0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNW0"
FT                   /protein_id="BAC93369.1"
FT                   /translation="MTDKNNFPTEGATLYIVPTPIGNLGDITQRAIEVLSSVDMIAAED
FT                   TRHTGKLLSHFNIQTKTFALHDHNEQQKAQVLVDKLLSGQNIALVSDAGTPLISDPGYH
FT                   LVTQCRQAGVKVVPLPGACAVITALSASGLPSDRFSFEGFLPPKSKGRKDKFLEIAKVE
FT                   RTCIFYESPHRIVDSLHDMLEILGPDREVVLARELTKTFETIQGMRLSELVEWVQSDDN
FT                   QQKGEMVLLIHGYRDSAEESLPEEALRSLAILTKELPLKKAAALAAEIYNLKKNALYKW
FT                   GLENLE"
FT   ncRNA           589305..589747
FT                   /gene="rnpB"
FT                   /product="RNA subunit of RNase P"
FT                   /note="identified by similarity alignment"
FT                   /ncRNA_class="RNase_P_RNA"
FT   CDS_pept        589928..590878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0606"
FT                   /product="predicted S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /note="involved in cell envelope biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93370"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93370"
FT                   /db_xref="GOA:Q7MNV9"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNV9"
FT                   /protein_id="BAC93370.1"
FT                   /translation="MTDTFQHISVLLHESIDGLAIKPDGIYIDGTFGRGGHSRTILSKL
FT                   GEHGRLYSIDRDPQAIAEAGKIDDPRFTIIHGPFSGMANYAEQYDLVGKVDGVLLDLGV
FT                   SSPQLDDAERGFSFMKDGPLDMRMDPTSGIPVSQWLMEADLDDITWVIREFGEDKHARR
FT                   IAKAIVAHREDETKEPLTRTSQLAKLISEAAPKSFKEKKHPATRAFQAFRIYINSELEE
FT                   IDTALKGAASILAPEGRLSVISFHSLEDRMVKRFMRKESKGPEVPHGIPLTEAQIKALG
FT                   SANMKTVGKAIMPTAQEIELNPRSRSSVLRIAEKL"
FT   CDS_pept        590888..591205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0607"
FT                   /product="cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93371"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93371"
FT                   /db_xref="GOA:Q7MNV8"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNV8"
FT                   /protein_id="BAC93371.1"
FT                   /translation="MRQAKPNLAKEIFFDLLTVGRTPLILLVLIFASAMAVVFATHHTR
FT                   QAITQKDEALQEREHLDNEWRNLMLEETALAEHSRVQEMAKKELEMKRPDGDKEVVINL
FT                   K"
FT   CDS_pept        591202..592932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0608"
FT                   /product="cell division protein FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93372"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93372"
FT                   /db_xref="GOA:Q7MNV7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNV7"
FT                   /protein_id="BAC93372.1"
FT                   /translation="MMGKKSKTTVKPKESEQGTSLLIRWRFHLVLGFVFLAFAALVVRL
FT                   AFIQVIEPDNLIREGDLRSIRVKALPSARGIISDRNGEPLAVSVPVEAVWADPVTIFKE
FT                   KALDNKQRWYALADVLGLQREELIERIERNENRRFIYLQRQVSPAMANYIRELKIPGVG
FT                   LKSESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSYDNWLTGEAGKQTIRKDRYGRVVE
FT                   NIAYEDRQEGKSLELTIDQRLQAIAYRAIKQAVADHRATSGSAVMLDVKTGAVLAMVNA
FT                   PSYNPNNRSDWQSYKMRNRIITDSLEPGSTVKPFVILAALENGVATKDTVIDTGNGILQ
FT                   VGGSRVRDTSKVGKADLTEILKKSSNIGVTKLSMEMPVEAILGMYNSVGLGEPSGLNLV
FT                   GEVTGIFPTRSRWSPIERATLSFGYGLSITPIQLAHAYATLGNEGMYEPIHIIKSNDRD
FT                   MAKQVVSKQHAREVLNMLETVTQKGGSARRAAVPGYRVGAKTGTSRKATAGGYSDEYIT
FT                   YTAGVAPVSDPRIALVVVVNEPQGDDYYGGSVASPVFSEIMKGALQILNVAPDENAFQN
FT                   "
FT   CDS_pept        592898..594445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0609"
FT                   /product="UDP-N-acetylmuramyl tripeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93373"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93373"
FT                   /db_xref="GOA:Q7MNV6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNV6"
FT                   /protein_id="BAC93373.1"
FT                   /translation="MWHPMKMHSRTSFMAERGSENKMRNTMNLTNLLAPWLDCPELADI
FT                   TVQSLELDSRQVKQGDTFVAIVGHVVDGRQYIEKAIEQGANAVIAQSCQQYPPGLVRYQ
FT                   QNVVIVYLEKLDEKLSQLAGRLYQHPEMSLIGVTGTNGKTTITQLIAQWLELAGQKAAV
FT                   MGTTGNGFLNALQPAANTTGNAVEIQKTLADLQQQGAKATALEVSSHGLVQGRVKALQF
FT                   AAGVFTNLSRDHLDYHGTMEAYAKAKMTLFTEHQCQHAIINLDDEVGAQWFQELQQGVG
FT                   VSLFPQDASVKALWASSVAYAESGITIEFDGCFGQGRLHAPLIGEFNATNLLLALATLL
FT                   ALGVDKQALLDSAASLRPVLGRMELFQVNSKAKVVVDYAHTPDALEKALQALRVHCTGH
FT                   LWAIFGCGGDRDKGKRPMMAEIAERLADHVVLTDDNPRSEDPAMIVQDMLAGLTRGDSA
FT                   VVEHDRFSALQYALDNAQADDIILLAGKGHEDYQVLKHQTVHYSDRESAQQLLGISS"
FT   CDS_pept        594442..595803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0610"
FT                   /product="UDP-N-acetylmuramyl pentapeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93374"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93374"
FT                   /db_xref="GOA:Q7MNV5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNV5"
FT                   /protein_id="BAC93374.1"
FT                   /translation="MIETSLSHLAQLTQGQLIGDDATFCTVSTDTRHIPQQALFIALVG
FT                   ERFDAHDFCQQAVDAGAVALLVERALDLPVAQVVVKDTKMALGQLGANVHQRCQTPTVA
FT                   ITGSCGKTTVKEMVASILQQKGKVLFTAGNFNNDIGAPLTLLRSEPEDDFAVIELGANH
FT                   IGEIAYTTQLVRPDVALVNNVAAAHLEGFGSIDGVKQAKGEIYQGLSAGGVAIVNLDSH
FT                   GGEYWTQVLADKQVTTFSASSEQADFYATDIVLDTQGKASFVLHTPEERIPLSLGIIGQ
FT                   HNVANAIAASIIALQFGASLAQIQSGLLNLMPVKGRVDVQQLSDNIKLIDDSYNASVPA
FT                   MKAAVDLLGSFTGQRWLVLGYMAELGNESLALHRQVGEHAAPLNFEHVLTYGEDTRIIS
FT                   QLCGGKHFSDHGELIEYIKQNLANENEACHTVLVKGANSAGMSKVAAALKENYR"
FT   CDS_pept        595800..596882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0611"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93375"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93375"
FT                   /db_xref="GOA:Q7MNV4"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNV4"
FT                   /protein_id="BAC93375.1"
FT                   /translation="MIIWLAELLQPYFSFFRLFEYLSFRAILSVLTALGLSLWMGPRLI
FT                   KRLQLLQIGQVVRNEGPESHFSKRGTPTMGGVMILAAISITILLWANLSNPYVWAVLAV
FT                   LMGYGAVGFVDDYRKVVRKNTDGLIARWKYFWQSAIALVVAFALYAYGKDTAATQLVVP
FT                   FFKDVMPQLGLMYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGFAVIAWATGNV
FT                   NFSQYLHIPYLPHASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIA
FT                   VLVRQELVLVIMGGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISMVLVLIGLATLKVR"
FT   CDS_pept        596916..598244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0612"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93376"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93376"
FT                   /db_xref="GOA:Q7MNV3"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNV3"
FT                   /protein_id="BAC93376.1"
FT                   /translation="MDRWQDIKQVVVVGLGITGLSVVRHLRKTQPQLQVKVIDTRPTPP
FT                   GVEQLPPDIALHVGSWNEAWLAEADLVVTNPGIALATPQIQTVLARGVAVVGDIELFAW
FT                   AADKPVIAITGSNGKSTVTDLTGVMANACGVKCAIGGNIGVPALDLLEQEVELYVLELS
FT                   SFQLETTTSLHLVAAAFLNLSEDHMDRYQGMDDYRQAKLRIFQHAKHGVVNRDDRQTYP
FT                   ETSHGQQSLALVTFGSDDKEFGVMSHQGESWLSYNQQPILASRELKLVGQHNVANVLVV
FT                   LALLTCAGIDYRKGLSALKSYTGLTHRCQVVADNRGIKWVNDSKATNLASTQAALSGLN
FT                   CAGKLYLLVGGDGKGADFSPLKPILAQLNLQLCCFGADGDQFMPLHASATRFERMEDVI
FT                   EHISPQLQSGDMVMLSPACASFDQFSNFMARGDRFAELARQYA"
FT   CDS_pept        598283..599482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0613"
FT                   /product="bacterial cell division membrane protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93377"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93377"
FT                   /db_xref="GOA:Q7MNV2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNV2"
FT                   /protein_id="BAC93377.1"
FT                   /translation="MVMVGNIKNNLFGWFRHSPPDALFDRQLVWIALCLMLTGLVMVTS
FT                   ASFPISSRLTDQPFHFMFRHATFLCLALGTSAVVLQIPLQKWQSHSHYLLGIAFALLVV
FT                   VLIAGKSVNGASRWIPLGLFNLQPAEVAKLALFIFMSGYLVRKQDEVRATFFGGFMKPI
FT                   MVFGALALLLLGQPDLGTVVVMLVTLFGMLFIAGAKLSQFLALMVAGITAVVGLILIEP
FT                   YRVRRVTSFLDPWEDPFGSGYQLTQSLMAFGRGEWFGQGLGNSIQKLEYLPEAHTDFVF
FT                   AVMAEELGFIGVVLILALIFSLVIKAVFIGKKAFEHQLQFGGYLAFGIGIWFAFQTLVN
FT                   VGAAAGMVPTKGLTLPLISYGGSSLIIMSIAVSILLRIDHECRLISMGNKTDLQTDEKE
FT                   "
FT   CDS_pept        599415..600536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0614"
FT                   /product="UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93378"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93378"
FT                   /db_xref="GOA:Q7MNV1"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNV1"
FT                   /protein_id="BAC93378.1"
FT                   /translation="MIMNADLSRWAIKQTYRQMKKNKRLMVMAGGTGGHVFPGLAVAKK
FT                   LQQQGWEIRWLGTADRMEAELVPKHGIDIDFIKVKGLRGQGIKRLVLAPFQILNAIFQA
FT                   KAHIKRWQPDAVLGMGGYVSGPGGIAAWLSGIPVVLHEQNAVAGLTNHWLAKIAKKVFQ
FT                   AFPGAFKDAPVVGNPVREDVVALPDPMQRMQDREGAVRILVMGGSQGARILNQTMPQVM
FT                   AQLGSGFEIRHQAGKGSADEVRLAYQQVGVEHVEVSEFIDDVAAQYAWADLLVCRSGAL
FT                   TVSEVSAAGVGAIFIPFMHKDRQQALNADHLVACGAALMIEQPQLTVDKLAGEIQKLGR
FT                   DTLLSMALHARAAAQNNADQVVADAIVALTEQK"
FT   CDS_pept        600550..602010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0615"
FT                   /product="UDP-N-acetylmuramate-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93379"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93379"
FT                   /db_xref="GOA:Q7MNV0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNV0"
FT                   /protein_id="BAC93379.1"
FT                   /translation="MTIQHKQDLAQIRAMVPEMRRVKSIHFIGIGGAGMSGIAEVLLNE
FT                   GYQITGSDIAENAVTERLAQKGAKVYIGHQATNVAEASVVVVSTAINEANPEVKAAREA
FT                   RIPVVRRAEMLAELMRFRHGIAVAGTHGKTTTTALVTQIYSEAGLDPTFVNGGLVKSAG
FT                   TNARLGSSRILIAEADESDASFLHLQPMVCIVTNIEADHMDTYGGDFETLKQTFIDFLH
FT                   NLPFYGQAIVCIDDPVIRELIPRISRQVITYGFSEDADVRIENYHQEGQQGKFTVVRKD
FT                   CEALDITLNIPGRHNALNAAAAIAVATEDEIGDDAILAAMIGTQGTGRRFEHLGEFETG
FT                   NGNVMLVDDYGHHPTEVDVTIHAARNGWQDKRLVMIFQPHRYSRTRDLYDDFANVLEQV
FT                   DVLVMLDVYAAGEKAIAGADSRSLCRTIRSRGKIDPIFVADTQQLPEVLANILQEGDLL
FT                   LAQGAGDIGKVARQLAALELNISNMKAK"
FT   CDS_pept        602202..602969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0616"
FT                   /product="cell division septal protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93380"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93380"
FT                   /db_xref="GOA:Q7MNU9"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNU9"
FT                   /protein_id="BAC93380.1"
FT                   /translation="MTEIAVDEADVLPSHWKRQKHQIIGAAFFVLVVALIGSILYSTLS
FT                   WMWDDQRLPLSKIILQGDLQYVTADDVQHAFGSITHIGTFMSQDVSVLQESVEALPWVA
FT                   HASIRKQWPDTVKVFITEHRAAAIWNGNALLNQDGMVFDGDVAQLNEERVKLYGPVATG
FT                   VEVLKKYREMNPEFSKLGLSISSLVLNDRRAWQIILDNGIRLELGKESLDERVARFFSL
FT                   YRQLGSKADKVSYVDLRYDTGAAVGWFPEQESE"
FT   CDS_pept        602905..604242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0617"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93381"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93381"
FT                   /db_xref="GOA:Q7MNU8"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNU8"
FT                   /protein_id="BAC93381.1"
FT                   /translation="MLTSGMTREPLLAGSLSKSQNKRVQMTKTADDNIIVGLDIGTATV
FT                   SALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKSVQRAIDQAEMMAECQISNV
FT                   FISLSGKHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIKIGDEQRILHVIPQEFTID
FT                   YQEGIKNPLGLSGVRMEVSVHLISCHNDMARNIIKAVERCGLKVEQIVFSGLAASNAVI
FT                   TEDERELGVCVVDIGAGTMDVAIWTGGALRHTEVFSYAGNAVTSDIAFAFGTPVSDAEE
FT                   IKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPRYSELMGLVNQTIESV
FT                   QMKLREDGIKHHLAAGVVLTGGAAQIEGLVECAERVFRNQVRVGKPLEVSGLTDYVKEP
FT                   YHSTAVGLLHYARDMRSSDDSDYNEPKRSAVTGLFGKLRNWIQKEF"
FT   CDS_pept        604275..605489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0618"
FT                   /product="cell division GTPase FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93382"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93382"
FT                   /db_xref="GOA:Q7MNU7"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNU7"
FT                   /protein_id="BAC93382.1"
FT                   /translation="MFEPMMEMSDDAVIKVVGVGGGGGNAVEHMVRESIEGVEFISVNT
FT                   DAQALRKTSVGNVIQIGGNITKGLGAGANPQVGRDAALEDKERIKELLIGADMVFIAAG
FT                   MGGGTGTGAAPVIAEVAKELGILTVAVVTKPFSFEGKKRLAFAEQGIDELSKHVDSLIT
FT                   IPNEKLLKVLGRGITLLEAFASANDVLKNAVQGIAELITRPGMINVDFADVRTVMSEMG
FT                   HAMMGSGVAKGEDRAEEAAEMAISSPLLEDIDLAGARGVLVNITAGLDMRLDEFETVGN
FT                   TVKAFASDNATVVIGTSLDPDMADEIRVTVVATGIGNDKKPDITLVSGGKAKVAQPTAA
FT                   PQPVVAAKVEEKPAQTLQERPQVTPQPSTPVSSSPASGSQNTAPKQEKESGYLDIPAFL
FT                   RRQAD"
FT   CDS_pept        605588..606505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0619"
FT                   /product="UDP-3-O-acyl-N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93383"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93383"
FT                   /db_xref="GOA:Q7MNU6"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNU6"
FT                   /protein_id="BAC93383.1"
FT                   /translation="MIRQRTLKEIVKTTGVGLHSGRKVTLTLRPAAANTGIIYRRTDLT
FT                   PAVDFPADPASVRDTMLCTALVNDEGVRISTVEHLNAALAGMGIDNIIIEVDAPEIPIM
FT                   DGSASPFVYLLQQAGIETQNAAKRFIRIKKPVRFEDGDKWAEFVPFNGFRMDFEIEFNH
FT                   PAIDSDEQRLLFDFSTQGFVREISRARTFGFMRDIEYLQSQNLVLGGSFDNAIVLDDYR
FT                   ILNEEGLRFENEFVTHKVLDAIGDLYMCGHAIIGEFRAYKSGHGLNNQLLRAVLADQEA
FT                   WEWTTFEEEVGSPVAFAEPNMVLA"
FT   CDS_pept        complement(606579..607046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0620"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93384"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93384"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNU5"
FT                   /protein_id="BAC93384.1"
FT                   /translation="MPIMRDHRPTSTQELIDGSGSSLQKIQHHACEILELNKVLAELLP
FT                   NGTAQHCRAANLRQGCLILDVASAAIKMKIDYDRLTILNALRSRGFAKLMAIEVRINPG
FT                   LYQQKDPKDQKKREPISQNAANALTMIAEMAPPKVKARLERLAAMAEKKSS"
FT   CDS_pept        607369..610092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0621"
FT                   /product="preprotein translocase subunit SecA"
FT                   /note="ATPase, RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93385"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93385"
FT                   /db_xref="GOA:Q7MNU4"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNU4"
FT                   /protein_id="BAC93385.1"
FT                   /translation="MITKLLTKVIGSRNDRTLRRLRKIVKEINNYEPTFEALSDEQLKA
FT                   KTVEFRQRLEQGETLDQLLPEAFATVREASKRVYGMRHFDVQLIGGMVLNAGQIAEMRT
FT                   GEGKTLTATLPAYLNALAGKGVHIVTVNDYLAKRDAETNRPLFEFLGMTVGINVPNMPH
FT                   PAKKEAYQADILYGTNNEFGFDYLRDNMAFRNEDRVQRERFFAVVDEVDSILIDEARTP
FT                   LIISGPAEDSSELYTRINALIPLLQKQDKEDSEEYRGDGHYTVDEKSKQVHLTETGQEF
FT                   VEELMVKNGLMEEGDTLYSPTNISLLHHVNAALRAHVLFEKNVDYIVNEDGEVVIVDEH
FT                   TGRTMPGRRWSEGLHQAVEAKEGVKIQNENQTLASITFQNYFRLYEKLSGMTGTADTEA
FT                   FEFQSIYGLETVVIPTNKPMIRNDMPDVVYRTEAEKFAAIIEDIKARVEKGQPVLVGTV
FT                   SIEKSELLSNALKKAKIKHNVLNAKFHEKEAEIVAEAGKPGAVTIATNMAGRGTDIVLG
FT                   GSWQAKVESMANPTQEQIDEIKAEWKLVHDQVLESGGLHIIGTERHESRRIDNQLRGRS
FT                   GRQGDAGSSRFYLSMEDSLLRIFTSDRMAALIQSGMEEGEAIESKMLSRSIEKAQRKVE
FT                   GRNFDIRKQLLEYDDVANDQRKVVYELRDELMSVDDISDMIEHNRVDVLQGVIDEYIPP
FT                   QSLEDMWDLEGLQERLKNDFDIDAPVKQWLEEDDKLYEEALREKVIDTAVEVYKAKEEV
FT                   VGAQVLRNFEKSVMLQTLDTLWKEHLAAMDHLRQGIHLRGYAQKNPKQEYKRESFELFE
FT                   GLLETLKSDVVMILSKVRVQQQEEVERMEAQRRAQAEEAARRAQAQHASAQSQLADDSD
FT                   EGHHQPVVRDERKVGRNEPCPCGSGKKYKQCHGQIN"
FT   CDS_pept        610155..610556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0622"
FT                   /product="NTP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93386"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93386"
FT                   /db_xref="GOA:Q7MNU3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNU3"
FT                   /protein_id="BAC93386.1"
FT                   /translation="MMKRIHIVAAIIFNQDKSQVYITKRPDDKHKGGFWEFPGGKVEEG
FT                   ESIEQAMVRELEEEIGITATQQQLFEHLEYDYPDKSLKFDFITVTDFNGQPYGREGQQG
FT                   EWVAIAELSRYPFPEANVPILERVLKEFA"
FT   CDS_pept        610649..611458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0623"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93387"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93387"
FT                   /db_xref="GOA:Q7MNU2"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNU2"
FT                   /protein_id="BAC93387.1"
FT                   /translation="MVRIAVAGAAGRMGRNLVKAAHHNPAAKVAAGSERPESSLVGVDL
FT                   GELCGECKFDVVVCDDLAKQIDQFDVIIDFTAPASTLNNLALCQQYGKSIVIGTTGFTE
FT                   EQREQIDLVAQQVPVVMAPNYSVGVNLVFKLLEKAAKVMGDYCDIEIVEAHHRHKVDAP
FT                   SGTAIGMGEAIAGAMGNKLSDVAVYAREGITGERTKDEIGFATIRAGDIVGEHTAMFAD
FT                   IGERVEITHKATDRMTFANGAVKAAVWLHEKPAGFYTMTDVLGLNDL"
FT   CDS_pept        611941..613080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0624"
FT                   /product="carbamoylphosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93388"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93388"
FT                   /db_xref="GOA:Q7MNU1"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNU1"
FT                   /protein_id="BAC93388.1"
FT                   /translation="MSKSALLVLEDGTVFRGVSIGADGISVGEVVFNTSMTGYQEILTD
FT                   PSYSQQIVTLTYPHIGNTGTTSEDEESSSIHAQGLVIRDLPLIASNFRSEQSLSDYLKS
FT                   QNIVGIADIDTRKLTRILREKGAQNGCIVAGNNLDEALALAKAKEFPGLKGMDLAKEVT
FT                   TKEAYQWKQGSWTLEGGLPEAKDDSELPYHVVAYDFGAKRNILRMLVDRGCRLTVVPAE
FT                   TSAEDVLALNPDGVFLSNGPGDPAPCTYAIEATKVFLEKGLPVFGICLGHQILALASGA
FT                   KTVKMKFGHHGANHPVKDLDRNVVMITSQNHGFAADEATLPDNLRATHVSLFDGSLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIKQHSA"
FT   CDS_pept        613097..616330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0625"
FT                   /product="carbamoylphosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93389"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93389"
FT                   /db_xref="GOA:Q7MNU0"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNU0"
FT                   /protein_id="BAC93389.1"
FT                   /translation="MPKRTDIQSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPDMADATYIEPIQWEVVRKIIEKERPDAVLPTMGGQTALNCALALEK
FT                   HGVLAEFGVEMIGATADAIDKAEDRSRFDKAMKSIGLECPRADTAKTMEEAYKVLDMVG
FT                   FPCIIRPSFTMGGTGGGIAYNKEEFEEICRRGLDLSPTNELLIDESLIGWKEYEMEVVR
FT                   DKADNCIIVCSIENFDPMGIHTGDSITVAPAQTLTDKEYQLMRNASLAVLREIGVETGG
FT                   SNVQFGINPKDGRMVIIEMNPRVSRSSALASKATGFPIAKIAAKLAVGFTLDELQNDIT
FT                   GGATPASFEPTIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRNQQESLHKAL
FT                   RGLEVGATGFDEMVDLDSPDALTKIRHELKEAGAERIWYIADAFRAGMSVDGVFNLTNI
FT                   DRWFLVQIEEIVKLEEQVKAGGFAGLTQDVLRQMKRKGFSDARLSKLLGVAESEIRRLR
FT                   DQFDIHPVYKRVDTCAAEFSSDTAYMYSSYDDECEANPTDKEKIMVLGGGPNRIGQGIE
FT                   FDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLAIARVEKPK
FT                   GVIVQYGGQTPLKLARALEAAGVPIIGTSPDAIDRAEDRERFQQAVDRLGLLQPENATV
FT                   TTMEQAVEKSREIGFPLVVRPSYVLGGRAMEIVYDEQDLRRYFNEAVSVSNESPVLLDR
FT                   FLDDAIEVDIDAICDGERVVIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDKMREQV
FT                   EKLAFELGVRGLMNTQFAVKDNEVYLIEVNPRAARTVPFVSKATGAPLAKIAARVMAGQ
FT                   SLESQGFTKEIIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGATFAEAYAKA
FT                   ELGCGNVYPEGGRALLSVREGDKQRVVDLASKLLKLGYKLDATHGTAVILGEAGINPRL
FT                   VNKVHEGRPHILDRIKNNEYTYIVNTAAGRQAIEDSKVLRRGALAEKVNYTTTLNAAFA
FT                   TCMSHTADAKASVTSVQELHAQVQASLKA"
FT   CDS_pept        complement(616450..616869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0626"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93390"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNT9"
FT                   /protein_id="BAC93390.1"
FT                   /translation="MGQIMEKTILLFLLLFFSSFTYTAQEKDGIPPSIVYDHTIALEHL
FT                   ASITSSLNSYREMTEMVDSQLKEKVDNTSWEMQNIGFPNWTNYIKGTLLKQNLRIAELE
FT                   REQASTPEEIRKRQNDLQQARKEYEDFTQRHQVVD"
FT   CDS_pept        complement(616857..617540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93391"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93391"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR013230"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNT8"
FT                   /protein_id="BAC93391.1"
FT                   /translation="MTNITLSGSVGISGKNQRKDIMAVQEALNLVNSSNPVLKPLVVDG
FT                   KLGIKPEKSKTVNAIIQFQKKYVHLQNPDGRIDVHGKTHVKLSSAILKLKAHQNSSILT
FT                   AHFKWSEFSCNDKDNTPVPQDLRTNVKNLASQLEVIRSEIGKPIKITSAYRTPEYNRKI
FT                   GGATNSLHVTGKAADLQVSGVKPKDLYEKIISLINNGKITQGGVGLYTSFVHYDIRGTS
FT                   ARWGK"
FT   CDS_pept        617771..617893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0628"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93392"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93392"
FT                   /db_xref="GOA:Q7MNT7"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNT7"
FT                   /protein_id="BAC93392.1"
FT                   /translation="MQLGNNHEKVEWIAVLGFVFTSLVLMLTSCSLLFLFEKDA"
FT   CDS_pept        617886..618674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0629"
FT                   /product="predicted permease"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93393"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93393"
FT                   /db_xref="GOA:Q7MNT6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNT6"
FT                   /protein_id="BAC93393.1"
FT                   /translation="MLELDITIEMLAALFFVASVAGFIDAMAGGGGLLTLPALLASGLS
FT                   PTQALATNKLQSSFGSFSASLYFVRNGIVSLKEMKVAIACTFIGAAIGAELVQVIDASV
FT                   LTSLIPVLLIAISLYFLLAPPTRNTGGQPKLSEAMFALSVGGGVGFYDGFFGPGTGSIF
FT                   TVCFVVLGQFSLVEATARTKVLNFTSNIAALLFFVLAGLPVWKVGLVMAVGGFIGARLG
FT                   AKVVVTKGHKWIRPLVIVMSMAMASKLLWQQHQQWLLSLF"
FT   CDS_pept        complement(618625..619470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0630"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93394"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93394"
FT                   /db_xref="GOA:Q7MNT5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNT5"
FT                   /protein_id="BAC93394.1"
FT                   /translation="MLLEGIETLLVLHKEKTMSRTGSQLYISQSAVSKRIANLEKKLGK
FT                   KLIEPDGRHIRLTADAQALIKSIEPSFNELRGQIYDQQLIEDNALIKIDCSETLLAGYL
FT                   NNAMEALYQQDRHLSLTTNHTPRIVEHVQSGKATLGFCAGYLPPNHGLMTFHLFDESFS
FT                   IISKYPLTELPKAIITNDLNNPANTYQLAALSAVGVTPLMQMDSYTASAQLAVGGMAPA
FT                   LVPKSVINALRIEPQYCYHFDELSHLTRPVTICCRAKSHQNSRVKTVITTIADAVAKVV
FT                   "
FT   CDS_pept        complement(619451..619579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0631"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93395"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93395"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNT4"
FT                   /protein_id="BAC93395.1"
FT                   /translation="MLADFIGQRHASLAFALAAESLLAKVNYLFPLVINHYVTRRH"
FT   CDS_pept        complement(619583..620248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0632"
FT                   /product="predicted membrane protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93396"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93396"
FT                   /db_xref="GOA:Q7MNT3"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNT3"
FT                   /protein_id="BAC93396.1"
FT                   /translation="MPPFSVPSLFKALSNMDSMLLYFIDLFGTAVFAVSGVLLAGRLKM
FT                   DPFGVVVLGSVTAIGGGTIRDMALGATPVFWIKDTTYLWVIIVTCLLTMLVVRRPKRLA
FT                   WWILPVCDAIGLAVFVGIGVEKALAYQDSAMVAVIMGVITGCGGGIIRDVLAREIPMVL
FT                   RSEVYATACLVGGIFHTSALSLGYDHSTALLAGVFSTLIIRLGAIRWHLSLPTFALNK"
FT   CDS_pept        complement(620275..621096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0633"
FT                   /product="ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93397"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93397"
FT                   /db_xref="GOA:Q7MNT2"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNT2"
FT                   /protein_id="BAC93397.1"
FT                   /translation="MMKTLSSLLLLFSVSLQAAPIERVISLAPHATEIAYAAGLGDKLI
FT                   AVSEMSDYPEAAKKLEKVSNYKGINLEKIITLKPDLILAWPAGNPAKELEKLEQFGFKI
FT                   YYSQTKSLKDIGDNIEQLSQYSDDPQIGLNNARDYRTHLEALRAKYQNLPKTRYFYQLS
FT                   DTPIITVAGQNWPTEVFRFCGGENVFDGASAPYPQVSIEQVILKRPQAMFVSPHAIQNN
FT                   GMWSPWVEEIPALKNAHFWQLNSDWLNRPTPRTLLAIEQVCEHFASIEQKR"
FT   CDS_pept        complement(621093..622046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0634"
FT                   /product="putative cobalamin biosynthesis protein CbiB"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93398"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93398"
FT                   /db_xref="GOA:Q7MNT1"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNT1"
FT                   /protein_id="BAC93398.1"
FT                   /translation="MTELFDQLYANGALLILWGALLFHLILPIPRSSHPVTLWHKFAEL
FT                   LADKVNTQQSYQQSLISGNLALLLMLFPCLAVLFALKPLVWQPQLFELALLLLALDWRS
FT                   NESLAKALIRAMANEDKPAARSLLAPYLNRETNALSQLGIGKAAAETLIMGYGRNVVGV
FT                   LFWFALSGGIGALMYRLTVELARAWSPSRANYAPFGVAAMRFAAVLDFIPLRLFALMIL
FT                   LGKHTGQTWQGMRQQVASWPLPGPAWLLCAVGNKLQLSLGGPAIYQGKRAERAKIGGRI
FT                   APFALHIDQLQHLLARRILVWILLQSLLMGLIYQGI"
FT   CDS_pept        complement(622058..622753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0635"
FT                   /product="nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93399"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93399"
FT                   /db_xref="GOA:Q7MNT0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNT0"
FT                   /protein_id="BAC93399.1"
FT                   /translation="MKVGIIGAMQQEVAILKEAMTNAQTVNKAGCTFYSGQINGVEVVL
FT                   LQSGIGKVAAAIGTTILLDEYQPDMVLNTGSAGGFDSSLNLGDVVISTEVRHHDADVTA
FT                   FGYEMGQMAGQPAAFLADEKLMNLAEKALEQMDGQHAVRGLICTGDAFVCTAERQAFIR
FT                   QHFPSVIAVEMEASAIAQTCHQFKVPFVVVRAISDVADKESPMSFEEFLPLAAKSSSEM
FT                   VFKMLELLK"
FT   CDS_pept        complement(622850..623278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0636"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93400"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93400"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNS9"
FT                   /protein_id="BAC93400.1"
FT                   /translation="MKKLILTICATLALTACSNGAYTMTDRTSQPCGNKPNCVSTQDER
FT                   ASFQLDPFKLTSNATLDQIEQVALELPGAKVADKKEHYLRVECTSRLFRFVDDLELKIV
FT                   DGQLLVRSESRVGYSDLGVNRKRAEQLRSLLTEAGFIK"
FT   CDS_pept        complement(623175..623300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0637"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93401"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93401"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNS8"
FT                   /protein_id="BAC93401.1"
FT                   /translation="MGTVGVQDEKTHFNDLRHLSPDRLQQWSLHNDRSNFSALWQ"
FT   CDS_pept        complement(623391..624809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0638"
FT                   /product="NADPH-dependent glutamate synthase, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93402"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93402"
FT                   /db_xref="GOA:Q7MNS7"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNS7"
FT                   /protein_id="BAC93402.1"
FT                   /translation="MNMSQNVYQFIDVQRVDPAKKPLQIRKIEFVEIYEPFTKQQATAQ
FT                   ADRCLDCGNPYCEWKCPVHNYIPQWLKLANEGRILEAVELSHQTNSLPEVCGRVCPQDR
FT                   LCEGSCTLNDDFGAVTIGNIEKYITDKAFEMGWKPDMSKVEWTDKKVAIIGAGPAGLAA
FT                   ADILVRNGVKPVVFDRYPEIGGLLTFGIPSFKLEKGVMENRRRIFSEMGVEFRMNVEVG
FT                   KDVQMQELLEEYDAVFLGVGTYKYMRAGLENEDASGVYDALPFLISNTYKVMGLEYDQP
FT                   FIDMAGKNVVVLGGGDTAMDCVRTSIRQGAANVVCAYRRDEENMPGSRREVKNAKEEGV
FT                   NFMFNLQPLSIDVDTRGQVTGVKVVQTALGEPDEAGRRRPEPVAGSEHVLPADVVIMAF
FT                   GFQPHQMSWLEPYGVELDQWGRIKAAAKQTYQFQTSNEKIFAGGDAVRGSDLVVTAIDE
FT                   GRKAAEGILDYLEL"
FT   CDS_pept        complement(624822..629333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0639"
FT                   /product="NADPH-dependent glutamate synthase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93403"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93403"
FT                   /db_xref="GOA:Q7MNS6"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNS6"
FT                   /protein_id="BAC93403.1"
FT                   /translation="MLVFLSGRQRSKGRIAMALYDPSLEKDNCGFGLIAHMEGEPSHKL
FT                   VRTAISALDRMTHRGGIAADGKTGDGCGLLLQKPDSYLRLIAKENSFNLAKQYAIGMIF
FT                   FSQDPVKAQTARDIINKELAKETLTVAGWRKVPTNPAVLGPIAADSLPDIQQVFISAPA
FT                   GWRERDIERRLYIARRRIEKQITDDRDFYVCSLSTQVIVYKGLCMPADLPRFYLDLADL
FT                   RMESAICLFHQRFSTNTQPRWPLAQPFRYLAHNGEINTIEGNRQWARARGYKFASPLLP
FT                   DLQSAAPFVNETGSDSSSLDNMLDLFLAGGMDIFRAMRMLVPPAWQNHPDMDPDLRAFY
FT                   DFNSKHMEPWDGPAGIVLSDGRYAACNLDRNGLRPARYVITKDKLITLASEVGIWDYAP
FT                   DEVAEKGRVGPGELLVIDTRKGKLWQSSEIDNDLKSRHPYREWMDNNVRRLTPFSELPE
FT                   DQVGERSFDSDTLKTYQKQFAMSNEEVDQVLRVLGDMAQEAVGSMGDDTPMAVLSSKER
FT                   LVTDYFRQKFAQVTNPPIDPLREQHVMSLATSIGQEMNVFCETDGHAHRVTFGSPVLLY
FT                   SDMQQLLELSDDHYRNTILDINYDPSEKDLKQAILDLCDQAEQVVRDGTVLIVLSDRPL
FT                   VAGKLPIPAAMAVGAVQTRLVNANLRCDANIVVETATARDPHQFAVLLGFGATAVYPYL
FT                   AYEVLGKLIDDGALEKSYREVMQNYQYGINKGLYKIMSKMGISTVASYRCSQLFEAVGL
FT                   SRDVVELCFKGVTTRIEGAGFADFQQDLFNLSRKAWAKRKSIEHGGLLKYVHGGEYHAY
FT                   NPDVVGTLQKAVKSGESGDYQQFAQQVNQRPVAMLRDLMQLKKADQPLALDKIEPSTEL
FT                   FKRFDSAAMSIGALSPEAHEALATAMNRLGGYSNSGEGGEDPRRFGTERNSRIKQVASG
FT                   RFGVTPHYLTNADVLQIKVAQGAKPGEGGQLPGHKVTAEIAKLRYSVQGVTLISPPPHH
FT                   DIYSIEDLAQLIFDLKQVNPKALVSVKLVSEPGVGTIATGVAKAYADLITISGYDGGTA
FT                   ASPLTSVKYAGSPWELGLAETQQALVANGLRHKIRLQVDGGLKTGLDVVKGAILGAESF
FT                   GFGTAPMVAMGCKFLRICHLNNCATGVATQDETLRKEYFKGLPEMVMNYFIGLADEVRG
FT                   LLAELGVEKLTDLIGRTDLLEVVQGMTAKQSKLDLSGILEAPVSPQNLPLFWTEPNAPF
FT                   DKAVLNQKIIEDALDAVENRQSASFFYNVINTDRSIGARLSGEIAKRYGNQGMAASPIK
FT                   LYLDGTAGQSFGVWNAGGVELYLTGDANDYVGKGMAGGKIVIKPHLGTAFRCNDATIIG
FT                   NTCLYGATGGKLFAAGKAGERFGVRNSGTITVIEGAGDNACEYMTGGIVAILGATGVNF
FT                   GAGMTGGFAYVLDENEDFQGRVNSESVEAISLSDLYIHQEHLRGLIAEHLEETGSVHAE
FT                   DILANFDAWIPKFYLVKPKAADLNTLLGHQSRSAAELRVQAQ"
FT   CDS_pept        complement(629715..631184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0640"
FT                   /product="NADPH-dependent glutamate synthase, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93404"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93404"
FT                   /db_xref="GOA:Q7MNS5"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNS5"
FT                   /protein_id="BAC93404.1"
FT                   /translation="MGKPTGFLEFGRELPKKLAPAERIKNNKEFVLNAEFGKKINTQAS
FT                   RCMDCGVPFCHNGCPIGNIIPEFNDAVYRDSWEEAWNILSSTNNFPEFTGRVCPAPCES
FT                   ACVLGINQDPITICNIEKTIVETAYREGYAKPKTPRSRTGKKVAIIGSGPAGLAAAEQL
FT                   NSAGHSVTVFERDEKVGGLLRFGIPDFKLGMDIIDRKINLMAEAGVEFKVNQHVGVDVN
FT                   AQQIRQEYDVVLLTGGSTVPRDLPVPGRELKGVYFAMQFLAQNNRRANEMDLKGEEIHA
FT                   AGKHVVVIGGGDTGSDCVGTSNRHGAASVTQVEIMPVPPEKRPANMPWPQYPMILRTST
FT                   SHEEGVDRHWNILTKEFIGNDKGEVTGLRLADIVWQDAQPGERPSFKEVEGSERVIPCD
FT                   MAFLAMGFLHPEPHGVLAQLNVALDERGNVATQDFQTNQQGVFAAGDMRTGQSLVVRCI
FT                   NEGRECARAIDQYLMGNTNLEAKADSLMLSA"
FT   CDS_pept        complement(631184..635722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0641"
FT                   /product="NADPH-dependent glutamate synthase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93405"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93405"
FT                   /db_xref="GOA:Q7MNS4"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNS4"
FT                   /protein_id="BAC93405.1"
FT                   /translation="MVDREQSSQGLYTPELEHDACGIGFVAHLKNRKSHQVVTQALDML
FT                   ARMEHRGGQGCDPCSGDGAGILLQKPHEFLLEEAVKLGIKLPSFEKYGVGVVLFPKDEY
FT                   KREQCRDILERNAKRLDLDIIGYRVLPTDNSMIGADPLSTEPQFEHVFISGGPGTSPEE
FT                   LERKLYVLRNYTVRVCLESVSNIGDDFYINSMSYKTLVYKGQLTTEQVPQYFQDLQNPT
FT                   MVTALALVHSRFSTNTFPKWRLAQPFRYIAHNGEINTVRGNLNWMKAREAILESKLFTQ
FT                   AEIDMLLPICQEGASDSANFDMVLELLVLSGRSLPHALMMMIPEAWQENKTMDPKRRAF
FT                   YQYHANIMEPWDGPASVCFTDGVQVGATLDRNGLRPSRYTVTKDNMLIMASESGVVEIP
FT                   PENVEYRGRLQPGRIFVADLEQGRIISDEEVKDSIANAQPYEQWVTDNLLSLKSLPDAD
FT                   NVHSQPSPERLLHRQQAFGISAEEVNEIILPLAQTGYEPLGSMGADWPVAILSHQSQHL
FT                   SNYFKQLFAQVTNPPIDPIRERMVMSLNTYIGKDQNLLAESPVHCRKVELESPVISNAE
FT                   LEKLRAIDNEHLQAKTLDIVFQANEDAGKLERALKRICQYAEDAVIDGYSIILLTDRAV
FT                   NSNHAAIPAMLAVGAVHHHLIRKGLRAKCGIVVETGDARETHHFATLVGYGANAVNPYL
FT                   VTETIVDLQRRKKLDANVSVEEYFNNYRKGVNGGLLKIFSKMGISTLQSYHGAQIFEAL
FT                   GISKAVVDKYFTGTVTRIQGLTLDDIAKEVLVRHRVGYPTREIPIQMLDVGGVYQWKQR
FT                   GEKHLFNPETIHLLQHSTRNKDYAEFKKYAAEVDRQGDNAVTLRSQLDFVKNPAGSIPI
FT                   DEVEPVESIVKRFATGAMSFGSISYEAHSTLAVAMNRLGAKSNSGEGGEDPIRFSPNEN
FT                   GDSERSAIKQVASGRFGVTSYYLTNSDEIQIKMAQGAKPGEGGQLPGDKVDDWIGATRH
FT                   STPGVGLISPPPHHDIYSIEDLAQLIYDLKNANRKGRVNVKLVSEAGVGTIASGVAKAK
FT                   ADVVLIAGHDGGTGASPISSIRHTGLPWELGLAETHQTLLKNGLRNRIVVQADGQMKTP
FT                   RDIAIATLLGAEEWGVATAALVVEGCIMMRKCHKNTCPVGIATQNKTLRERFDGRVEDV
FT                   VTFFLYMAQGVREIMAELGFRTVDEMVGQAQKLKVRDNVSHWKYKNLDLSPVLFLEQPR
FT                   EQDGIYCQTKQNHQLEAVLDRQLIQVATPALEDGLAVTAEFPIINTDRSVGTMLSNEIS
FT                   KVYKDQGLPQPMNVKFKGSAGQSFGAFLAKGVTFEVEGDANDYWGKGLSGGTLVLYPDS
FT                   NSTLVPEDNIVVGNVCFYGATSGESYIRGLAGERFCVRNSGAKVVVEGVGDHGCEYMTG
FT                   GVAIILGSTGRNFAAGMSGGVAYVWDKSGDFQSKLNPELVDLDPIEQEDKDLLLDMLNK
FT                   HVQFTGSEVAQAFLANFETSLKSLVKVMPRDYKAVLQKRKAEAEQREAEAV"
FT   CDS_pept        636236..637228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0642"
FT                   /product="predicted Fe-S oxidoreductase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93406"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93406"
FT                   /db_xref="GOA:Q7MNS3"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNS3"
FT                   /protein_id="BAC93406.1"
FT                   /translation="MRLIAVYNWWFSMQLHELVNTIGQDLQRRYGEKVHKLTLHGGFSC
FT                   PNRDGTIGRGGCTFCNVASFADEQAQVKSIREQLTERAGEVHRAKKYLAYFQAYTSTYA
FT                   EVQVLKNMYEEALKAADIVGLCVGTRPDCVPDAVLDLLSDYVQQGYEIWLELGLQTASN
FT                   DTLKRINRGHDFECYAEITQRARALGIKVCTHLIVGLPKESRDDNFTTLEKVIEVGTDG
FT                   IKLHGLHIVEGSTMAKAWRAGKLDAPELEQYVEIACEMIRRTPPEVIFHRVSSAARRPT
FT                   LLSPLWCENRWLAMTEIGQYLAQHGGQGSALGHSFVYTKPQLKSGIHPQ"
FT   CDS_pept        637264..639069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0643"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93407"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93407"
FT                   /db_xref="GOA:Q7MNS2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNS2"
FT                   /protein_id="BAC93407.1"
FT                   /translation="MRMDKQFAWIAHLAEHYGAIILMAVFGYVVVRLLHLRYQRELDTL
FT                   ILDLMSPVLLVDLSGQHVLLANSAAMQQLGVRQLNRTYLFPATFAIEQLSNSLTSLSGR
FT                   QFSQLAFAWQASEHEHLDVALSGRKVYYRGQHCWLLNIQLNPSNRSRHMDDLDAFLVAQ
FT                   SALDSLSELICLKDNDGKILATNRAFELFWEGRRDEAIMPESRLMKGRQSERRWTTDPQ
FT                   GRSCLLEVNQSLLMTKAGEPIGTLSISHDVTEWHAMQQNLRDEMERRKDTEVALAQRDT
FT                   ILQNILEASPDSIGIFNENLVYQACNEPFVRALGIADVNDLIGKRLQDVVPGEMYQRLS
FT                   VTDSQVLHEGKSLRYIDKVLDSNGEYAWYDVVKSPFRDPASGTNGVLIMARDISERYLA
FT                   EQKLEAANLELEKLSFMDSLTQVSNRRRFDEQLNTLWFHHAREKLPLTIMLCDIDFFKE
FT                   FNDRYGHQAGDEALIQVATVFSQVVSRSSDCVARYGGEEFALLLPNTTAEGALKVAEKI
FT                   HAYIAESNIAHQGSKIAGRVTISIGLVSYIPSPEDVPDMGVALADSALYQAKSDGRNRT
FT                   CVHPISLSSGESPSTLAQGNPPYAN"
FT   CDS_pept        639275..641617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0644"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93408"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93408"
FT                   /db_xref="GOA:Q7MNS1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR014409"
FT                   /db_xref="InterPro:IPR027460"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040642"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNS1"
FT                   /protein_id="BAC93408.1"
FT                   /translation="MKPMKNLAQYYVDLLVKLGIVRFSMLLALALVALAVVVQVGITLV
FT                   LKGNVDDIDIVRSVFFGLLITPWAVYFLSVVVDQLEESRQRLSKLVSKLKDMRSRDQEL
FT                   NVQLQQNIEQLNQEIEERIRAEEAREEAMKDLENEVFQRERTQVELAERTALLRSFIDA
FT                   SPDLIYYRNAEGVFSGCNRAMEELTGKKEHQLVGLSPWDVYSKEVAQQIVDTDQQVFAN
FT                   NRALTYEQWLEYPDGRKHYFELRKVPFYSKDGRHLGLVGFGRDITERKRHEESLEKASR
FT                   DKTTFISTISHELRTPLNGIVGLSRMLLDTRLTDEQRKYMQTINVSAITLGNIFNDIID
FT                   MDKFDRRKLELLPAPLNFEDFVAEIESISALMAEQKGLRFDLERLSELPKAIEVDATRL
FT                   RQVIWNLISNAMKFTKEGGVVMTVSSEVEEDFATIIIEVEDTGIGIPEAELDKIFAMYY
FT                   QVKSGKDNLHAVGTGIGLAVSRQLINMMDGDITVSSEEGFGSTFTISIHVPVIESAPST
FT                   VDKPKTQLYLSIFMVEDIALNVTVARSLLESLGHKVTVAMTGDEAIRSFDPSRYDLVLL
FT                   DIQLPDMTGFDVAAYYRKHYSQLPPLVALTANVLKDKREYLDNGMDEAISKPLAVQAIQ
FT                   DVIEKLIIKQESTTIEMEEAEVVEITTSHVENHILDLVMLESYVEIVGPQPVLDSIRMF
FT                   EEMMPEYLEILDSNMIAKDQPGIVSEAHKIKGAAGSIGLKRIQSVAQKAQSPDMPAWWE
FT                   NIADWVEEIKNEYQNDIQILKSWLEQR"
FT   CDS_pept        641622..642071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0645"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93409"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93409"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNS0"
FT                   /protein_id="BAC93409.1"
FT                   /translation="MKKPLIALLPLLLLVGCTSEPNVSWQQDNRITIADTRIELASNLW
FT                   INQMPTLGESQQDNLHGALYLSSDRDLPASLTVSELTIKQGDQEWKIDGDLLELRTHSE
FT                   NKWEIAFVWQANFDPEKNVDLLVELDNHGKREWLVERNITIDKVF"
FT   CDS_pept        complement(642144..642860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0646"
FT                   /product="aerobic respiration control protein FexA"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93410"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93410"
FT                   /db_xref="GOA:Q7MNR9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNR9"
FT                   /protein_id="BAC93410.1"
FT                   /translation="MQTPQILIVEDEQVTRNTLKSIFEAEGYAVFEASNGDEMHHMLSE
FT                   NSINLVIMDINLPGKNGLLLARELREQADVALMFLTGRDNEVDKILGLEIGADDYITKP
FT                   FNPRELTIRARNLLSRSMSSSVMPEEKRSVEKYEFNGWVLDINSRSLISPSGDGYKLPR
FT                   SEFRALLHFCENPGKIQTRADLLKKMTGRELKPHDRTVDVTIRRIRKHFESVSGTPEII
FT                   ATIHGEGYRFCGDLEA"
FT   CDS_pept        643224..643631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0647"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93411"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93411"
FT                   /db_xref="InterPro:IPR021710"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNR8"
FT                   /protein_id="BAC93411.1"
FT                   /translation="MINNGETTVDASLWHAYSASFFHFNDEWQSDRFAIITAWNPASIL
FT                   QSKKENCISNQKLKTKINTRRFCSVLVADKACCWSEESFAVEINLNYALNLAREFKQNA
FT                   IYFVEQGELFLVSCLSDERKESLGPFDQRIR"
FT   CDS_pept        643660..644172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0648"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93412"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93412"
FT                   /db_xref="GOA:Q7MNR7"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNR7"
FT                   /protein_id="BAC93412.1"
FT                   /translation="MWQKFSQGGYMKDITPDICDQHEDKVTLLNLPLQNFGQKAAFFGE
FT                   IVTVRCYHDNSKVRDVLSENGKGKVLVVDGHGSCQKALLGDQLAILAIENDWEGVIVFG
FT                   AVRDVAQMSQMELGIKALGTSPFKTEKRGAGEVNVTLTMHNQMVQPKDYIYADWNGILI
FT                   SKELLQF"
FT   CDS_pept        complement(644169..644633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0649"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93413"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93413"
FT                   /db_xref="InterPro:IPR016895"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNR6"
FT                   /protein_id="BAC93413.1"
FT                   /translation="MKNWPILLLFFVFSHAYANNLPALNPTKTSPHKLFLTSESQTEES
FT                   FDVWNIDGGYAYQLFDSVDLYVGARVNNSQTANQSGFLSGVSYQISDRVVVKSTIRSFK
FT                   VQEESGTEHNGNFAAEVTSRVKISEQLDLHATLDLQEWQQGIEFGLGFRF"
FT   CDS_pept        644996..647563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0650"
FT                   /product="homoserine dehydrogenase, threonine-sensitive"
FT                   /note="aspartokinase I"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93414"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93414"
FT                   /db_xref="GOA:Q7MNR5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNR5"
FT                   /protein_id="BAC93414.1"
FT                   /translation="MLGQAAERKNKFQKKACIQQDTGLFLYRLKIIREEGMRVLKFGGS
FT                   SLADADRFLRAADIVANNAKQEEVSVVLSAPGKTTNKLVAVIESALKNGEAERQVDELD
FT                   TAFKQLLSDIKQQLPSLNGDAYLKQVADSLSQLRQFVHGIGLLGMCPDNVNARIISKGE
FT                   RVSIQLMKAVLEAKGHLVNLIDPVDYLLAHGDHLEGMVDVDVSTQNFRSNPLPQGHVHI
FT                   MPGFTAGNKHGELVTLGRNGSDYSAAVLAACLRADCCEIWTDVDGVYNCDPRLVEDARL
FT                   LKSLSYQEAMELSYFGASVLHPKTIAPIAQFHIPCLIKNSFNPQGAGTLIGQDTGEDNL
FT                   AIKGITTLNNLTMVNVSGPGMKGMVGMASRVFGAMSASGVSIVLITQSSSEYSISFCIE
FT                   AADRPLAEQALSDAFELELKDGLLEPVEFLTNVSIITLVGDGMRTSKGVASQFFASLAE
FT                   VSVNVIAIAQGSSERAISAVIPEDKISQAIKACHENLFNSKHYLDVFVVGVGGVGGELV
FT                   DQIQRQQAKLADKGIVIRVCGLANSKGLLLDSNGLPLEHWRDRMANASEAFSLASLIAT
FT                   VQRNHIINPVLVDCTSSDVIANQYAEFLAAGFHVVTPNKKANTASMAYYHQLRDVARSS
FT                   RRKLMYETTVGAGLPVIENLQNLISAGDELERFSGILSGSLSFIFGKLDEGMTLSEATN
FT                   IAKQNGFTEPDPRDDLSGMDVARKLLILAREAGMALELEDVEVDQALPPSFDDSGSVDE
FT                   FMARLPEADAYFKQLSAQAAEEGKVLRYVGEIIDGKCKVSIAAVDENDPMFKIKDGENA
FT                   LAFYSRYYQPIPLVLRGYGAGTQVTAAGVFSDVMRTLGWKLGV"
FT   CDS_pept        647567..648538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0651"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93415"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93415"
FT                   /db_xref="GOA:Q7MNR4"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNR4"
FT                   /protein_id="BAC93415.1"
FT                   /translation="MSSSDMAVVVYAPASIGNVSVGFDVLGAAVSPIDGTLLGDRVMVK
FT                   AGNEPFSLKTAGSFVAKLPSDPKENIVYDCWRVFARELDKKGLELKPLEMTLEKNMPIG
FT                   SGLGSSACSIVAALDALNQFHANPLDEMELLALMGEMEGQISGGVHYDNVAPCYLGGLQ
FT                   LMLEELGIISQEVPCFDDWYWVMAYPGIKVSTAEARAILPSQYRRQDVIAHGRHLAGFI
FT                   HACHSGQPELAAKMIKDVIAEPYREKLLPGFADARKYAASAGALATGISGSGPTLFSIC
FT                   KDQDVAQRVARWLEQNYVQNEEGFVHICRLDKKGSIVTGSEL"
FT   CDS_pept        648535..649815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0652"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93416"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93416"
FT                   /db_xref="GOA:Q7MNR3"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNR3"
FT                   /protein_id="BAC93416.1"
FT                   /translation="MKLYNIKENDEQVSFGQAVRQGLGRNQGLFFPAELPKFDDIDALL
FT                   AQDFISRSTAILSALIGDELAEDKVNSMVDAAFQFPAPIKQVKEGVYALELFHGPTLAF
FT                   KDFGGRFMAQSLAAVSDGGKITILTATSGDTGAAVAHAFYGMEDINVVILYPKGKISPL
FT                   QEKLFCTLGKNIHTVAINGDFDACQALVKQAFDDAELREEIGLNSANSINISRLMAQIC
FT                   YYFEAAAQMSKQERENLVVSVPSGNFGNLTAGLLAKALGLPIKRFIAATNANDTVPRYL
FT                   ETGKWDPKPTVATTSNAMDVSQPNNWPRIEELCRVKEWGLETLGKGAVSDEQSAQSVKD
FT                   LYSLGYLCEPHGAIAYRVLDQQLQEGETGLFLCTAHPAKFKEVVDDILGSDIDLPAPLA
FT                   KHAVMELLSEELDADFTALKEVLRRVQ"
FT   CDS_pept        complement(649939..650319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0653"
FT                   /product="acid-induced glycyl radical enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93417"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93417"
FT                   /db_xref="GOA:Q7MNR2"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR011140"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNR2"
FT                   /protein_id="BAC93417.1"
FT                   /translation="MMIQGIQITKAANDDLLNSIWLLDSEKNEARCVAAVSGYEADQIV
FT                   AINELGEFESREVAIEAAPRIEGGQHLNVNVLKRETLEDAVAHPEKYPQLTIRVSGYAV
FT                   RFNSLTPEQQRDVIARTFTESL"
FT   CDS_pept        650641..651522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0654"
FT                   /product="endonuclease IV"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93418"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93418"
FT                   /db_xref="GOA:Q7MNR1"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNR1"
FT                   /protein_id="BAC93418.1"
FT                   /translation="MTNSKNRFGNKFIGAHVSAAGGVDNAPLRAREIGANAFALFTKNQ
FT                   RQWVAKPLEEKTISAFKANCALLGFSPQQILPHDSYLINLGAPEAEKLEKSRLAFIDEM
FT                   ERCQLLGLNLLNFHPGSHLEKISEKACLYLIAESINLAHQAVPDVVAVIENTAGQGSNL
FT                   GWRFEHLAEIIEQVEDKSRVGVCLDTCHTFAAGYDLRTPEACEATFAEFERVVGMHYLR
FT                   AMHINDSKVKLASKVDRHHALGKGEIGWDCFEYIAKDSRFDSIPLILETIEPELWPQEI
FT                   EQLRKYHLSSIA"
FT   CDS_pept        651800..652504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0655"
FT                   /product="uracil DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93419"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93419"
FT                   /db_xref="GOA:Q7MNR0"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNR0"
FT                   /protein_id="BAC93419.1"
FT                   /translation="MVFNRILPMTQQLTWHDVIGAEKEQSYFQQTLNFVEAERQAGKVI
FT                   YPPAKDVFNAFRYTEFQDVKVVILGQDPYHGPNQAHGLCFSVLPGIKTPPSLVNMYKEL
FT                   AQDIQGFQIPAHGYLEAWAKQGVLLLNTVLTVEQGKAHSHASLGWETFTDKVIEAINQH
FT                   QQGVVFLLWGSHAQKKGRFIDRHKHVVLTAPHPSPLSAHRGFLGCKHFSQANQHLLDQG
FT                   KQAIDWQLPLSL"
FT   CDS_pept        652598..653167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0656"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93420"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93420"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNQ9"
FT                   /protein_id="BAC93420.1"
FT                   /translation="MLRRNAMMIERIRREHGYIVRMLAILRHKVELLKNEQPINYSLVA
FT                   EIVSYLSDHAEKVHHPKEDILYRHYLEHYGAQRTIENLELEHKELAKKTAAFADVMHMI
FT                   LNDAVVPQAMFIEQLEAFISSQRQHLDIEERLILPLIAESFTTQDWQQVESQWLVNEDD
FT                   PVFGETIADHYRQLAERVQQSEKEMI"
FT   CDS_pept        complement(653245..653562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0657"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93421"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93421"
FT                   /db_xref="InterPro:IPR021932"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNQ8"
FT                   /protein_id="BAC93421.1"
FT                   /translation="MMVCSVLIEIFIIPTQMRNLSWLCSEKLWYLVTAQALVIYVRWLM
FT                   DGFELDDLLDFETTSTTKTRSKPVKRKWREIEAMLDRRNLLKELRDMDMCHDYSLEDIK
FT                   L"
FT   CDS_pept        654097..655572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0658"
FT                   /product="sodium/alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93422"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93422"
FT                   /db_xref="GOA:Q7MNQ7"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNQ7"
FT                   /protein_id="BAC93422.1"
FT                   /translation="MARKHRLAQTQFEVTMTDLINLMNDLLWGSILVYLLVGVGIYFTV
FT                   RLGFIQFRHFGHMFSVLKNSRKSDNAGISSFQALCTSLAARVGTGNMAGVAVALTAGGP
FT                   GAIFWMWLIAMLGMATSFAESTLAQLYKTKDDDGNYRGGPAYYMEKGLGMRWMGVLFSI
FT                   FLIIAFGLVFNAVQANSIANAMQNAFGWENAYVGVVIVVLSGVIIFGGIKRIARTAELI
FT                   VPVMALAYLALALFVMFSNLEKLPDVLMLIFKSAFGLQEAAAGGLGYAIAQAMINGIKR
FT                   GLFSNEAGMGSAPNAAASATPYPPHPASQGYVQMLGVFMDTIVICSATVAIILMSGEYV
FT                   PHGEITGIELTQLALSSQVGSWGSIFVAVAIFFFAFTSIIANYSYAETNLVFLEHNHKA
FT                   GLNVFRLVVLGLVGFGAIAPLPVVWALADVSMGLMAIVNLVAILLLSGIVIKLAKDYNR
FT                   QLQAGKLPTFNADDFPELKSQLEEGIWDNNKKD"
FT   CDS_pept        655599..656453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0659"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93423"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93423"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNQ6"
FT                   /protein_id="BAC93423.1"
FT                   /translation="MIRKAVQTMHGFFCTLDKKKIRERIVMLIVVSPAKTLDYESPLVT
FT                   HKFTQPELVDYSKQLIEVCRQLTPADVASLMKVSDKIADLNVGRFQEWSEEFTPDNARQ
FT                   AILAFKGDVYTGLEAETLNDDDFDYAQKHLRMLSGLYGLLKPLDLMQPYRLEMGTKLAN
FT                   PKGSNLYQFWGNVITEKLNEAIAAQGDNVLINLASNEYFKAVKPKALDAQVITPIFKDA
FT                   KNGQYKVISFFAKKARGMMARYIIENRISSVADLTQFDSAGYYFVEEESTPTELVFKRE
FT                   EQH"
FT   CDS_pept        complement(656526..657851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0660"
FT                   /product="DNA and RNA helicase"
FT                   /note="superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93424"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93424"
FT                   /db_xref="GOA:Q7MNQ5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028621"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNQ5"
FT                   /protein_id="BAC93424.1"
FT                   /translation="MIKITEHSIIFALLNYCCPLNFVSQGIACGEHTVIRTFADLDLDP
FT                   NLLSAIEEMGYERPTQIQAEAIPQALEGRDILASAPTGTGKTAAFVLPALQYLQDFPRR
FT                   KPGPARVLILTPTRELAMQVADQARALAKNTSLNIFTITGGVQYQEHADILATTQDIVV
FT                   ATPGRLMEYIQAERFDCRAIEWLILDEADRMLDMGFAPTVDRLSNECRWRKQTMLFSAT
FT                   LEGKGVEGFTADLLNDPADIDAEPSRRERKKITQWYYRADSMEHKLALLKDIINNQAER
FT                   TIVFLKTRERLADLRAHLESEQVNCAWIQGEMPQDRRNNAIARFRDGSVNVLLATDVAA
FT                   RGIDLPDVSHVVNFDMPRSADVYLHRIGRTARAGKKGNAISIVEAHDQPMMDRVARYVK
FT                   EDIKERFVKELRPQHKKPVFKKKKKKDDKKTSVKKKSTKKKK"
FT   CDS_pept        complement(657861..658622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0662"
FT                   /product="predicted O-methyltransferase"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93425"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93425"
FT                   /db_xref="GOA:Q7MNQ4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022882"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNQ4"
FT                   /protein_id="BAC93425.1"
FT                   /translation="MVFLSRNGENEEINMKSGTLKTKGFKFKQFSIASSNSGMPVSTDG
FT                   VLLGAWADFHHSQNLLDIGTGTGLLSLMCAQRYAHLSITAVDIDAHAMEAAQENFSHSP
FT                   WHSRLHLQHGDVLKLNFTHRFDGIICNPPYFNSGEQAQATQRATARHTDTLAHDALLLR
FT                   CRELLTPNGKANFVLPLTEGEQFLQLAQQQGWHLHRLCRVKPSPNKPVHRLLFELGLST
FT                   ATTSEEHLTINDGSTYSAAFVKLCQDFYLKM"
FT   CDS_pept        658546..658668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0661"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93426"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93426"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNQ3"
FT                   /protein_id="BAC93426.1"
FT                   /translation="MNPLVFNVPLFMFISSFSPFLDRKTIVKDLFELFLYLLSL"
FT   CDS_pept        658889..660202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0663"
FT                   /product="branched-chain amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93427"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93427"
FT                   /db_xref="GOA:Q7MNQ2"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNQ2"
FT                   /protein_id="BAC93427.1"
FT                   /translation="MNQTLKLTDIIAVGFMLFAFFLGAGNIIFPPLAGQLAGEHLFPAM
FT                   SGFLVTAVGLPLITIIAIAVAGGSWDHLTKDLPKQAATLMAVLIFIIIGPAFAAPRTGL
FT                   VAYEMAVKPFFVDALQSHLTIFSILFFAVAMFFSWSQGKLIDIIGKVLTPALFVGLIIL
FT                   ALAVFIDPQGEMLAAQGEYLTQPLTKGFLEGYNTMDTFGSLMFGMLIVDALRSRGITER
FT                   SATTKYLIYAGFIAAAGLAFVYISLFYLGATSAAVASGADNGGVVLSLYVQALFGPYGQ
FT                   IVLSVIVLLACLTTAIGLISACSDYFSSLTPLSYKAWVVINGVACAVVANVGLAQLIAL
FT                   SVPVLFALYPVAIALVALTFVRKKLPNPQVAYRVVILVSLLFALIDAAKVAGVDVSAFK
FT                   VLPLFEVGMAWLLPTMTAIVCMFFVSRSVRQELAEEAA"
FT   CDS_pept        complement(660314..660832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0664"
FT                   /product="flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93428"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93428"
FT                   /db_xref="GOA:Q7MNQ1"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNQ1"
FT                   /protein_id="BAC93428.1"
FT                   /translation="MKIGLFYGSTTCYTEMAAEKMRTILGDDLVEIHNVKECDLAQMAD
FT                   YDLLLLGISTWDFGEIQEDWAAIWHDLTSSPVQGKTIALFGLGDQEGYGEWYLDAMGLL
FT                   HDELKAVGAEFIGYWPNQGYQFEASKALTEDGSHFVGLALDEDSQYELSDERIETWIEQ
FT                   VLTEFHDKL"
FT   CDS_pept        660986..661909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0665"
FT                   /product="site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93429"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93429"
FT                   /db_xref="GOA:Q7MNQ0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNQ0"
FT                   /protein_id="BAC93429.1"
FT                   /translation="MSMQQTASVNMQDFGYVEQFLDAMWMERGLAENTLASYRNDLMKL
FT                   LQWMEANHYRLDFISLSGLQQYQSYLVDQDYKQTSRARMLSAIRRLFQYLHREKVRADD
FT                   PSALLVSPKLPQRLPKDISEEQVDALLDAPDPNDPVELRDKAMLELLYATGLRVTELVS
FT                   LTMENISLRQGVVRVTGKGGKERLVPMGENAIDWIETFIKQGRPALLGETSSDVVFPSK
FT                   RARQMTRQTFWHRIKFYAVIAGIDTDHLSPHVLRHAFATHLLNYGADLRVVQMLLGHSD
FT                   LSTTQIYTHVATERLKQIHSQHHPRA"
FT   CDS_pept        661927..662721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0666"
FT                   /product="protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93430"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93430"
FT                   /db_xref="GOA:Q7MNP9"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNP9"
FT                   /protein_id="BAC93430.1"
FT                   /translation="MILMSVLRRLTLLTLPLFVTACGAEESQAVETAQPAAQVAASTHF
FT                   DSEALKARFSKLGLNIMDIQPSDVAGLVEIQTSGGVLFASKDGSHFIAGTLYSIDENGQ
FT                   YKDVIAERQAPLNAKKIAEFADSAIEYKAKDEKYVVTVFTDITCGYCVRLHSQMQGYND
FT                   LGITVRYMAYPRQGGTGPVAEQMAGIWCAANPQEAMHDAKVNRKFAPAKNDLQQCKQTV
FT                   AQHYQLGQQLGITGTPAIFLPNGELVAGYLPPEKLLERLQQP"
FT   CDS_pept        662773..664512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0667"
FT                   /product="single-stranded DNA-specific exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93431"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93431"
FT                   /db_xref="GOA:Q7MNP8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNP8"
FT                   /protein_id="BAC93431.1"
FT                   /translation="MIEIQRRPEPDLSLLPDSVPDILKRIYLNRGIQDISQLETAVKGL
FT                   HSYQKLHGIELAVALLFEAIREQKRIIVVGDFDADGATSSALSVLALRMLGSNNVDYLV
FT                   PNRFEDGYGLSPEVVEQAIALGAEVIMTVDNGVSSIEGVRYAKEHGLKVLVTDHHLPGQ
FT                   VLPEVDAMVNPNLQTCAFPSKALAGVGVAFYLMMALCVHMRQCGWFAEQGMAEPKLMEL
FT                   VDLVALGTVADVVPLDENNRILVHQGLQRIRAGKARPGIQALIEVAKRDARRLVAADFG
FT                   FALGPRINAAGRLDDMSFGVELLMCNNIHAARRMAHELDGLNQTRKEIEEGMKQEAMAF
FT                   CERLQFGENSELPYGLALFQRDWHQGVIGILASRIKEKYHRPVIAFADGGDGYIKGSCR
FT                   SIPGLHMRDALDLIDTQNPGLILKFGGHAMAAGLTIKECDFERFSQLFDQLVKRELDEA
FT                   ALKGIVLSDGELKPEEFSMHTAELLRSAGPWGQAFPEPIFDGEFKVLHQKLVGEKHLKL
FT                   MLEPLFKGYPTNIMIDGIAFNVDLRRWPDASVKTVRLAYKLDINEFRNNQSLQLMIEHI
FT                   EAR"
FT   CDS_pept        664885..665754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0668"
FT                   /product="protein chain release factor B"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93432"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93432"
FT                   /db_xref="GOA:Q7MNP7"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNP7"
FT                   /protein_id="BAC93432.1"
FT                   /translation="MDDVEGLLELAIEAEDQETFDEIGPELEALEEKLAGLEFRRMFSG
FT                   AHDSSDCYIDLQAGSGGTEAQDWTSMMLRMYLRWAEAKGFKTEVIEVSEGDVAGLKSVT
FT                   VRIIGDYAYGWLRTETGVHRLVRKSPFDSGGRRHTSFASAFVYPEIDENIDIDINPADL
FT                   RIDVYRASGAGGQHVNTTESAVRITHVPTNTVVQCQNDRSQHKNKDQAMKQLRAKLFEL
FT                   ELQKQNAEKQANEDAKSDIGWGSQIRSYVLDDSRIKDLRTGVENRNTQAVLDGDLDKFI
FT                   EASLKSGL"
FT   CDS_pept        665787..667319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0669"
FT                   /product="lysyl-tRNA synthetase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93433"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93433"
FT                   /db_xref="GOA:Q7MNP6"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNP6"
FT                   /protein_id="BAC93433.1"
FT                   /translation="MTDAVQNETVQEASAQEENKLIAERRAKLDQIRKSCKANGHPNDF
FT                   RRDSLAGDLQKEFGEKSKEELEALNHVVAIAGRVMAKRGPFLVIQETSGRIQAYADKDV
FT                   QKVLKDKYQGLDIGDIIGVKGALHKSGKGDLYVNMEEYELLTKALRPLPEKFHGLTDQE
FT                   MRYRQRYVDLIVNEDSRNAFVVRSKVMSAIRNFMISKQFMEVETPMMHVIPGGASARPF
FT                   ITHHNALDMPMYLRIAPELYLKRLVVGGFDRVFEINRNFRNEGLSPRHNPEFTMMEFYM
FT                   AYADYKDLMDLTEELLSSVALEVLGSTSMPYGEHTVEFGGTYTRMSMFEAIKHYNPDHA
FT                   QIQALTEEDIQNRDLMVSIAKSVHVEVEPFWTCGQLLEEIFGETAEPKLMQPTFITGYP
FT                   ADISPLARRSDDNPFFTDRFEFFIGGREVANGFSELNDAEDQDARFKAQVEAKESGDDE
FT                   AMFYDADYITALEHGLPPTAGQGIGIDRLVMLLTNTHTIRDVILFPAMRPQA"
FT   CDS_pept        667503..668852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0670"
FT                   /product="sigma-54 dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93434"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93434"
FT                   /db_xref="GOA:Q7MNP5"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNP5"
FT                   /protein_id="BAC93434.1"
FT                   /translation="MKGLYMATQFKMDSVPGSLVVVGGTYEPWLSVLEQVGWKCHQCAD
FT                   LRKVDALLEDIGPCIGIVDLSHDEFSLNGIANLVSTHKHVRWLAFIREQQLSSDTICQF
FT                   IVNFCIDFFTAPIPDAQLLSTIGHQLGMLKLEKKVWPTFGNNQDMGLIGESVPLKRLRD
FT                   QIKRIGPTDVSILINGENGSGKETVARAIHKISSRAMKPFFSVKCRAMSEQRFQADVFG
FT                   IGADANAGPSILEQADGGTVLFNDILTISKTQQLHLLRFLQEGTIETSDGMKKVNVRIL
FT                   TANASDIEKALIDGDFSEELYHYINVLRINVPSLKERASDITLLARYYLQEYSKEYNAQ
FT                   AKGYSEEALRALMRYYWPGNVRELMNQIKRAVLMSDSVIIDVPQLDLPKRGDSKRSLKN
FT                   IREKSERDALLLVLESHSGQVSNAAKELGVSRATMYRLLNKHNLISEQTV"
FT   CDS_pept        669364..669615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0671"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93435"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93435"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNP4"
FT                   /protein_id="BAC93435.1"
FT                   /translation="MRHSIYLKLATILVQADLKREEREWAKRVRRSSYEIPWNNAFLLR
FT                   DIGLDEGGRANPNTTPDEVKVARRIRHIRRVLSARIPT"
FT   CDS_pept        complement(669655..670689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0672"
FT                   /product="oxidoreductase Tas, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93436"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93436"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNP3"
FT                   /protein_id="BAC93436.1"
FT                   /translation="MQYTKLPHSTLEISKLCLGTMTFGEQNSQQDAFEQLDYAVAQGIN
FT                   FIDTAEMYPVPPKAQSQGLTEQFIGNWLSKSGKREKVLIATKIAGPRNVPYIRDNMSLN
FT                   RRHIHTAIDDSLTRLQTDYVDLYQLHWPQRQTNCFGQLNYPYPDAQEEVTLIETLEALN
FT                   ELVKAGKVRYIGVSNETPWGVMTLLRLAEKHDLPRIVSIQNPYNLLNRSFEVGLSEISH
FT                   YEGVQLLAYSPMAFGTLSGKYLDGARPKGARCTLFERFQRYFTPQGLEATKAYVSLARD
FT                   YGLDPAQMALAFVNQRPFVASNIIGATTLDQLKANIESLNVKLEDEVLNKIQQIGTTYS
FT                   NPCP"
FT   CDS_pept        670898..671209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0673"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93437"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93437"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNP2"
FT                   /protein_id="BAC93437.1"
FT                   /translation="MQKHQLDLWLHSKHHDHYVPPKMFVIGCSDANEYLLAIEYKHHLE
FT                   PIKQGEELMHFSSLDLVKEELLRLGVEKAYLRLHNVYEEVGSDRLASYYDIELQLTPH"
FT   CDS_pept        complement(671196..671945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0674"
FT                   /product="DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93438"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93438"
FT                   /db_xref="GOA:Q7MNP1"
FT                   /db_xref="InterPro:IPR004230"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011337"
FT                   /db_xref="InterPro:IPR037057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNP1"
FT                   /protein_id="BAC93438.1"
FT                   /translation="MSVSLRSDSLLPYRFPIITALVMKPIPQTEAELLQRANQIAGCSF
FT                   AELAEEANMDVPLDLKRDKGWVGQLLEWHLGAPAGSKPQQDFSELGIELKSIPVSYSGK
FT                   PLETTFVCVAPLTGVHGLTWETSHVRNKLSRVLWIPVEGEREIPLAERHVGTPLLWSPN
FT                   DEEEILLKNDWEELMEMIVFGQFDQISARHGVALHLRPKAANSKALTEAYNINGKPIKT
FT                   LPRGFYLRTQFTAQILQNAFNSLLNEE"
FT   CDS_pept        672498..673016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0675"
FT                   /product="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93439"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93439"
FT                   /db_xref="GOA:Q7MNP0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNP0"
FT                   /protein_id="BAC93439.1"
FT                   /translation="MIDGDGYRLNVGIVICNNHGQVFWAKRYGQHSWQFPQGGIDDGET
FT                   PEQAMFRELYEEVGLTHKDVKIIASSRHWLRYKLPKRLVRWDSKPVCIGQKQKWFLLRL
FT                   ECDESKINMQKGSSPEFDGWRWVSYWYPVRQVVSFKRDVYRRAMKEFASLAMPFRERKL
FT                   KGKKVKRRG"
FT   CDS_pept        673019..675265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0676"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93440"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93440"
FT                   /db_xref="GOA:Q7MNN9"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNN9"
FT                   /protein_id="BAC93440.1"
FT                   /translation="MLSQLREIVEKVSRVEDVHQALNTLVRETCTALSTECCTIYLANE
FT                   ERQRLELMATQGLTFHGDSIHIQFEEGLVGLVKRSAEPLNLAEASKHPAFKYFPQLGEE
FT                   TYHSFLGAPIIHRKKVLGVLVIQQKTPRLFSEMEESFLVTLSAQLAVIIAHAQSLGHWS
FT                   LASKPAAVQGIAASSGVAIGEFWYDNSQPILSEVCPASTLDKEREQEWLAVAIEAALAD
FT                   FRRMRKKFDSEINKDALAIFDLFTHLLNDPMLRTDLKKHVERGDRADWALRQVVESYSS
FT                   RFARMSDVYLRERAHDIRELGQRLLFFLHNSEQEQPRIERPVILVANELTASLLASVPK
FT                   KYLLAVVALEGAANSHAAILSRALGVPAVMGANLNLEEVHGKQGIVDGYSGEIYIQPNR
FT                   QILREYRSLVTEESELFAMVNKELALPAKTQDNVDVEVLLNAGLSADSNIAINAGVDGV
FT                   GLYRTEIAFLLQHRFPSEDEQYQQYRAILSSYPQQRVVMRTLDIGGDKPLPYLPIEEDN
FT                   PFLGWRGIRFTLDHPDIFLIQLRAMLRASAEHGNLSILLPMISGVGELDDAIRLIQQAY
FT                   HEVVLLDERVVMPQIGVMIEVPSMVYLIPSIAQRVDFVSVGTNDLTQYLLAVDRNNARV
FT                   SDVYESLHPAVLQALQQIYQQCGQYHLPVCICGELAGDPFGALLLLGLGYRSLSMNTSN
FT                   VARIKYLIRHSQLSDLQALSQQALSLSYGKDIHQLMRDYFINHDFAGFIRAGKK"
FT   CDS_pept        675272..676063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0677"
FT                   /product="predicted permease"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93441"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93441"
FT                   /db_xref="GOA:Q7MNN8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNN8"
FT                   /protein_id="BAC93441.1"
FT                   /translation="MTFELLSVLLVLGAFVGVMAGLLGIGGGLIVVPALLYLLPWAGIP
FT                   TELSMHMALATSLASIIVTSGSSALNHLKLGNVDIFVVKWLMPGVVIGGFVGANIAEWI
FT                   PTQYLPRVFGVIVLVLALQMFRSIRVTTTRAMPSSPVTMLYGTGIGVVSSLAGIGGGSL
FT                   SVPFLNRHGVEMRKAVGSSSVCGCVIAIAGMTGFILHGYSVASLPDYSVGYVYLPALLA
FT                   IAGTSMLTTRIGARWATTLPTAKLKKIFALFLMFVALSMLV"
FT   CDS_pept        676103..676918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0678"
FT                   /product="prolipoprotein diacylglyceryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93442"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93442"
FT                   /db_xref="GOA:Q7MNN7"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNN7"
FT                   /protein_id="BAC93442.1"
FT                   /translation="MSQGYLPFPNIDPVFFSIGPISVRWYGLMYLFGFLFAMWLANRRA
FT                   DKPGSGWTREQVSDLLFAGFLGVVLGGRIGYVLFYNFDLFLADPIYLFKVWTGGMSFHG
FT                   GLLGVITAMLWYAKKNGRTFFGVADFVAPLVPFGLGVGRLGNFMNGELWGRVTDVPWAM
FT                   VFPTGGPLPRHPSQLYEMALEGVLLFFILNWFIRKPRPLGSVSGLFLAGYGTFRFLVEY
FT                   VREPDAQLGLFGGFISMGQILSSPMIIGGLALMAWAYKRGHYQDKVTVK"
FT   CDS_pept        676928..677779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0679"
FT                   /product="thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93443"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93443"
FT                   /db_xref="GOA:Q7MNN6"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNN6"
FT                   /protein_id="BAC93443.1"
FT                   /translation="MKQYLELCRRIVDEGHWVENERTGKRCLTVINADLTYDVANNQFP
FT                   LVTTRKSFWKAAVAELLGYIRGYDNAEDFRKLGTKTWDANANLNDAWLNNPYRKGDDDM
FT                   GRVYGVQGRAWAKPDGGHIDQLRKIVDDLTRGVDDRGEILNFYNPGEFHMGCLRPCMYS
FT                   HHFSLLGDTLYLNSTQRSCDVPLGLNFNMVQVYVFLAIMAQITGKKPGQAFHKIVNAHI
FT                   YEDQLALMRDVQLKREPLQAPTFHINPEIKSLEDLETWVTLDDFWVEGYEHHDPIQYPF
FT                   SV"
FT   CDS_pept        complement(677838..678995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0680"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93444"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93444"
FT                   /db_xref="InterPro:IPR012548"
FT                   /db_xref="InterPro:IPR012656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNN5"
FT                   /protein_id="BAC93444.1"
FT                   /translation="MYTMMEHKENQQRLEAARKIDDQLSLLVENIDILSSVTPQNYKEE
FT                   RQRFFDNRFSIEPSFTYKDQTFDVHQAKRNLYSLPIENIDSVKLRALYAEVIQSYADKL
FT                   DQLCSIGNAEFLYNSLRYYGEPSSKDIRNANFLLHLPIEEEASQRHDCHEIAAFMQQFC
FT                   QDHGYTGEIEINNSMIANALVSGTKVKINASASITTKEMHALAHHELGVHLLTTLNGRA
FT                   QPLKLLSLGCPVNTTTQEGLAILCEFLSGHFSLKRLRTLALRVIAVESMIKDRDFRNTF
FT                   LLLKEQYKTDDMTAFTITARVYRGGGYTKDYLYLRGFREILNAYDQLGDDFNLLLAGKT
FT                   EIRYFSTIKSLVADGLIQPPKFISPAIAKPAPADPIYKFVANALK"
FT   CDS_pept        complement(679106..680356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0681"
FT                   /product="NptA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93445"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93445"
FT                   /db_xref="GOA:Q7MNN4"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR030147"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNN4"
FT                   /protein_id="BAC93445.1"
FT                   /translation="MTPNCHITEIFHLYYRPQFQQQTKLRFRRSMEKIMMNQATTAATP
FT                   ISSTTRWLRWANLAFMLYLLLLAVSMVGSGFKLATGDQAKVLFEFASHPVAGLMIGLVA
FT                   TALIQSSSTVTSIIVGLVAGGLPVETAIPMVMGANIGTTVTNTLVSLGHVRCKEEFKRA
FT                   FASATIHDFFNLLAVAIFLPLEMMFGILEKVSHWLVSPLLNTGDMSMKGFDFIKPITKP
FT                   VVSAVKGPLSTFGDTFAGVALIVLGIATIFVAITVMGKLMKSLMVGRARDILKNAIGRG
FT                   PIHGIVSGSIVTVLVQSSSTTTSLMVPLVGTGVLKVRDVYPFTLGANIGTCITALLAAT
FT                   AVSGEFAVFALQIALVHLTFNVLATLFIFGIPFLREIPIKGAEFISEMAIKNKAVVAGY
FT                   LLAVFIFIPGSILALTA"
FT   CDS_pept        680636..681526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0682"
FT                   /product="transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93446"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93446"
FT                   /db_xref="GOA:Q7MNN3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNN3"
FT                   /protein_id="BAC93446.1"
FT                   /translation="MSHLNYNHLYYFWMVCKQGSVTKAADALFLTPQTVTGQIKALEDR
FT                   MKGKLTKRNGRTVEPTELGQLVFKYADRMFGLSYEMLDIVNYSQHANILFEVGVADALS
FT                   KRLVSKVLKTTVPQDKKIHLCCYESTHELLLERLAQHKLDMILSDCPVDSTQSPGLYSK
FT                   KLGESSMSFFSSTKIDNAEFPAILEQKKLLIPGSRTAMGRKVLQWFDRQGIQPDVLGEF
FT                   DDVALMKAFARYHDDVIFLAPTVYISEIEEDLTLQLIGHVDDLKEEYYVIFAERMIQHP
FT                   AVKNVCDADFSQLFE"
FT   CDS_pept        681655..681951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0683"
FT                   /product="transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93447"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93447"
FT                   /db_xref="GOA:Q7MNN2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNN2"
FT                   /protein_id="BAC93447.1"
FT                   /translation="MNLKDMEQNSAKAVVLLKAMANERRLQILCMLHNQELSVGELCAK
FT                   LQLSQSALSQHLAWLRRDGLVTTRKEAQTVYYTLKSEEVKAMIKLLHSLYCEE"
FT   CDS_pept        complement(682074..682349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0684"
FT                   /product="ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93448"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93448"
FT                   /db_xref="GOA:Q7MNN1"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNN1"
FT                   /protein_id="BAC93448.1"
FT                   /translation="MGVRPLANNKSAKKRAIQAEKRRQHNASRRSMMRTYMKKTVAAIA
FT                   AGDKEAATAAFAVVTPILDRMATKGLIHKNKAARHKSRFAAQIKAL"
FT   CDS_pept        682584..684146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0685"
FT                   /product="mviN protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93449"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93449"
FT                   /db_xref="GOA:Q7MNN0"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNN0"
FT                   /protein_id="BAC93449.1"
FT                   /translation="MSKRLLKSGMIVSAMTLVSRVLGLVRDVVVANLMGAGASADVFFF
FT                   ANKIPNFLRRLFAEGAFSQAFVPVLTEYHASGDLNKTRDLIAKASGTLGVIVSVVTILG
FT                   VLGSGVVTALFGAGWFIDWLHGGPAAEKFELASFMLKITFPYLWFITFVALSGAILNTM
FT                   GKFAVSSFTPVFLNVMIILCAWYISPIMAQPEVGLAIGVFLGGLVQFLFQMPFLIKAGV
FT                   LVKPKWGWRDPGVVKIRTLMIPALFGVSVSQINLLFDTFIASFLQTGSISWLYYSDRLL
FT                   EFPLGLFGIAIATVILPALSRKHVDAHSEGFAHTMDWGVRMVTLLGIPAMLGLMVLAKP
FT                   MLMVLFMRGEFTPQDVHQASLSLLAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIVA
FT                   MVTNMVFNAIFAWFYGYVGLAIATALSAFVNMALLYRGLHIAGVYKISRRTFLFISRLV
FT                   VSGAVMVAAILWQLDEMSVWLEWTTAHRAAMLTMLIGFGALAYVACAFLLGIRVKDLKA
FT                   GTE"
FT   CDS_pept        684173..685153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0686"
FT                   /product="FAD synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93450"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93450"
FT                   /db_xref="GOA:Q7MNM9"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNM9"
FT                   /protein_id="BAC93450.1"
FT                   /translation="MTLHKTKTEAFRCIQMELIRGIHNIKPQHRGCVLTIGNFDGVHLG
FT                   HQEVLRQVSLRAREMSLPSVVMTFEPQPLELFAKEKAPARLTRLRDKFVQLGKLEIDRL
FT                   LCVNFNRHFASLDADAFIRDLLVERLGVKFLVVGDDFCFGKARQGNFAMLQEAGKKYGF
FT                   TVVNTQSFCLAQLRVSSTAIREALAHDQLAVAAQMLGRDYSISGRVSHGRKLGRTIGFP
FT                   TANIPLKRCVSPVSGVYVVQALGLDNKPIGGVANIGQRPTVNGVRQQLEVHLFDFQANL
FT                   YGKQLEVVLLHKLRDEKKFESFDALKQQIELDAEAARVWLRQLKR"
FT   CDS_pept        685218..688064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0687"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93451"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93451"
FT                   /db_xref="GOA:Q7MNM8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNM8"
FT                   /protein_id="BAC93451.1"
FT                   /translation="MSEYKDTLNLPETGFPMRGDLAKREPEMLKRWYQEDLYGEIRKAK
FT                   KGKKSFVLHDGPPYANGDIHIGHALNKILKDIIIKSKTLSGFDAPYVPGWDCHGLPIEL
FT                   MVEKKVGKPGQKVTAAEFREKCREYAAGQVEGQKESFKRLGIMGEWDKPYRTMDFTTEA
FT                   NIIRALGQIADNGHLLKGFKPVHWCTDCGSALAEAEVEYKNKVSPSIDVRFKAADEAAL
FT                   LAKFSLNEGHQGQGDVSIVIWTTTPWTLPANRAVCLRDDLEYVLIQVEGDNPERIIVAA
FT                   ELAKDVMDRAGIEHFHNLGFAKGADLELTQFQHPFYDFTVPAILGDHVTTDSGTGVVHT
FT                   APGHGQEDFAVGQKYNLEVANPVGSNGVYLPDTELFAGQHVFKANDAVVETLKEKGALL
FT                   HHHAYEHSYPHCWRHKTPIIFRATPQWFVSMDQAGLRAKALESIKGVQWMPEWGQSRIE
FT                   GMIEGRPEWCISRQRTWGVPIALFVHKETAELHPNTSELIEKVAQVVEQKGIQAWWDID
FT                   AAELLGDDAAQYEKVLDTLDVWFDSGVTHYAVVDKREEFNGAEADMYLEGSDQHRGWFQ
FT                   SSLISSIAMKGKAPYKQVLTHGFVVDGHGRKMSKSIGNVVAPKDVTNKLGADILRLWVA
FT                   STDYTGEVAVSDEILKRSADAYRRIRNTARFFLANLNGFNPETDIVPVEEMVALDRWAV
FT                   GRALAAQNEIVKAYDEYNTHAVTQRLMHFCSIEMGSFYLDVIKDRQYTAKLGGHAQRSC
FT                   QTALYYIVEALVRWMAPIMSFTADEIWNQMPASLPSGESRDKFVFTGEWFDGLFGLAEG
FT                   EELNNAFWSEMQKVRGAVNKLLEAARSDKTIGGSLQAELTLFADDALAAKINKLEDELR
FT                   FVLLTSAATVKPLSEKSDAAQATDIEGLFVEVRATEAEKCDRCWHHTPDVGTIEGHEKI
FT                   CGRCVSNVDGEGEARKFA"
FT   CDS_pept        688143..688649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0688"
FT                   /product="lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93452"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93452"
FT                   /db_xref="GOA:Q7MNM7"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNM7"
FT                   /protein_id="BAC93452.1"
FT                   /translation="MSGKAQIFKQTGVRWLWLALVVFLADIGIKFIVMENMGYGWANRI
FT                   EVLPFFNLLYVHNYGAAFSFLSDQAGWQRWLFTGIAFVVTGLLTYWMSKLPAAEKWNNV
FT                   AYAMIIGGAIGNVFDRMVHGFVVDYLDFYWGTYHWPAFNLADTAICLGAAMIILDGFRK
FT                   KEEEK"
FT   CDS_pept        688891..689322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0689"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase 2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93453"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93453"
FT                   /db_xref="GOA:Q7MNM6"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNM6"
FT                   /protein_id="BAC93453.1"
FT                   /translation="MSTINNNSAVTLHFTIKMKDGSVADSTHNMGKPAKFVMGDGSLSE
FT                   NFEQCLLGLTVGENKAIELKAADAFGMPNPDHIHHMDRTKFVGEAQVEVGTIMAFSGPD
FT                   GMEIPGIITEIAGDSVTVDFNHPLAGQDVTFEVEILSVE"
FT   CDS_pept        689343..690305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0690"
FT                   /product="penicillin tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93454"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93454"
FT                   /db_xref="GOA:Q7MNM5"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNM5"
FT                   /protein_id="BAC93454.1"
FT                   /translation="MSNEMKILLANPRGFCAGVDRAISIVERALELYQPPIYVRHEVVH
FT                   NRFVVEGLKQRGAIFVEELHEVPDDNIVIFSAHGVSQAVRQEAKERALTVFDATCPLVT
FT                   KVHMEVARASRKHMEVVLIGHAGHPEVEGTMGQYASLQGGMYLVEKPEDVLGLKAIVKD
FT                   PSNLHYVSQTTLSVDETADVIDELRRVFPEIQGPRKDDICYATQNRQDAVRELAKDVDV
FT                   VVVVGSKNSSNSTRLKELAEKLGTPAYLTDCPQDIEPQWFDGKVKVGVTAGASAPEELV
FT                   NQILTRIKELGAQSVEEVLGREENMFFEVPKELQIKQID"
FT   CDS_pept        complement(690374..691102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0691"
FT                   /product="response regulator"
FT                   /note="LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93455"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93455"
FT                   /db_xref="GOA:Q7MNM4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNM4"
FT                   /protein_id="BAC93455.1"
FT                   /translation="MLTALVIDDEPFAREELTDLLSETGDIDVIGDAANAIVGLKKINE
FT                   LKPDVVFLDIQMPQVTGIELLGMMDPDTMPYVVFVTAYDQYAIQAFEDNAFDYLLKPVD
FT                   PERLRKTVKRLSKAASHSALSQHIASLAPETLDQIPCIGHNRIVIMATESVECAYSDIS
FT                   GVHVRSASQTASTQLTLKVLEEKTSLVRCHRQYLISIKAISEIKLLENGLAEIITKTGF
FT                   EVPVSRRYLKLLKEMLGLSH"
FT   CDS_pept        complement(691122..692804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0692"
FT                   /product="putative regulator of cell autolysis"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93456"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93456"
FT                   /db_xref="GOA:Q7MNM3"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNM3"
FT                   /protein_id="BAC93456.1"
FT                   /translation="MELVISLLQQMCVYLVLAYMLSKTPIILPLLNISSRLSHRVLCYL
FT                   LFSAFCILGTYFGLHINDAIANTRAIGAVMGGLFGGPIVGFAVGLTGGLHRYTLGGFTD
FT                   LACAISTTAEGLIGGLLHIYLIKKNKGAQLFNPSVVFSITFVAEIIQMIILLVVAKPFD
FT                   QAYSLVSTIAAPMIIANSVGAALFMSILQDRKTIFEKYSATFSRRALTIADRSVGILHT
FT                   GFNSANAEKIARIIYEETNVGAVAITDQEKILAFVGIGDDHHKPNTPISSQSTLDSMSQ
FT                   NAIIYLDGSERPYQCSLAADCKLGSALIIPLRAGKEVVGTIKLYEPKRKLFSTINMSMA
FT                   EGIAQLLSSQILYGDYQQQQTLLTQSEIKLLHAQVNPHFLFNALNTISAVIRRDPDKAR
FT                   ELIQNLSHFFRSNLKQNINTVTLKEELAHVNAYLSIEKARFADRLEIEIDITPELFDIK
FT                   LPSFTLQPLVENAIKHGISNMLEGGRVRIYSQSCEQGDVIVVEDNAGSYQPPAENHSGL
FT                   GMEIVDKRLTHHFGRDSALKIEAKEHQFTKMSFIIPRSHHTAI"
FT   CDS_pept        complement(692973..694457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0693"
FT                   /product="carbon starvation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93457"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93457"
FT                   /db_xref="GOA:Q7MNM2"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNM2"
FT                   /protein_id="BAC93457.1"
FT                   /translation="MMWFLTCVAALIGGYFIYGAFVEKVFGINENRRTPAHTKTDGVDY
FT                   VPMSTKKVYLVQLLNIAGVGPIFGPIMGALYGPAAMLWIVVGCIFAGAVHDYFSGMLSV
FT                   RNGGASVPTITGRYLGNGAKHFMNIFAIVLLLLVGVVFVSAPAGMITNLINDQTSFSVS
FT                   MTTMVVVIFAYYIIATIVPVDKIIGRFYPLFGALLIFMSVGLMTAIAFSSEHTVMGDFQ
FT                   VSDMFTNLNPNDMPLWPALFITIACGAISGFHATQSPLMARCMENEKNGRFVFYGAMIG
FT                   EGVIALIWCAIALSFFGTLEGLAEAVKNGGPGNVVYSASFGLLGVFGGVIAFLGVVILP
FT                   ITSGDTAFRSSRLILAEYFNMEQKTLRNRLLMAVPLFVLGGILTQVDFGIIWRYFGFAN
FT                   QTTAVMMLWTASAYLLRHNKLHWITTVPAFFMTTVCVTFILNNSALGFGLPMQLSTIAG
FT                   VLFAAAVTGYVIKTSKGKGETDLADEEKPQGVTETA"
FT   CDS_pept        694493..694684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0694"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93458"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93458"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNM1"
FT                   /protein_id="BAC93458.1"
FT                   /translation="MDSKAWFGEMHSVMKSVVEYRVEWSMGQLSGFNVCSMVGTELFFV
FT                   HERHIRCFDDNVFAQTIS"
FT   CDS_pept        694694..695035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0695"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93459"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93459"
FT                   /db_xref="InterPro:IPR021242"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNM0"
FT                   /protein_id="BAC93459.1"
FT                   /translation="MKTSALGLAVFLLAGCVASTEQLAQQGDWQQIGYQDGIAGHTQRS
FT                   YKALAELGEVNKSDYEQGYLEGVAEYCNPDFAYQMGLSGQYYEGVCEGTEQAQKFRMEW
FT                   QRGWNEYQN"
FT   CDS_pept        695062..696858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0696"
FT                   /product="NhaP-type Na+/H+ and K+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93460"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93460"
FT                   /db_xref="GOA:Q7MNL9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNL9"
FT                   /protein_id="BAC93460.1"
FT                   /translation="MQTETTALWLAGIGVIGLACQWFAWRLKLPAILFLLVAGLLVGPV
FT                   SGLLQPELLLGDLLFPMVSLAVAVILFEGSLTLNFREIRGVSNTVWSIVTLGAVVSWGL
FT                   TSTATHYLLGFDWPLALLFGSLTVVTGPTVIVPLLRTVRPSTRLSNILRWEGILIDPLG
FT                   ALFVVMVYEFIVSSSETHSLVVLAWILAIGLGLGVLFGQFLAVVLRRSWLPEYLQPFAV
FT                   LSLVLGVFALSNHLEHESGLLTVTVMGMWLANSKGVDIKHILHFKEHLTILFITGLFIL
FT                   LAARIQPEDFYTLGISALVLFAFIQFVSRPVSIYLATLRSSLNGKEKAFLAWVAPRGIV
FT                   AASISSLFAIKLESLGMSEAALLVPLTFMVIIGTVVLQSATARPVAVALGVSEPAPKGF
FT                   LIIGANDVARTLAQAINKYDCRVVLTDSNWDYIRQARMAGLDNYFGNPVSSHADEYLNL
FT                   IGIGHVVALSPDRYFNIMACMHFLNDFSDKRIFCLYDKSNGNGSGDKHSVSDGYKGLPF
FT                   LDEAISYKKLASLINQGAEVRHTKISENYTYADYRETHANNYVLPLFVVDTNGRVQICH
FT                   NSANFSPKEGETIVSLIKVQEA"
FT   CDS_pept        complement(696640..696789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0697"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93461"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93461"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNL8"
FT                   /protein_id="BAC93461.1"
FT                   /translation="MANLHTPIGVYHKQRQHVIIRVSFTIICVRVVFTDLGVTHFRPLV
FT                   DQTG"
FT   CDS_pept        complement(696900..698063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0699"
FT                   /product="predicted molecular chaperone"
FT                   /note="distantly related to HSP70-fold metalloprotease"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93462"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93462"
FT                   /db_xref="GOA:Q7MNL7"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNL7"
FT                   /protein_id="BAC93462.1"
FT                   /translation="MNLHYNGLHDENTMELSVSTKELYIGVMSGTSMDGVDCALVEFDQ
FT                   EQVRLIAHSDYPMPADLRQQLLSVCTGQATNLKQIGELDHRLGHLFADAVMDLLSQAGV
FT                   DASQICAIGNHGQTVFHQPNGEFPFTTQLGDANIIATRTNIDTVADFRRKDMALGGQGA
FT                   PLVPAFHQSVFALQDSTTVVLNIGGIANISVLHPTRPVLGYDTGPGNMLMDAWCETHTQ
FT                   QNYDKDARFALQGEVNEALLNSLLQEPYLHQDAPKSTGRELFNMEWLTAKLQGQNYRSE
FT                   DVQRTLCEYTALTISKEVERFRYGPTPQLLVCGGGARNPLLMQRLQQQLSHWQVSTTDA
FT                   KGVSGDYMEAMAFAWLAYRHMHRLPSNLPEVTGASRLASLGVLYPKA"
FT   CDS_pept        697701..697835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0698"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93463"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93463"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNL6"
FT                   /protein_id="BAC93463.1"
FT                   /translation="MKYRLAMITDSADLARVDACLAEQIHHGIGKKMAEAVIKFANLL"
FT   CDS_pept        698115..699101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0700"
FT                   /product="beta-hexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93464"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93464"
FT                   /db_xref="GOA:Q7MNL5"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR022956"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNL5"
FT                   /protein_id="BAC93464.1"
FT                   /translation="MGPLWVDVAGYELNAEDKEILQHPSVGGLILFTRNYHDSEQLLAL
FT                   TAAIRQVVKRPFLIGVDQEGGRVQRFRDGFSLIPAAAEYAKQANGEAMAQMGGWLMAAE
FT                   LIAHDIDLSFAPVLDQGFGCKAIGNRAFGEDTQTILRHSSAYMQGMKAVGMATTGKHFP
FT                   GHGGVVADSHLETPFDQRSDIVEQDMAIFKTQIDAGLLDAMMPAHVIYPHYDPQPASGS
FT                   EYWLKQVLRQQLGFKGLIFSDDLTMEGAAVMGGPADRALQALNAGCDMLLMCNKRDAQV
FT                   AALDALPIVEVPLALSLLKKRSFSLSELKLAPQWKEARENMLRILGH"
FT   CDS_pept        699121..700365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0701"
FT                   /product="3-deoxy-D-arabino-heptulosonate 7-phosphate
FT                   (DAHP) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93465"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93465"
FT                   /db_xref="GOA:Q7MNL4"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNL4"
FT                   /protein_id="BAC93465.1"
FT                   /translation="MKTKARRFGFFIMCNLFFTFDVFYCLRLIFNSTLLTCVQTDFDSQ
FT                   GYEGVKNNIQVSVMQKSELSNINISDEQVLITPEQLKQKLPLSDNARRFIQESRNTVAN
FT                   IIHKQDHRLLVVCGPCSIHDLDAAKDYARRLKALSAELSDQLYIVMRVYFEKPRTTVGW
FT                   KGLINDPHLDGSFDIEHGLHVGRQLLVELAEMEIPLATEALDPISPQYLADTFSWAAIG
FT                   ARTTESQTHREMASGLSMPIGFKNGTDGSLSTAINAMQAASSSHRFMGINREGQVALLT
FT                   TQGNPNGHVILRGGKQTNYDSVSVAECEQDMAKVGLDASLMVDCSHANSRKDYRRQPLV
FT                   AEDVIHQIREGNKSIIGLMIESHINEGNQSSDLPLSEMQYGVSITDACINWQATEALLR
FT                   KAHKELVPHLENRLK"
FT   CDS_pept        700385..701512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0702"
FT                   /product="prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93466"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93466"
FT                   /db_xref="GOA:Q7MNL3"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008244"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011277"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNL3"
FT                   /protein_id="BAC93466.1"
FT                   /translation="MAVELNALREQIDAVDKQMLALLAQRLALVEQVGHVKSQHGLPIY
FT                   APDREAAMLASRRAEAEKIGVPPQLIEDILRRTMRESYASEKDSGFKCLNPDLRSVVII
FT                   GGHGQLGGLFARMFTLSGYQVKILGSKDWHRADEILDGAGLVVVTVPIHLTQGVIEKLT
FT                   QLPSDCILCDLTSIKSKPLKTMLDVHSGPVVGLHPMFGPDVPSLAKQVIVYCDGRGAEQ
FT                   YQWLLQQFKIWGASLCQIEASEHDHGMTLIQALRHFTSFAYGMHLSQENPSLDKLLKLS
FT                   SPIYRLELAMVGRLFAQDPNLYGDIILSSQENIDMIKRFHRRFGEALEMLDQHDKARFV
FT                   ERFTQVSDWFGGYSQQFMAESQNLLKQANDNLHRD"
FT   CDS_pept        complement(701583..702587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0703"
FT                   /product="membrane protein"
FT                   /note="related to metalloendopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93467"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93467"
FT                   /db_xref="GOA:Q7MNL2"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNL2"
FT                   /protein_id="BAC93467.1"
FT                   /translation="MSKKITMQIPTKNGDQLFYLGKGTVATLLLSITAFPLVLGGGWYW
FT                   YLQQSEQSQQLRAQLDVLASEKQQLMADYQEQLDTNHSLSQTLTEKSNQIQLLGKRVFD
FT                   VESVLGIADEEIIVDENSLEERIDTAAIDSAVRATMFRLIPNDSPMSYLRVSSSFGRRT
FT                   NPISGKRHTHTGIDLTCKRGEEIVAPADGVIETVRPSKKGFGNFITMRHSFGFMSSYAH
FT                   LQSFKVKSGQFVSKGDVIATCGNSGNSTGPHLHYEVRFLGRALNPQYTMDWNQENFNYL
FT                   FEKEKTVKWSPLVKMIDNVVRLQVNLTKSPYRDTSIDTVSSEENSLDPSLQTN"
FT   CDS_pept        complement(702616..702990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0704"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93468"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93468"
FT                   /db_xref="GOA:Q7MNL1"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR027021"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNL1"
FT                   /protein_id="BAC93468.1"
FT                   /translation="MAERRRFSRIMYQVPAIVKQGQYVLHTTIQDLSLHGLLLRTDSMH
FT                   TLRNNDTVLVDFTLSDSDIDISLEADVVGFDQQTIRLKITHIDIDSISHLKRLVELNVG
FT                   DDALLHREIEHLSDLGDEAS"
FT   CDS_pept        complement(703107..704774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0705"
FT                   /product="ABC-type transport system, ATPase component"
FT                   /note="containing duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93469"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93469"
FT                   /db_xref="GOA:Q7MNL0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNL0"
FT                   /protein_id="BAC93469.1"
FT                   /translation="MAEYVYTMSRVSKIVPPKRQILKDISLSFFPGAKIGVLGLNGSGK
FT                   STLLRIMAGLDTDIDGEARPQPGLKVGYLPQEPVLDESKTVREVVEEAVADVAGALKRL
FT                   DEVYAAYADPDADFDALAKEQGELEALIQAKDGHNLDNALERAADALRLPEWDQKVAHL
FT                   SGGERRRVAICRLLLEKPDMLLLDEPTNHLDAESVAWLERFLVDYSGTVVAITHDRYFL
FT                   DNAAGWILELDRGEGIPWQGNYTSWLEQKDARLQQEASQEKARQKTIEKELEWVRQNPK
FT                   GRQAKSKARMARFEELQNTDHQKRNETNELFIPPGERLGDKVIEVKNLTKSFDGRVLID
FT                   DLSFSMPKGAIVGIIGANGAGKSTLFKMLSGVEQPDSGTIEMGETVKLASVDQFRDSMN
FT                   DKNTIFQEISEGADIIKINNFELPARAYCSRFNFKGVDQQKIIGELSGGERNRVHLAKL
FT                   LKAGGNVLLLDEPTNDLDVETLRALEEALLEFPGCAMVISHDRWFLDRIATHIIDYRDE
FT                   GQVNFYEGNYTEYMEWLKKTLGPAAAEPHRIKYKRMTK"
FT   CDS_pept        705091..707046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0706"
FT                   /product="soluble lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93470"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93470"
FT                   /db_xref="GOA:Q7MNK9"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023800"
FT                   /db_xref="InterPro:IPR037061"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNK9"
FT                   /protein_id="BAC93470.1"
FT                   /translation="MTRMNLKNIGRESATKWLMAALCGVAMNVSAADVVTLEKQRALYE
FT                   QAQKLLDDKNDEAYVQVRSQLDDYALTPYLDYRFFLAQLSKKSPTEVEQFITQSRDYPF
FT                   SQRIRAPYLDALYRQQAWSEVVSFQQQEPRGESYQCIYYYAQYNQGQKKLAYQGAEQLW
FT                   LSGLEIADECDHLFTVWEQAGGRSDNLILQRMLLAFEQKNSKLMTYLLKLPKSSQAKKQ
FT                   AQEMKALFNRPESVLEFAKQHKANEFYRKQTELALEKLARKDIKRAQEQYAQVIKAQKF
FT                   SSVQAQESAEYLAFRLINTESEALAQWRDAVLKKSHKQNLIERRIRLALQQADWKGVQS
FT                   WVAQLDDEHRNSLRWQYWLGRSEIEMGKATQGKLRLSKLVGQRNFYSVAAAKEIGQSIN
FT                   YPTSTLKLDSSLVEPYRRSLARIEELIALDKIAAAKSEWQYLLSRSDEQTQGMLAVYAA
FT                   SKRWYHLTVTASIAAQMWDNMEIRFPVAHRWWFNFYAEKHDIDPIMLMSLARQESGMDA
FT                   EATSPVGARGIMQIMPSTAKYTAKKYQLSYEGSDDLYQVGKNIEIGSHYLNGLLEQYDN
FT                   NRIFAFAAYNAGPHRVKSWRERTGGKLDAYAFIEAIPFKETRGYVQNILMFETYYRDIL
FT                   GVDGAFLNQHELETKY"
FT   CDS_pept        707062..707370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0707"
FT                   /product="Trp operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93471"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93471"
FT                   /db_xref="GOA:Q7MNK8"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013335"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNK8"
FT                   /protein_id="BAC93471.1"
FT                   /translation="MSQQPEYTDWQQIVDLVKHSVEQKQHDMLLTMLMTPDEREALVSR
FT                   VNIVRELLKGELSQRQISQMLGVGIATITRGSNELKLKSDEDKARLNQLLEGTKKGG"
FT   CDS_pept        complement(707401..707952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0708"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93472"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93472"
FT                   /db_xref="GOA:Q7MNK7"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNK7"
FT                   /protein_id="BAC93472.1"
FT                   /translation="MSKKIMATQKVIIASLNPAKITAVESAFTSAFPDGTFEFVGVNVP
FT                   SEVADQPMSDSETHLGALNRVRNAKACRADGAFYVGLEAGIDGNVTFAWMVIESHTHRG
FT                   ESRSASLMLPPNVIAKLPNANELGDVMDEVFGTENIKQKGGAISLLTQNQLTRSSVYHQ
FT                   ALILALIPFTNPEHFPANLS"
FT   CDS_pept        complement(707962..709140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0709"
FT                   /product="prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93473"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93473"
FT                   /db_xref="GOA:Q7MNK6"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR010952"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNK6"
FT                   /protein_id="BAC93473.1"
FT                   /translation="MTEQPLSLDEIRLRLNDLDDQLLSLLSERRKLSIEVAKSKVETSK
FT                   PVRDASREQQLLVKLITNGREKYQLDAQYITKLFHTIIEDSVLLQQSYLQNLLNPEQSR
FT                   KPLARVAFLGSKGSYSHLASREYFSRKNTELIELNCDHFKEVTQTVESGHADFGVLPIE
FT                   NTSSGSINEVYDLLQHTTLYIVGELTQPIEHCLVATKDVRLEEIKVLYSHPQPHQQCSE
FT                   FLGRLKGVTLKSCASTADAMKKVQELNRDDVAAIGNASSGKLYGLQPIQGNIANQTENH
FT                   TRFIVVARKPVEVSAQIPAKTTLIMSTSQKAGSLVETLLVLQRYGINMTKLESRPIMGN
FT                   PWEEMFYVDLEAHLDSEEMQLALGELTKITKHLKVLGCYPSENVKPTQVKLS"
FT   CDS_pept        complement(709384..709707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0710"
FT                   /product="putative sigma-54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93474"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93474"
FT                   /db_xref="GOA:Q7MNK5"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNK5"
FT                   /protein_id="BAC93474.1"
FT                   /translation="MKLNITGKNIEITSAIRNHIESKFKKLEKWQTDIISCQTTFSEEP
FT                   GKQMKFEAVIKVPKGQLIASAIHEDLYAAINEVEQKLERQLNKLQHKPDARRAEKPEVV
FT                   EEE"
FT   CDS_pept        complement(710041..711378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0711"
FT                   /product="transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93475"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93475"
FT                   /db_xref="GOA:Q7M7C3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024473"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M7C3"
FT                   /protein_id="BAC93475.1"
FT                   /translation="MSIQNYFADFLEESPVDVAQLTTFSEHIPDEWVAKAATLSDKATI
FT                   RRRRLPSDMVLWLIVGMAFFRNESIAEVARRMNVCAEGLADEELLAKSALTQARQRLGK
FT                   AAPEWLFRQCSHTWGLERYPEDTWQGLQVFAIDGALFRTADTSELREHFGSGNTSSERQ
FT                   TPHPVLRVVTMMNVRSHVIVDAAISPYRRGEIPLAMPFIDSLPDNSVTLLDKGFYGADL
FT                   LLSLQNSGSNRHWLLPAKKGVKFRLLDDEESDDMLVEMKVSPQARKKNPNLPEKWQVRA
FT                   VTYQVQGKHKTVFTSLPREEYDAESVAELYHERWEIELGYRDIKSSMQHNALVLRSKTV
FT                   ELVYQELWGLLLGYNLVRREASQAAVAHGRMANEISFKYACQFIASQLKVMSKAVSPGN
FT                   TPKRLKSLRGDLSILFIDKRPKPNRPRAVKISKTRYPVNRKAAPLK"
FT   CDS_pept        complement(711502..712227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0712"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93476"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93476"
FT                   /db_xref="GOA:Q7MNK4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNK4"
FT                   /protein_id="BAC93476.1"
FT                   /translation="MKHHTLAGLLAVSVLFGCSSSEQIVPDVPPAELYAEAQTSLQGGN
FT                   WLTAIEKLEALDSRYPFGAYSEQVQLDLIYAYYKNDDLALGLATISRFTRLNPTHEKMD
FT                   WVLYMRGLTHMAQDRNFMHDLFNIDRSDRDPEPVKQAFDDFKKLLERYPNSPYAEDSQK
FT                   RMFALKNRLAEYDLATADYYLRREAWIAAINRSQELQKTYPDTIAARKSLKIQLEAYKQ
FT                   LGLQDAIARTEELIRLNPL"
FT   CDS_pept        712364..713341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0713"
FT                   /product="pseudouridylate synthase, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93477"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93477"
FT                   /db_xref="GOA:Q7MNK3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNK3"
FT                   /protein_id="BAC93477.1"
FT                   /translation="MAQQIELTNTVKDSQLGQRLDQAIAELFADFSRSRLKEWLLDGKV
FT                   TVDGNVVTKPRTKVMGGEVITVLAELEDEVRWEAQDIPLDIVYEDDDILVINKPRDFVV
FT                   HPGAGTPDGTVLNALLFHCPEVAEVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVRALQ
FT                   KRHITREYEAIAIGRMTAGGKVDKPIGRHATKRTLMAVSPMGKPAVTHFRVAEHFREHT
FT                   RIRLRLETGRTHQIRVHMSYLQHPLLGDAAYGGRARIPAGASEDVTAMIRNFDRQALHA
FT                   VMLRFEHPITGEEMEFHAPVPDDMVELTETLRRDAQEHGLPDEY"
FT   CDS_pept        713342..714061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0714"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93478"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93478"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNK2"
FT                   /protein_id="BAC93478.1"
FT                   /translation="MMIIPNWPAPKNVKALSTTRQGGYSTGVYAGLNLGTHVGDDFSIV
FT                   MRNRQWLAEQAQMPSAPIWLNQTHSTTVIEATEPTEVILDADGVFTHSSGVVCSAMTAD
FT                   CLPVLITNTSGTQVAAVHAGWRGLAGGIVEEALRHFSQDVLIWLGPAIGPQAFEVGEDV
FT                   VEAFCQQHPQAVSAFSAHTTPNKWLADMDQLARIRLSSIGVEAIYSSELCTYQDSRFYS
FT                   YRREGVTGRQASFIWFE"
FT   CDS_pept        714179..716752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0715"
FT                   /product="clpB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93479"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93479"
FT                   /db_xref="GOA:Q7MNK1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNK1"
FT                   /protein_id="BAC93479.1"
FT                   /translation="MRLDRFTSKFQIAISDAQSLALGRDHQYIEPVHLMVALLDQNGSP
FT                   IRPLLTILNVDVTHLRSKLSEMLDRLPKVSGIGGDVQLSSAMGAMFNLCDKIAQKRQDA
FT                   YISSEIFLLAAIEDRGPLGQLFKELGLTEQKVSQAIEQIRGGQKVNDQNAEELRQALEK
FT                   FTIDLTERAEQGKLDPVIGRDDEIRRTIQVLQRRTKNNPVIIGEPGVGKTAIVEGLAQR
FT                   IINNEVPEGLRGRRVLSLDMGALVAGAKYRGEFEERLKSVLNELSKEEGNIILFIDELH
FT                   TMVGAGKGEGSMDAGNMLKPALARGELHCVGATTLDEYRQYIEKDPALERRFQKVLVDE
FT                   PTVEDTIAILRGLKERYELHHHVEITDPAIVAAASLSHRYVSDRQLPDKAIDLIDEAAS
FT                   SIRMQIDSKPEALDKLERKIIQLKIEQQALSNEHDEASEKRLRSLNEELNEKEREFAEL
FT                   EEIWNAEKAALSGTQHIKAALEQARMDMEFARRAGDLSRMSELQYGRIPELEKQLDLAT
FT                   QAEMQEMTLLKNKVTDNEIAEVLSKQTGIPVSKMLEAEKEKLLRMEEVLHKRVIGQKEA
FT                   VEVVANAIRRSRAGLSDPNKPIGSFLFLGPTGVGKTELCKTLANFMFDSEDAMVRIDMS
FT                   EFMEKHSVARLVGAPPGYVGYEEGGYLTEAVRRKPYSVILLDEVEKAHPDVFNILLQVL
FT                   DDGRLTDGQGRTVDFRNTVVIMTSNLGSSRIQENFAMLDYQGIKEQVMEVVTKHFRPEF
FT                   LNRVDETVVFHPLSQDHIKSIAAIQLNRLANRMEEHGYQLEVSDKALELIAQVGFDPVY
FT                   GARPLKRAIQQSIENPLAKSILAGSVLPDKKIQLIVNNDQIVAHQ"
FT   CDS_pept        complement(716794..717018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0716"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93480"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93480"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNK0"
FT                   /protein_id="BAC93480.1"
FT                   /translation="MKSQTLFQIYFSGTYLNFSLAEALRRLPCQWMRIIGGFFTCTRAK
FT                   LEKKEKSKSLACFLLKLCLKTSKEAFRLF"
FT   rRNA            717240..718774
FT                   /gene="rRNA-16Sc"
FT                   /product="16S ribosomal RNA"
FT   tRNA            718843..718918
FT                   /gene="tRNA-Glu-2"
FT                   /product="tRNA-Glu"
FT   tRNA            718920..718995
FT                   /gene="tRNA-Lys-2"
FT                   /product="tRNA-Lys"
FT   tRNA            719024..719099
FT                   /gene="tRNA-Val-2"
FT                   /product="tRNA-Val"
FT   CDS_pept        complement(719070..719198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0717"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93481"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93481"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNJ9"
FT                   /protein_id="BAC93481.1"
FT                   /translation="MRNTLFKDSQRRKINHRHKEGGFHQETLKIFKEWWAIPGSNQ"
FT   rRNA            719439..722326
FT                   /gene="rRNA-23Sc"
FT                   /product="23S ribosomal RNA"
FT   CDS_pept        complement(722302..722460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0718"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93482"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93482"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M7F3"
FT                   /protein_id="BAC93482.1"
FT                   /translation="MVAKQILFLSSLFLKTEGKKSGKLFMFSTHSMFLHRVHQNPLGVV
FT                   WLSLTGN"
FT   rRNA            722447..722564
FT                   /gene="rRNA-5Ssc"
FT                   /product="5S ribosomal RNA"
FT   tRNA            722596..722672
FT                   /gene="tRNA-Asp-2"
FT                   /product="tRNA-Asp"
FT   tRNA            722742..722818
FT                   /gene="tRNA-Trp-1"
FT                   /product="tRNA-Trp"
FT   CDS_pept        723024..723854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0719"
FT                   /product="murein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93483"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93483"
FT                   /db_xref="GOA:Q7MNJ8"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNJ8"
FT                   /protein_id="BAC93483.1"
FT                   /translation="MFAKILASLCTMYSIPIWALQMTAWELVTAPTRERAQSIGSYANG
FT                   CLDGGVALPLEGAGYQVVRTERNRYFAHPETVNFIQELGYYADTHLASTLMIADVSLPR
FT                   GGRFSFGHASHQTGLDIDVWLKLNTSPLNKYELEQAKTESVVNFDTMTIRADEWRDEQF
FT                   ELIRAAAENGRVARIFVHAVIKQRLCQMETSTHRSWLRKVRPWWGHSSHMHVRLSCPQG
FT                   SDDCIEQALPPEGDGCGEEVLSWIERPTPTAKKAQEPEPISEACVTVLNQKREK"
FT   CDS_pept        complement(723889..724143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0720"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93484"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93484"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNJ7"
FT                   /protein_id="BAC93484.1"
FT                   /translation="MALLITDKCINCDMCDPECPNGAISMGDKIFEIDPNLCTECKGHY
FT                   DKPTCQSVCPITKCIITDPNHIETEEQLLEKFVIIQGLA"
FT   CDS_pept        complement(724147..725547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0721"
FT                   /product="collagenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93485"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93485"
FT                   /db_xref="GOA:Q7MNJ6"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNJ6"
FT                   /protein_id="BAC93485.1"
FT                   /translation="MTSNTPFVPELLSPAGSLKNMRYAFAYGADAVYAGQPRYSLRVRN
FT                   NEFNHENLKIGIDEAHALGKKFYVVCNIQPHNSKLKTFIRDLKPVVDMGPDALIMSDPG
FT                   LIMMVREAFPDMAIHLSVQANAVNWATVKFWAAYGVERVIVSRELSLEEIEEIRQQCPE
FT                   TELEVFVHGALCMAYSGRCLLSGYINKRDPNQGTCTNACRWEYKVVQGKEDDAGQIVEQ
FT                   FDPNAAQAIEVQEERPETTIGRGKPIDDVVLLSESHRPDEKMAAFEDEHGTYIMNSKDL
FT                   RAVQHVERLTQMGVHSLKIEGRTKSFYYCARTAQVYRKAIDDAVAGKPFDETLMGTLES
FT                   LAHRGYTEGFLRRHTHDAYQNYDYGYSVSDSQQFVGEFTGKRRGDLAEVEVKNKFVVGD
FT                   SLELMTPKGNVIFTLEQMENRKSESIDDAKGNGHFVFIPVPQDMDLSYALLMRNLNEGQ
FT                   DTRNPTGN"
FT   CDS_pept        complement(725690..726604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0722"
FT                   /product="DNA recombination-dependent growth factor C"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93486"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93486"
FT                   /db_xref="GOA:Q7MNJ5"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNJ5"
FT                   /protein_id="BAC93486.1"
FT                   /translation="MWFKNCMVYRVNREIEFNADQLEKQLAEFRYTPCGSQDKQKFGWV
FT                   SAMGRHGDMMTHVSEDRILICAKKEEKMLPASVIKESLNTKVEAMEAQEGRPLKKKEKE
FT                   TLKEEIIIDLLPRAFSRSNHTYVLILPKEGFILVDASSYKKAEDVLALLRKTMGSLPVV
FT                   PAIPEKAVETTLTEWVKTGQTPQGFHLLDEAELKSVLEDGGIIRCKKQELTSDEILSHI
FT                   AADKVVTKLALNWQERLEFVLADDASIKRLKFSDELRDQNDDIPREDQAARFDADFSLM
FT                   CGELSAFLPNLFQALGGLPHPNA"
FT   CDS_pept        726823..727512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0723"
FT                   /product="DNA-binding response regulator PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93487"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93487"
FT                   /db_xref="GOA:Q7MNJ4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNJ4"
FT                   /protein_id="BAC93487.1"
FT                   /translation="MSRRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDTAVNKLAEP
FT                   FPDLVLLDWMLPGGSGINFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYIT
FT                   KPFSPKELVARLKAVIRRVTPTALEDVIDVQGLKLDPVSHRVTANDAPVDMGPTEFKML
FT                   HFFMTHQERVYSREQLLNNVWGTNVYVEDRTVDVHIRRLRKALEDAGHDKLIQTVRGAG
FT                   YRFSTKA"
FT   CDS_pept        727533..728831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0724"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93488"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93488"
FT                   /db_xref="GOA:Q7MNJ3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNJ3"
FT                   /protein_id="BAC93488.1"
FT                   /translation="MVERLTWKKLAWELAFFYTPWVIVGWIFGYMPWLLLVATALQLGW
FT                   HLHNQVRLSAWLWDEKRLTPPSGSGNWESLFNGLYRLQQRQRRKRKELTNLIRRFRNGA
FT                   ESLPDAVVVFRAEGNIVWCNKLAQHLLGFHWPEDSGQPISNLLRTPDFIKYLSGNDFSE
FT                   PLEMSSPLNVERTLELRIVPYTEGEHLMVVRDVTQLKQLEGMRRNFFANVSHELRTPMT
FT                   VLQGYLEMTEDPDMLVGPMWGKAHRVMTEQLNRMNSLVNQLLTLSKIEASPIHELDEVV
FT                   DVPAMLEVLEKEAVSLSGDNQHAISFQVDKALKVYADEDQLRSAISNLVYNAVKYTPAG
FT                   ANVQVRWYRNSKGACLEVEDSGDGIEPQHIHRLTERFYRVDKARSRDTGGSGLGLAIVK
FT                   HALTHHDTHLDIQSKVGSGSKFSFVLPAKLVAK"
FT   CDS_pept        728828..729781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0725"
FT                   /product="ABC-type phosphate transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93489"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93489"
FT                   /db_xref="GOA:Q7MNJ2"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNJ2"
FT                   /protein_id="BAC93489.1"
FT                   /translation="MKRWWLSLLLMGGISASAQALDTPLQPYKKIPGVSGNLLSVGSDT
FT                   LAGMTTLWVEEFKALYPNINAQVQASGSSTAPPALTEQTAQFGPMSRPMRLREVEAFER
FT                   THGYKPTALRVAIDAIGI