(data stored in ACNUC7421 zone)

EMBL: BA000039

ID   BA000039; SV 2; circular; genomic DNA; STD; PRO; 2593857 BP.
AC   BA000039; AP005369-AP005377;
PR   Project:PRJNA308;
DT   26-OCT-2004 (Rel. 81, Created)
DT   10-OCT-2016 (Rel. 130, Last updated, Version 10)
DE   Thermosynechococcus elongatus BP-1 DNA, complete genome.
KW   .
OS   Thermosynechococcus elongatus BP-1
OC   Bacteria; Cyanobacteria; Synechococcales; Synechococcaceae;
OC   Thermosynechococcus.
RN   [1]
RP   1-2593857
RA   Sato S., Kaneko T.;
RT   ;
RL   Submitted (05-JUN-2002) to the INSDC.
RL   Contact:Shusei Sato Kazusa DNA Research Institute, Department of Plant
RL   Genome Research; 2-6-7 Kazusa-kamatari, Kisarazu, Chiba 292-0812, Japan URL
RL      :http://www.kazusa.or.jp/rhizobase/
RN   [2]
RX   DOI; 10.1093/dnares/9.4.123.
RX   PUBMED; 12240834.
RA   Nakamura Y., Kaneko T., Sato S., Ikeuchi M., Katoh H., Sasamoto S.,
RA   Watanabe A., Iriguchi M., Kawashima K., Kimura T., Kishida Y., Kiyokawa C.,
RA   Kohara M., Matsumoto M., Matsuno A., Nakazaki N., Shimpo S., Sugimoto M.,
RA   Takeuchi C., Yamada M., Tabata S.;
RT   "Complete genome structure of the thermophilic cyanobacterium
RT   Thermosynechococcus elongatus BP-1";
RL   DNA Res. 9(4):123-130(2002).
DR   MD5; 3a1000681a898b3ec2300c72df47fb74.
DR   BioSample; SAMD00061106.
DR   EnsemblGenomes-Gn; EBG00000032413.
DR   EnsemblGenomes-Gn; EBG00000032414.
DR   EnsemblGenomes-Gn; EBG00000032415.
DR   EnsemblGenomes-Gn; EBG00000032416.
DR   EnsemblGenomes-Gn; EBG00000032417.
DR   EnsemblGenomes-Gn; EBG00000032418.
DR   EnsemblGenomes-Gn; EBG00000032419.
DR   EnsemblGenomes-Gn; EBG00000032420.
DR   EnsemblGenomes-Gn; EBG00000032421.
DR   EnsemblGenomes-Gn; EBG00000032422.
DR   EnsemblGenomes-Gn; EBG00000032423.
DR   EnsemblGenomes-Gn; EBG00000032424.
DR   EnsemblGenomes-Gn; EBG00000032425.
DR   EnsemblGenomes-Gn; EBG00000032426.
DR   EnsemblGenomes-Gn; EBG00000032427.
DR   EnsemblGenomes-Gn; EBG00000032428.
DR   EnsemblGenomes-Gn; EBG00000032429.
DR   EnsemblGenomes-Gn; EBG00000032430.
DR   EnsemblGenomes-Gn; EBG00000032431.
DR   EnsemblGenomes-Gn; EBG00000032432.
DR   EnsemblGenomes-Gn; EBG00000032433.
DR   EnsemblGenomes-Gn; EBG00000032434.
DR   EnsemblGenomes-Gn; EBG00000032435.
DR   EnsemblGenomes-Gn; EBG00000032436.
DR   EnsemblGenomes-Gn; EBG00000032437.
DR   EnsemblGenomes-Gn; EBG00000032438.
DR   EnsemblGenomes-Gn; EBG00000032439.
DR   EnsemblGenomes-Gn; EBG00000032440.
DR   EnsemblGenomes-Gn; EBG00000032441.
DR   EnsemblGenomes-Gn; EBG00000032442.
DR   EnsemblGenomes-Gn; EBG00000032443.
DR   EnsemblGenomes-Gn; EBG00000032444.
DR   EnsemblGenomes-Gn; EBG00000032445.
DR   EnsemblGenomes-Gn; EBG00000032446.
DR   EnsemblGenomes-Gn; EBG00000032447.
DR   EnsemblGenomes-Gn; EBG00000032448.
DR   EnsemblGenomes-Gn; EBG00000032449.
DR   EnsemblGenomes-Gn; EBG00000032450.
DR   EnsemblGenomes-Gn; EBG00000032451.
DR   EnsemblGenomes-Gn; EBG00000032452.
DR   EnsemblGenomes-Gn; EBG00000032453.
DR   EnsemblGenomes-Gn; EBG00000032454.
DR   EnsemblGenomes-Gn; EBG00000032455.
DR   EnsemblGenomes-Gn; EBG00000032456.
DR   EnsemblGenomes-Gn; EBG00000032457.
DR   EnsemblGenomes-Gn; EBG00000032458.
DR   EnsemblGenomes-Gn; EBG00000032459.
DR   EnsemblGenomes-Gn; EBG00000032460.
DR   EnsemblGenomes-Gn; EBG00000622943.
DR   EnsemblGenomes-Gn; EBG00001174948.
DR   EnsemblGenomes-Gn; EBG00001174949.
DR   EnsemblGenomes-Gn; EBG00001174950.
DR   EnsemblGenomes-Gn; EBG00001174951.
DR   EnsemblGenomes-Gn; EBG00001174952.
DR   EnsemblGenomes-Gn; EBG00001174953.
DR   EnsemblGenomes-Gn; EBG00001174954.
DR   EnsemblGenomes-Gn; EBG00001174955.
DR   EnsemblGenomes-Gn; EBG00001174956.
DR   EnsemblGenomes-Gn; EBG00001174957.
DR   EnsemblGenomes-Gn; EBG00001174958.
DR   EnsemblGenomes-Gn; EBG00001174959.
DR   EnsemblGenomes-Gn; EBG00001174960.
DR   EnsemblGenomes-Gn; EBG00001174961.
DR   EnsemblGenomes-Gn; EBG00001174962.
DR   EnsemblGenomes-Gn; EBG00001174963.
DR   EnsemblGenomes-Gn; EBG00001174964.
DR   EnsemblGenomes-Gn; EBG00001174965.
DR   EnsemblGenomes-Gn; EBG00001174966.
DR   EnsemblGenomes-Gn; EBG00001174967.
DR   EnsemblGenomes-Gn; EBG00001174968.
DR   EnsemblGenomes-Gn; EBG00001174969.
DR   EnsemblGenomes-Gn; EBG00001174970.
DR   EnsemblGenomes-Gn; EBG00001174971.
DR   EnsemblGenomes-Gn; EBG00001174972.
DR   EnsemblGenomes-Gn; EBG00001174973.
DR   EnsemblGenomes-Gn; EBG00001174974.
DR   EnsemblGenomes-Gn; EBG00001174975.
DR   EnsemblGenomes-Gn; EBG00001174976.
DR   EnsemblGenomes-Gn; EBG00001174977.
DR   EnsemblGenomes-Gn; EBG00001174978.
DR   EnsemblGenomes-Gn; EBG00001174979.
DR   EnsemblGenomes-Gn; EBG00001174980.
DR   EnsemblGenomes-Gn; EBG00001174981.
DR   EnsemblGenomes-Gn; EBG00001174982.
DR   EnsemblGenomes-Gn; EBG00001174983.
DR   EnsemblGenomes-Gn; EBG00001174984.
DR   EnsemblGenomes-Gn; EBG00001174985.
DR   EnsemblGenomes-Gn; EBG00001174986.
DR   EnsemblGenomes-Gn; EBG00001174987.
DR   EnsemblGenomes-Gn; EBG00001174988.
DR   EnsemblGenomes-Gn; EBG00001174989.
DR   EnsemblGenomes-Gn; EBG00001174990.
DR   EnsemblGenomes-Gn; EBG00001174991.
DR   EnsemblGenomes-Gn; EBG00001174992.
DR   EnsemblGenomes-Gn; EBG00001174993.
DR   EnsemblGenomes-Gn; EBG00001174994.
DR   EnsemblGenomes-Gn; EBG00001174995.
DR   EnsemblGenomes-Gn; EBG00001174996.
DR   EnsemblGenomes-Gn; EBG00001174997.
DR   EnsemblGenomes-Gn; EBG00001174998.
DR   EnsemblGenomes-Gn; EBG00001174999.
DR   EnsemblGenomes-Gn; EBG00001175000.
DR   EnsemblGenomes-Gn; EBG00001175001.
DR   EnsemblGenomes-Gn; EBG00001175002.
DR   EnsemblGenomes-Tr; EBG00000032413-1.
DR   EnsemblGenomes-Tr; EBG00000032414-1.
DR   EnsemblGenomes-Tr; EBG00000032415-1.
DR   EnsemblGenomes-Tr; EBG00000032416-1.
DR   EnsemblGenomes-Tr; EBG00000032417-1.
DR   EnsemblGenomes-Tr; EBG00000032418-1.
DR   EnsemblGenomes-Tr; EBG00000032419-1.
DR   EnsemblGenomes-Tr; EBG00000032420-1.
DR   EnsemblGenomes-Tr; EBG00000032421-1.
DR   EnsemblGenomes-Tr; EBG00000032422-1.
DR   EnsemblGenomes-Tr; EBG00000032423-1.
DR   EnsemblGenomes-Tr; EBG00000032424-1.
DR   EnsemblGenomes-Tr; EBG00000032425-1.
DR   EnsemblGenomes-Tr; EBG00000032426-1.
DR   EnsemblGenomes-Tr; EBG00000032427-1.
DR   EnsemblGenomes-Tr; EBG00000032428-1.
DR   EnsemblGenomes-Tr; EBG00000032429-1.
DR   EnsemblGenomes-Tr; EBG00000032430-1.
DR   EnsemblGenomes-Tr; EBG00000032431-1.
DR   EnsemblGenomes-Tr; EBG00000032432-1.
DR   EnsemblGenomes-Tr; EBG00000032433-1.
DR   EnsemblGenomes-Tr; EBG00000032434-1.
DR   EnsemblGenomes-Tr; EBG00000032435-1.
DR   EnsemblGenomes-Tr; EBG00000032436-1.
DR   EnsemblGenomes-Tr; EBG00000032437-1.
DR   EnsemblGenomes-Tr; EBG00000032438-1.
DR   EnsemblGenomes-Tr; EBG00000032439-1.
DR   EnsemblGenomes-Tr; EBG00000032440-1.
DR   EnsemblGenomes-Tr; EBG00000032441-1.
DR   EnsemblGenomes-Tr; EBG00000032442-1.
DR   EnsemblGenomes-Tr; EBG00000032443-1.
DR   EnsemblGenomes-Tr; EBG00000032444-1.
DR   EnsemblGenomes-Tr; EBG00000032445-1.
DR   EnsemblGenomes-Tr; EBG00000032446-1.
DR   EnsemblGenomes-Tr; EBG00000032447-1.
DR   EnsemblGenomes-Tr; EBG00000032448-1.
DR   EnsemblGenomes-Tr; EBG00000032449-1.
DR   EnsemblGenomes-Tr; EBG00000032450-1.
DR   EnsemblGenomes-Tr; EBG00000032451-1.
DR   EnsemblGenomes-Tr; EBG00000032452-1.
DR   EnsemblGenomes-Tr; EBG00000032453-1.
DR   EnsemblGenomes-Tr; EBG00000032454-1.
DR   EnsemblGenomes-Tr; EBG00000032455-1.
DR   EnsemblGenomes-Tr; EBG00000032456-1.
DR   EnsemblGenomes-Tr; EBG00000032457-1.
DR   EnsemblGenomes-Tr; EBG00000032458-1.
DR   EnsemblGenomes-Tr; EBG00000032459-1.
DR   EnsemblGenomes-Tr; EBG00000032460-1.
DR   EnsemblGenomes-Tr; EBG00000622943-1.
DR   EnsemblGenomes-Tr; EBT00001753375.
DR   EnsemblGenomes-Tr; EBT00001753376.
DR   EnsemblGenomes-Tr; EBT00001753377.
DR   EnsemblGenomes-Tr; EBT00001753378.
DR   EnsemblGenomes-Tr; EBT00001753379.
DR   EnsemblGenomes-Tr; EBT00001753380.
DR   EnsemblGenomes-Tr; EBT00001753381.
DR   EnsemblGenomes-Tr; EBT00001753382.
DR   EnsemblGenomes-Tr; EBT00001753383.
DR   EnsemblGenomes-Tr; EBT00001753384.
DR   EnsemblGenomes-Tr; EBT00001753385.
DR   EnsemblGenomes-Tr; EBT00001753386.
DR   EnsemblGenomes-Tr; EBT00001753387.
DR   EnsemblGenomes-Tr; EBT00001753388.
DR   EnsemblGenomes-Tr; EBT00001753389.
DR   EnsemblGenomes-Tr; EBT00001753390.
DR   EnsemblGenomes-Tr; EBT00001753391.
DR   EnsemblGenomes-Tr; EBT00001753392.
DR   EnsemblGenomes-Tr; EBT00001753393.
DR   EnsemblGenomes-Tr; EBT00001753394.
DR   EnsemblGenomes-Tr; EBT00001753395.
DR   EnsemblGenomes-Tr; EBT00001753396.
DR   EnsemblGenomes-Tr; EBT00001753397.
DR   EnsemblGenomes-Tr; EBT00001753398.
DR   EnsemblGenomes-Tr; EBT00001753399.
DR   EnsemblGenomes-Tr; EBT00001753400.
DR   EnsemblGenomes-Tr; EBT00001753401.
DR   EnsemblGenomes-Tr; EBT00001753402.
DR   EnsemblGenomes-Tr; EBT00001753403.
DR   EnsemblGenomes-Tr; EBT00001753404.
DR   EnsemblGenomes-Tr; EBT00001753405.
DR   EnsemblGenomes-Tr; EBT00001753406.
DR   EnsemblGenomes-Tr; EBT00001753407.
DR   EnsemblGenomes-Tr; EBT00001753408.
DR   EnsemblGenomes-Tr; EBT00001753409.
DR   EnsemblGenomes-Tr; EBT00001753410.
DR   EnsemblGenomes-Tr; EBT00001753411.
DR   EnsemblGenomes-Tr; EBT00001753412.
DR   EnsemblGenomes-Tr; EBT00001753413.
DR   EnsemblGenomes-Tr; EBT00001753414.
DR   EnsemblGenomes-Tr; EBT00001753415.
DR   EnsemblGenomes-Tr; EBT00001753416.
DR   EnsemblGenomes-Tr; EBT00001753417.
DR   EnsemblGenomes-Tr; EBT00001753418.
DR   EnsemblGenomes-Tr; EBT00001753419.
DR   EnsemblGenomes-Tr; EBT00001753420.
DR   EnsemblGenomes-Tr; EBT00001753421.
DR   EnsemblGenomes-Tr; EBT00001753422.
DR   EnsemblGenomes-Tr; EBT00001753423.
DR   EnsemblGenomes-Tr; EBT00001753424.
DR   EnsemblGenomes-Tr; EBT00001753425.
DR   EnsemblGenomes-Tr; EBT00001753426.
DR   EnsemblGenomes-Tr; EBT00001753427.
DR   EnsemblGenomes-Tr; EBT00001753428.
DR   EnsemblGenomes-Tr; EBT00001753429.
DR   EuropePMC; PMC1446974; 16585762.
DR   EuropePMC; PMC2174460; 17908306.
DR   EuropePMC; PMC2242806; 18045455.
DR   EuropePMC; PMC2442094; 18534010.
DR   EuropePMC; PMC2675224; 19218404.
DR   EuropePMC; PMC2679770; 19331657.
DR   EuropePMC; PMC3271361; 21320320.
DR   EuropePMC; PMC6297720; 30619416.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00028; Intron_gpI.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01116; Yfr1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01701; Cyano-1.
DR   RFAM; RF01739; glnA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   SILVA-LSU; BA000039.
DR   SILVA-SSU; BA000039.
FH   Key             Location/Qualifiers
FT   source          1..2593857
FT                   /organism="Thermosynechococcus elongatus BP-1"
FT                   /strain="BP-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:197221"
FT   CDS_pept        129..1142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0001"
FT                   /note="ORF_ID:tlr0001"
FT                   /note="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07554"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07554"
FT                   /db_xref="GOA:Q8DMW0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMW0"
FT                   /protein_id="BAC07554.1"
FT   CDS_pept        complement(1351..2331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0002"
FT                   /product="serine proteinase"
FT                   /note="ORF_ID:tll0002"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07555"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07555"
FT                   /db_xref="GOA:Q8DMV9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMV9"
FT                   /protein_id="BAC07555.1"
FT   CDS_pept        complement(2402..2578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0003"
FT                   /note="ORF_ID:tsl0003"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07556"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07556"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMV8"
FT                   /protein_id="BAC07556.1"
FT                   LSIAFARSHPLHP"
FT   CDS_pept        2577..2762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0004"
FT                   /note="ORF_ID:tsr0004"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07557"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07557"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMV7"
FT                   /protein_id="BAC07557.1"
FT                   LQALMKKGLIVVEELG"
FT   CDS_pept        2816..4534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureC"
FT                   /product="urease alpha subunit"
FT                   /note="ORF_ID:tlr0005"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07558"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07558"
FT                   /db_xref="GOA:Q8DMV6"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMV6"
FT                   /protein_id="BAC07558.1"
FT   CDS_pept        4538..5032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0006"
FT                   /note="ORF_ID:tlr0006"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07559"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07559"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMV5"
FT                   /protein_id="BAC07559.1"
FT                   L"
FT   CDS_pept        complement(5430..7640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0007"
FT                   /product="cellulose synthase"
FT                   /note="ORF_ID:tll0007"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07560"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07560"
FT                   /db_xref="GOA:Q8DMV4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMV4"
FT                   /protein_id="BAC07560.1"
FT   CDS_pept        complement(7667..8746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf81"
FT                   /note="ORF_ID:tll0008"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07561"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07561"
FT                   /db_xref="GOA:Q8DMV3"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMV3"
FT                   /protein_id="BAC07561.1"
FT   CDS_pept        complement(8796..9758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0009"
FT                   /note="ORF_ID:tll0009"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07562"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07562"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMV2"
FT                   /protein_id="BAC07562.1"
FT   CDS_pept        9717..10886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0010"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:tlr0010"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07563"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07563"
FT                   /db_xref="GOA:Q8DMV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMV1"
FT                   /protein_id="BAC07563.1"
FT   CDS_pept        10886..11296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0011"
FT                   /note="ORF_ID:tlr0011"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07564"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07564"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMV0"
FT                   /protein_id="BAC07564.1"
FT   CDS_pept        11299..12438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0012"
FT                   /note="ORF_ID:tlr0012"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07565"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07565"
FT                   /db_xref="GOA:Q8DMU9"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMU9"
FT                   /protein_id="BAC07565.1"
FT   CDS_pept        complement(12457..13638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0013"
FT                   /product="N-acetyl-L-amino acid amidohydrolase"
FT                   /note="ORF_ID:tll0013"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07566"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07566"
FT                   /db_xref="GOA:Q8DMU8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMU8"
FT                   /protein_id="BAC07566.1"
FT   CDS_pept        complement(13685..14158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0014"
FT                   /note="ORF_ID:tll0014"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07567"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07567"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMU7"
FT                   /protein_id="BAC07567.1"
FT   CDS_pept        complement(14162..15625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0015"
FT                   /product="lignostilbene-alpha,beta-dioxygenase"
FT                   /note="ORF_ID:tll0015"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07568"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07568"
FT                   /db_xref="GOA:Q8DMU6"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMU6"
FT                   /protein_id="BAC07568.1"
FT   CDS_pept        complement(15622..16977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0016"
FT                   /note="ORF_ID:tll0016"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07569"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07569"
FT                   /db_xref="GOA:Q8DMU5"
FT                   /db_xref="InterPro:IPR004324"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039309"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMU5"
FT                   /protein_id="BAC07569.1"
FT   CDS_pept        complement(17096..17308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0017"
FT                   /note="ORF_ID:tsl0017"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07570"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07570"
FT                   /db_xref="GOA:Q8DMU4"
FT                   /db_xref="InterPro:IPR020905"
FT                   /db_xref="PDB:6HUM"
FT                   /db_xref="PDB:6NBQ"
FT                   /db_xref="PDB:6NBX"
FT                   /db_xref="PDB:6NBY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMU4"
FT                   /protein_id="BAC07570.1"
FT   CDS_pept        17429..18859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0018"
FT                   /product="phosphomannose isomerase / guanosine
FT                   5'-diphospho-D-mannose pyrophosphorylase"
FT                   /note="ORF_ID:tlr0018"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07571"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07571"
FT                   /db_xref="GOA:Q8DMU3"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMU3"
FT                   /protein_id="BAC07571.1"
FT                   GEDDIVRFEDCYGRKTEE"
FT   CDS_pept        complement(18870..19319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0019"
FT                   /note="ORF_ID:tll0019"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07572"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07572"
FT                   /db_xref="GOA:Q8DMU2"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMU2"
FT                   /protein_id="BAC07572.1"
FT   CDS_pept        complement(19371..20294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtE"
FT                   /product="geranylgeranyl pyrophosphate synthase"
FT                   /note="ORF_ID:tll0020"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07573"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07573"
FT                   /db_xref="GOA:Q8DMU1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMU1"
FT                   /protein_id="BAC07573.1"
FT   CDS_pept        complement(20305..21150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /product="FolD bifunctional protein"
FT                   /note="ORF_ID:tll0021"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07574"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07574"
FT                   /db_xref="GOA:Q8DMU0"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMU0"
FT                   /protein_id="BAC07574.1"
FT                   "
FT   CDS_pept        complement(21388..21723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0022"
FT                   /note="ORF_ID:tll0022"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07575"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07575"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMT9"
FT                   /protein_id="BAC07575.1"
FT                   SPAGDRP"
FT   CDS_pept        complement(21720..21917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0023"
FT                   /note="ORF_ID:tsl0023"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07576"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07576"
FT                   /db_xref="GOA:Q8DMT8"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMT8"
FT                   /protein_id="BAC07576.1"
FT   CDS_pept        complement(21994..22638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0024"
FT                   /note="ORF_ID:tll0024"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07577"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07577"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMT7"
FT                   /protein_id="BAC07577.1"
FT   CDS_pept        complement(22644..23105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0025"
FT                   /product="transcription regulator Fur family"
FT                   /note="ORF_ID:tll0025"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07578"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07578"
FT                   /db_xref="GOA:Q8DMT6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMT6"
FT                   /protein_id="BAC07578.1"
FT   CDS_pept        complement(23238..23537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0026"
FT                   /note="ORF_ID:tll0026"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07579"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07579"
FT                   /db_xref="GOA:Q8DMT5"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMT5"
FT                   /protein_id="BAC07579.1"
FT   CDS_pept        23700..24683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0027"
FT                   /note="ORF_ID:tlr0027"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07580"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07580"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMT4"
FT                   /protein_id="BAC07580.1"
FT   CDS_pept        24680..25006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0028"
FT                   /note="ORF_ID:tlr0028"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07581"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07581"
FT                   /db_xref="GOA:Q8DMT3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMT3"
FT                   /protein_id="BAC07581.1"
FT                   GQRS"
FT   CDS_pept        25137..26279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0029"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="ORF_ID:tlr0029"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07582"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07582"
FT                   /db_xref="GOA:Q8DMT2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011649"
FT                   /db_xref="InterPro:IPR023527"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMT2"
FT                   /protein_id="BAC07582.1"
FT   CDS_pept        complement(26276..27235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0030"
FT                   /note="ORF_ID:tll0030"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07583"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07583"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMT1"
FT                   /protein_id="BAC07583.1"
FT   mobile_element  join(27344..27971,28811..30566)
FT                   /mobile_element_type="other:TelI4a"
FT                   /note="groupII intron"
FT   mobile_element  27972..28810
FT                   /mobile_element_type="other:TelI3a"
FT                   /note="groupII intron"
FT   CDS_pept        28791..30485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0031"
FT                   /product="reverse transcriptase"
FT                   /note="ORF_ID:tlr0031"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07584"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07584"
FT                   /db_xref="GOA:Q8DMT0"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMT0"
FT                   /protein_id="BAC07584.1"
FT   CDS_pept        complement(30580..31596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0032"
FT                   /product="UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine
FT                   N-acyltransferase"
FT                   /note="ORF_ID:tll0032"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07585"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07585"
FT                   /db_xref="GOA:Q8DMS9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMS9"
FT                   /protein_id="BAC07585.1"
FT   CDS_pept        31799..31984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nblA"
FT                   /product="phycobilisome degradation protein"
FT                   /note="ORF_ID:tsr0033"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07586"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07586"
FT                   /db_xref="InterPro:IPR007574"
FT                   /db_xref="InterPro:IPR036904"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMS8"
FT                   /protein_id="BAC07586.1"
FT                   LMMKDNVIRSLVKRAA"
FT   CDS_pept        complement(32156..32449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0034"
FT                   /note="ORF_ID:tsl0034"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07587"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07587"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMS7"
FT                   /protein_id="BAC07587.1"
FT   CDS_pept        32957..33289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0035"
FT                   /note="ORF_ID:tlr0035"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07588"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07588"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMS6"
FT                   /protein_id="BAC07588.1"
FT                   LLLRQE"
FT   CDS_pept        33336..34058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodB"
FT                   /product="superoxide dismutase"
FT                   /note="ORF_ID:tlr0036"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07589"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07589"
FT                   /db_xref="GOA:Q8DMS5"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMS5"
FT                   /protein_id="BAC07589.1"
FT                   VNWPWVSDRYAQMRELLA"
FT   CDS_pept        complement(34003..35025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0037"
FT                   /product="phosphate starvation-induced protein"
FT                   /note="ORF_ID:tll0037"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07590"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07590"
FT                   /db_xref="GOA:Q8DMS4"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMS4"
FT                   /protein_id="BAC07590.1"
FT                   "
FT   CDS_pept        complement(35035..35208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps21"
FT                   /product="30S ribosomal protein S21"
FT                   /note="ORF_ID:tsl0038"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07591"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07591"
FT                   /db_xref="GOA:Q8DMS3"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMS3"
FT                   /protein_id="BAC07591.1"
FT                   KRKQEAARKRNR"
FT   CDS_pept        complement(35212..35565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0039"
FT                   /note="ORF_ID:tll0039"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07592"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07592"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMS2"
FT                   /protein_id="BAC07592.1"
FT                   SRRRFYPSSRRQS"
FT   CDS_pept        complement(35569..35820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps16"
FT                   /product="30S ribosomal protein S16"
FT                   /note="ORF_ID:tsl0040"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07593"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07593"
FT                   /db_xref="GOA:Q8DMS1"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMS1"
FT                   /protein_id="BAC07593.1"
FT   CDS_pept        35921..36817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /product="malonyl coenzyme A-acyl carrier protein
FT                   transacylase"
FT                   /note="ORF_ID:tlr0041"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07594"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07594"
FT                   /db_xref="GOA:Q8DMS0"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMS0"
FT                   /protein_id="BAC07594.1"
FT                   EITVTGVATIASLESLV"
FT   CDS_pept        36814..37449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0042"
FT                   /note="ORF_ID:tlr0042"
FT                   /note="probable acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07595"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07595"
FT                   /db_xref="GOA:Q8DMR9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMR9"
FT                   /protein_id="BAC07595.1"
FT   CDS_pept        complement(37446..38468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap1"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /note="ORF_ID:tll0043"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07596"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07596"
FT                   /db_xref="GOA:Q8DMR8"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMR8"
FT                   /protein_id="BAC07596.1"
FT                   "
FT   CDS_pept        complement(38491..38826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0044"
FT                   /note="ORF_ID:tll0044"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07597"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07597"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMR7"
FT                   /protein_id="BAC07597.1"
FT                   DPTLPRY"
FT   CDS_pept        complement(38879..40426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhB"
FT                   /product="NADH dehydrogenase subunit 2"
FT                   /note="ORF_ID:tll0045"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07598"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07598"
FT                   /db_xref="GOA:Q8DMR6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="PDB:6HUM"
FT                   /db_xref="PDB:6NBQ"
FT                   /db_xref="PDB:6NBX"
FT                   /db_xref="PDB:6NBY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMR6"
FT                   /protein_id="BAC07598.1"
FT   CDS_pept        complement(40601..41497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0046"
FT                   /note="ORF_ID:tll0046"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07599"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07599"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMR5"
FT                   /protein_id="BAC07599.1"
FT                   GVAAELDGDRGSLQVLL"
FT   CDS_pept        complement(41499..41837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0047"
FT                   /note="ORF_ID:tll0047"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07600"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07600"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMR4"
FT                   /protein_id="BAC07600.1"
FT                   FCRNSNFC"
FT   CDS_pept        complement(41841..42398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /product="ferric uptake regulation protein"
FT                   /note="ORF_ID:tll0048"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07601"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07601"
FT                   /db_xref="GOA:Q8DMR3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMR3"
FT                   /protein_id="BAC07601.1"
FT   CDS_pept        complement(42585..44516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0049"
FT                   /product="penicillin-binding protein"
FT                   /note="ORF_ID:tll0049"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07602"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07602"
FT                   /db_xref="GOA:Q8DMR2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMR2"
FT                   /protein_id="BAC07602.1"
FT                   PKPPRPKN"
FT   CDS_pept        44678..45904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /product="tyrosyl tRNA synthetase"
FT                   /note="ORF_ID:tlr0050"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07603"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07603"
FT                   /db_xref="GOA:Q8DMR1"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMR1"
FT                   /protein_id="BAC07603.1"
FT                   KKKFLRFVP"
FT   CDS_pept        46286..49024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0051"
FT                   /note="ORF_ID:tlr0051"
FT                   /note="probable proteinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07604"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07604"
FT                   /db_xref="GOA:Q8DMR0"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMR0"
FT                   /protein_id="BAC07604.1"
FT   CDS_pept        49029..49751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA"
FT                   /note="ORF_ID:tlr0052"
FT                   /note="putative c-type cytochrome biogenesis protein CcdA"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07605"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07605"
FT                   /db_xref="GOA:Q8DMQ9"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMQ9"
FT                   /protein_id="BAC07605.1"
FT                   ISGVLLIAFGVIALATRL"
FT   CDS_pept        50147..50869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0053"
FT                   /product="branched-chain amino acid ABC transporter
FT                   ATP-binding protein"
FT                   /note="ORF_ID:tlr0053"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07606"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07606"
FT                   /db_xref="GOA:Q8DMQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMQ8"
FT                   /protein_id="BAC07606.1"
FT                   LNDPKVGELYLGIVRAEP"
FT   CDS_pept        complement(50866..51441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0054"
FT                   /product="guanylate kinase"
FT                   /note="ORF_ID:tll0054"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07607"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07607"
FT                   /db_xref="GOA:Q8DMQ7"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMQ7"
FT                   /protein_id="BAC07607.1"
FT   CDS_pept        51518..52021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0055"
FT                   /note="ORF_ID:tlr0055"
FT                   /note="biopolymer transport ExbD like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07608"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07608"
FT                   /db_xref="GOA:Q8DMQ6"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMQ6"
FT                   /protein_id="BAC07608.1"
FT                   PSNP"
FT   CDS_pept        52031..52954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0056"
FT                   /note="GTP-binding protein ERA homolog"
FT                   /note="ORF_ID:tlr0056"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07609"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07609"
FT                   /db_xref="GOA:Q8DMQ5"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMQ5"
FT                   /protein_id="BAC07609.1"
FT   CDS_pept        52959..53561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureG"
FT                   /product="urease accessory protein G"
FT                   /note="ORF_ID:tlr0057"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07610"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07610"
FT                   /db_xref="GOA:Q8DMQ4"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMQ4"
FT                   /protein_id="BAC07610.1"
FT   CDS_pept        53598..54584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0058"
FT                   /note="ORF_ID:tlr0058"
FT                   /note="similar to serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07611"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07611"
FT                   /db_xref="GOA:Q8DMQ3"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMQ3"
FT                   /protein_id="BAC07611.1"
FT   CDS_pept        54653..55396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0059"
FT                   /note="ORF_ID:tlr0059"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07612"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07612"
FT                   /db_xref="InterPro:IPR010328"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMQ2"
FT                   /protein_id="BAC07612.1"
FT   CDS_pept        complement(55378..56664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0060"
FT                   /note="ORF_ID:tll0060"
FT                   /note="similar to DNA repair protein RAD32"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07613"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07613"
FT                   /db_xref="GOA:Q8DMQ1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMQ1"
FT                   /protein_id="BAC07613.1"
FT   CDS_pept        complement(56678..58132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0061"
FT                   /note="ORF_ID:tll0061"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07614"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07614"
FT                   /db_xref="GOA:Q8DMQ0"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013857"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR039131"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMQ0"
FT                   /protein_id="BAC07614.1"
FT   CDS_pept        complement(58122..58700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0062"
FT                   /note="ORF_ID:tll0062"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07615"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07615"
FT                   /db_xref="GOA:Q8DMP9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMP9"
FT                   /protein_id="BAC07615.1"
FT   CDS_pept        complement(58741..58911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0063"
FT                   /note="ORF_ID:tsl0063"
FT                   /note="similar to high light-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07616"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07616"
FT                   /db_xref="GOA:Q8DMP8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMP8"
FT                   /protein_id="BAC07616.1"
FT                   AGLVAIAVGVS"
FT   CDS_pept        complement(58964..60127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0064"
FT                   /note="ORF_ID:tll0064"
FT                   /note="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07617"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07617"
FT                   /db_xref="GOA:Q8DMP7"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMP7"
FT                   /protein_id="BAC07617.1"
FT   CDS_pept        complement(60124..60957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /product="thiamine biosynthesis protein"
FT                   /note="ORF_ID:tll0065"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07618"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07618"
FT                   /db_xref="GOA:Q8DMP6"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMP6"
FT                   /protein_id="BAC07618.1"
FT   CDS_pept        61076..61543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0066"
FT                   /note="ORF_ID:tlr0066"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07619"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07619"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMP5"
FT                   /protein_id="BAC07619.1"
FT   CDS_pept        61591..62127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /product="riboflavin synthase beta subunit"
FT                   /note="ORF_ID:tlr0067"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07620"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07620"
FT                   /db_xref="GOA:Q8DMP4"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMP4"
FT                   /protein_id="BAC07620.1"
FT                   PTTKLSSSTRILTDG"
FT   CDS_pept        complement(62148..62444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0068"
FT                   /note="ORF_ID:tsl0068"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07621"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07621"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMP3"
FT                   /protein_id="BAC07621.1"
FT   CDS_pept        62718..63740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /product="aspartate beta-semialdehyde dehydrogenese"
FT                   /note="ORF_ID:tlr0069"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07622"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07622"
FT                   /db_xref="GOA:Q8DMP2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMP2"
FT                   /protein_id="BAC07622.1"
FT                   "
FT   CDS_pept        complement(63777..64613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0070"
FT                   /note="ORF_ID:tll0070"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07623"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07623"
FT                   /db_xref="InterPro:IPR014990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMP1"
FT                   /protein_id="BAC07623.1"
FT   CDS_pept        complement(64616..65293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0071"
FT                   /note="ORF_ID:tll0071"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07624"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07624"
FT                   /db_xref="GOA:Q8DMP0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMP0"
FT                   /protein_id="BAC07624.1"
FT                   PVE"
FT   CDS_pept        complement(65298..66485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0072"
FT                   /note="ORF_ID:tll0072"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07625"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07625"
FT                   /db_xref="GOA:Q8DMN9"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMN9"
FT                   /protein_id="BAC07625.1"
FT   CDS_pept        complement(66470..67834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /note="ORF_ID:tll0073"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07626"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07626"
FT                   /db_xref="GOA:Q8DMN8"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMN8"
FT                   /protein_id="BAC07626.1"
FT   CDS_pept        67985..68413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0074"
FT                   /note="ORF_ID:tlr0074"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07627"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07627"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMN7"
FT                   /protein_id="BAC07627.1"
FT   CDS_pept        complement(68437..68907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0075"
FT                   /note="ORF_ID:tll0075"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07628"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07628"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMN6"
FT                   /protein_id="BAC07628.1"
FT   CDS_pept        complement(68908..70407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf46"
FT                   /note="ORF_ID:tll0076"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07629"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07629"
FT                   /db_xref="GOA:Q8DMN5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMN5"
FT                   /protein_id="BAC07629.1"
FT   CDS_pept        complement(70404..70901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0077"
FT                   /note="ORF_ID:tll0077"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07630"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07630"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMN4"
FT                   /protein_id="BAC07630.1"
FT                   SP"
FT   CDS_pept        complement(70904..71335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0078"
FT                   /note="ORF_ID:tll0078"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07631"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07631"
FT                   /db_xref="GOA:Q8DMN3"
FT                   /db_xref="InterPro:IPR007024"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="PDB:1X0P"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMN3"
FT                   /protein_id="BAC07631.1"
FT   CDS_pept        complement(71398..71889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0079"
FT                   /note="ORF_ID:tll0079"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07632"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07632"
FT                   /db_xref="GOA:Q8DMN2"
FT                   /db_xref="InterPro:IPR021215"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMN2"
FT                   /protein_id="BAC07632.1"
FT                   "
FT   CDS_pept        complement(71858..72994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /note="ORF_ID:tll0080"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07633"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07633"
FT                   /db_xref="GOA:Q8CWM7"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWM7"
FT                   /protein_id="BAC07633.1"
FT   CDS_pept        73361..73999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl3"
FT                   /product="50S ribosomal protein L3"
FT                   /note="ORF_ID:tlr0081"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07634"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07634"
FT                   /db_xref="GOA:Q8DMN1"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMN1"
FT                   /protein_id="BAC07634.1"
FT   CDS_pept        74016..74648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl4"
FT                   /product="50S ribosomal protein L4"
FT                   /note="ORF_ID:tlr0082"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07635"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07635"
FT                   /db_xref="GOA:Q8DMN0"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMN0"
FT                   /protein_id="BAC07635.1"
FT   CDS_pept        74641..74943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl23"
FT                   /product="50S ribosomal protein L23"
FT                   /note="ORF_ID:tlr0083"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07636"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07636"
FT                   /db_xref="GOA:Q8DMM9"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMM9"
FT                   /protein_id="BAC07636.1"
FT   CDS_pept        74955..75821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl2"
FT                   /product="50S ribosomal protein L2"
FT                   /note="ORF_ID:tlr0084"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07637"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07637"
FT                   /db_xref="GOA:Q8DMM8"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMM8"
FT                   /protein_id="BAC07637.1"
FT                   GRGGRQS"
FT   CDS_pept        75844..76122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps19"
FT                   /product="30S ribosomal protein S19"
FT                   /note="ORF_ID:tsr0085"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07638"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07638"
FT                   /db_xref="GOA:Q8DMM7"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMM7"
FT                   /protein_id="BAC07638.1"
FT   CDS_pept        76153..76521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl22"
FT                   /product="50S ribosomal protein L22"
FT                   /note="ORF_ID:tlr0086"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07639"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07639"
FT                   /db_xref="GOA:Q8DMM6"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMM6"
FT                   /protein_id="BAC07639.1"
FT                   PTCHITIAVAPQNTADES"
FT   CDS_pept        76534..77250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps3"
FT                   /product="30S ribosomal protein S3"
FT                   /note="ORF_ID:tlr0087"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07640"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07640"
FT                   /db_xref="GOA:P59187"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59187"
FT                   /protein_id="BAC07640.1"
FT                   RRSPQRRLPQFENRSN"
FT   CDS_pept        77265..77696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl16"
FT                   /product="50S ribosomal protein L16"
FT                   /note="ORF_ID:tlr0088"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07641"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07641"
FT                   /db_xref="GOA:Q8DMM5"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMM5"
FT                   /protein_id="BAC07641.1"
FT   CDS_pept        77699..77911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl29"
FT                   /product="50S ribosomal protein L29"
FT                   /note="ORF_ID:tsr0089"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07642"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07642"
FT                   /db_xref="GOA:Q8DMM4"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMM4"
FT                   /protein_id="BAC07642.1"
FT   CDS_pept        77911..78159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps17"
FT                   /product="30S ribosomal protein S17"
FT                   /note="ORF_ID:tsr0090"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07643"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07643"
FT                   /db_xref="GOA:Q8DMM3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMM3"
FT                   /protein_id="BAC07643.1"
FT   CDS_pept        78172..78540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl14"
FT                   /product="50S ribosomal protein L14"
FT                   /note="ORF_ID:tlr0091"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07644"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07644"
FT                   /db_xref="GOA:Q8DMM2"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMM2"
FT                   /protein_id="BAC07644.1"
FT                   ELRDKNFTKIVSLAPEVL"
FT   CDS_pept        78540..78893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl24"
FT                   /product="50S ribosomal protein L24"
FT                   /note="ORF_ID:tlr0092"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07645"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07645"
FT                   /db_xref="GOA:Q8DMM1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMM1"
FT                   /protein_id="BAC07645.1"
FT                   KVRMLKKTGEIID"
FT   CDS_pept        78951..79496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl5"
FT                   /product="50S ribosomal protein L5"
FT                   /note="ORF_ID:tlr0093"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07646"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07646"
FT                   /db_xref="GOA:Q8DMM0"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMM0"
FT                   /protein_id="BAC07646.1"
FT                   DEEGRALLKAMGMPFREN"
FT   CDS_pept        79526..79927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps8"
FT                   /product="30S ribosomal protein S8"
FT                   /note="ORF_ID:tlr0094"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07647"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07647"
FT                   /db_xref="GOA:Q8DML9"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DML9"
FT                   /protein_id="BAC07647.1"
FT   CDS_pept        79946..80509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl6"
FT                   /product="50S ribosomal protein L6"
FT                   /note="ORF_ID:tlr0095"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07648"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07648"
FT                   /db_xref="GOA:Q8DML8"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DML8"
FT                   /protein_id="BAC07648.1"
FT   CDS_pept        80510..80872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl18"
FT                   /product="50S ribosomal protein L18"
FT                   /note="ORF_ID:tlr0096"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07649"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07649"
FT                   /db_xref="GOA:Q8DML7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DML7"
FT                   /protein_id="BAC07649.1"
FT                   RVKALADAAREGGLDF"
FT   CDS_pept        80884..81408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps5"
FT                   /product="30S ribosomal protein S5"
FT                   /note="ORF_ID:tlr0097"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07650"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07650"
FT                   /db_xref="GOA:P59126"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59126"
FT                   /protein_id="BAC07650.1"
FT                   REIPIENLYSK"
FT   CDS_pept        81422..81886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl15"
FT                   /product="50S ribosomal protein L15"
FT                   /note="ORF_ID:tlr0098"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07651"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07651"
FT                   /db_xref="GOA:Q8DML6"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DML6"
FT                   /protein_id="BAC07651.1"
FT   CDS_pept        81899..83209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /product="preprotein translocase SecY subunit"
FT                   /note="ORF_ID:tlr0099"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07652"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07652"
FT                   /db_xref="GOA:Q8DML5"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DML5"
FT                   /protein_id="BAC07652.1"
FT   CDS_pept        83209..83796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0100"
FT                   /product="adenylate kinase"
FT                   /note="ORF_ID:tlr0100"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07653"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07653"
FT                   /db_xref="GOA:Q8DML4"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DML4"
FT                   /protein_id="BAC07653.1"
FT   CDS_pept        83789..84013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /product="translation initiation factor IF-1"
FT                   /note="ORF_ID:tsr0101"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07654"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07654"
FT                   /db_xref="GOA:Q8DML3"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DML3"
FT                   /protein_id="BAC07654.1"
FT   CDS_pept        84074..84187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl36"
FT                   /product="50S ribosomal protein L36"
FT                   /note="ORF_ID:tsr0102"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07655"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07655"
FT                   /db_xref="GOA:Q8DML2"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DML2"
FT                   /protein_id="BAC07655.1"
FT   CDS_pept        84221..84601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps13"
FT                   /product="30S ribosomal protein S13"
FT                   /note="ORF_ID:tlr0103"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07656"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07656"
FT                   /db_xref="GOA:Q8DML1"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DML1"
FT                   /protein_id="BAC07656.1"
FT   CDS_pept        84644..85036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps11"
FT                   /product="30S ribosomal protein S11"
FT                   /note="ORF_ID:tlr0104"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07657"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07657"
FT                   /db_xref="GOA:P59379"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59379"
FT                   /protein_id="BAC07657.1"
FT   CDS_pept        85066..86031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /product="RNA polymerase alpha subunit"
FT                   /note="ORF_ID:tlr0105"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07658"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07658"
FT                   /db_xref="GOA:Q8DML0"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DML0"
FT                   /protein_id="BAC07658.1"
FT   CDS_pept        86054..86404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl17"
FT                   /product="50S ribosomal protein L17"
FT                   /note="ORF_ID:tlr0106"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07659"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07659"
FT                   /db_xref="GOA:Q8DMK9"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMK9"
FT                   /protein_id="BAC07659.1"
FT                   GDNAELAVIELV"
FT   CDS_pept        86411..87265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0107"
FT                   /product="tRNA-pseudouridine synthase I"
FT                   /note="ORF_ID:tlr0107"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07660"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07660"
FT                   /db_xref="GOA:Q8CWM6"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWM6"
FT                   /protein_id="BAC07660.1"
FT                   SIA"
FT   CDS_pept        87282..87740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl13"
FT                   /product="50S ribosomal protein L13"
FT                   /note="ORF_ID:tlr0108"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07661"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07661"
FT                   /db_xref="GOA:Q8DMK8"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMK8"
FT                   /protein_id="BAC07661.1"
FT   CDS_pept        87743..88156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps9"
FT                   /product="30S ribosomal protein S9"
FT                   /note="ORF_ID:tlr0109"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07662"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07662"
FT                   /db_xref="GOA:Q8DMK7"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMK7"
FT                   /protein_id="BAC07662.1"
FT   CDS_pept        88195..88470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl31"
FT                   /product="50S ribosomal protein L31"
FT                   /note="ORF_ID:tsr0110"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07663"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07663"
FT                   /db_xref="GOA:Q8DMK6"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMK6"
FT                   /protein_id="BAC07663.1"
FT   CDS_pept        88480..89505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0111"
FT                   /note="ORF_ID:tlr0111"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07664"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07664"
FT                   /db_xref="GOA:Q8DMK5"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMK5"
FT                   /protein_id="BAC07664.1"
FT                   L"
FT   CDS_pept        89502..90359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0112"
FT                   /note="ORF_ID:tlr0112"
FT                   /note="probable hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07665"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07665"
FT                   /db_xref="GOA:Q8DMK4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMK4"
FT                   /protein_id="BAC07665.1"
FT                   DGVI"
FT   CDS_pept        complement(90858..91229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftrC"
FT                   /product="ferredoxin-thioredoxin reductase, catalytic
FT                   chain"
FT                   /note="ORF_ID:tll0113"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07666"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07666"
FT                   /db_xref="GOA:Q8DMK3"
FT                   /db_xref="InterPro:IPR004209"
FT                   /db_xref="InterPro:IPR024707"
FT                   /db_xref="InterPro:IPR036644"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMK3"
FT                   /protein_id="BAC07666.1"
FT   tRNA            complement(join(91307..91362,93749..93765))
FT                   /product="trnI_CAU"
FT   mobile_element  complement(91363..93748)
FT                   /mobile_element_type="other:TelI4h"
FT                   /note="groupII intron"
FT   CDS_pept        complement(91446..93134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0114"
FT                   /product="maturase; reverse transcriptase"
FT                   /note="ORF_ID:tll0114"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07667"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07667"
FT                   /db_xref="GOA:Q8DMK2"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMK2"
FT                   /protein_id="BAC07667.1"
FT   CDS_pept        93834..95027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifS"
FT                   /product="cysteine desulfurase"
FT                   /note="ORF_ID:tlr0115"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07668"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07668"
FT                   /db_xref="GOA:Q8DMK1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMK1"
FT                   /protein_id="BAC07668.1"
FT   CDS_pept        95342..95677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0116"
FT                   /note="ORF_ID:tlr0116"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07669"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07669"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMK0"
FT                   /protein_id="BAC07669.1"
FT                   AAPAMPR"
FT   CDS_pept        complement(95698..95970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0117"
FT                   /note="ORF_ID:tsl0117"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07670"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07670"
FT                   /db_xref="InterPro:IPR021489"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMJ9"
FT                   /protein_id="BAC07670.1"
FT   CDS_pept        complement(95967..96440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /product="heat shock protein"
FT                   /note="ORF_ID:tll0118"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07671"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07671"
FT                   /db_xref="GOA:Q8DMJ8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMJ8"
FT                   /protein_id="BAC07671.1"
FT   CDS_pept        complement(96449..97150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /note="ORF_ID:tll0119"
FT                   /note="similar to fimbrial assembly protein PilC"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07672"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07672"
FT                   /db_xref="GOA:Q8DMJ7"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMJ7"
FT                   /protein_id="BAC07672.1"
FT                   LPMFKIFDLVK"
FT   CDS_pept        complement(97170..97670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /note="ORF_ID:tll0120"
FT                   /note="similar to fimbrial assembly protein PilC"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07673"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07673"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMJ6"
FT                   /protein_id="BAC07673.1"
FT                   QPD"
FT   CDS_pept        complement(97701..98798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /product="twitching motility protein"
FT                   /note="ORF_ID:tll0121"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07674"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07674"
FT                   /db_xref="GOA:Q8DMJ5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMJ5"
FT                   /protein_id="BAC07674.1"
FT   CDS_pept        complement(98868..100892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilB"
FT                   /product="pilus assembly protein"
FT                   /note="ORF_ID:tll0122"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07675"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07675"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMJ4"
FT                   /protein_id="BAC07675.1"
FT   CDS_pept        101106..101378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0123"
FT                   /note="ORF_ID:tsr0123"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07676"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07676"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMJ3"
FT                   /protein_id="BAC07676.1"
FT   CDS_pept        101379..101576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0124"
FT                   /note="ORF_ID:tsr0124"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07677"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07677"
FT                   /db_xref="GOA:Q8DMJ2"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMJ2"
FT                   /protein_id="BAC07677.1"
FT   CDS_pept        101573..103114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0125"
FT                   /note="ORF_ID:tlr0125"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07678"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07678"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMJ1"
FT                   /protein_id="BAC07678.1"
FT   CDS_pept        complement(103111..104085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0126"
FT                   /note="ORF_ID:tll0126"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07679"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07679"
FT                   /db_xref="GOA:Q8DMJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMJ0"
FT                   /protein_id="BAC07679.1"
FT   CDS_pept        104141..105136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0127"
FT                   /note="ORF_ID:tlr0127"
FT                   /note="probable glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07680"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07680"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMI9"
FT                   /protein_id="BAC07680.1"
FT   CDS_pept        complement(105448..108210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0128"
FT                   /note="ORF_ID:tll0128"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07681"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07681"
FT                   /db_xref="GOA:Q8DMI8"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMI8"
FT                   /protein_id="BAC07681.1"
FT   CDS_pept        108552..108914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0129"
FT                   /note="ORF_ID:tlr0129"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07682"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07682"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMI7"
FT                   /protein_id="BAC07682.1"
FT                   AALEERLLSHHHGHSH"
FT   CDS_pept        complement(108926..110614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menD"
FT                   /product="menaquinone biosynthesis protein"
FT                   /note="ORF_ID:tll0130"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07683"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07683"
FT                   /db_xref="GOA:Q8DMI6"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMI6"
FT                   /protein_id="BAC07683.1"
FT   tRNA            complement(110764..110834)
FT                   /product="trnG-UCC"
FT   CDS_pept        complement(110890..112728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /product="cell division protein"
FT                   /note="ORF_ID:tll0131"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07684"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07684"
FT                   /db_xref="GOA:Q8DMI5"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMI5"
FT                   /protein_id="BAC07684.1"
FT   CDS_pept        112839..113663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0132"
FT                   /note="ORF_ID:tlr0132"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07685"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07685"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMI4"
FT                   /protein_id="BAC07685.1"
FT   CDS_pept        complement(113660..114292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /note="ORF_ID:tll0133"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07686"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07686"
FT                   /db_xref="GOA:Q8DMI3"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMI3"
FT                   /protein_id="BAC07686.1"
FT   mobile_element  114293..115619
FT                   /mobile_element_type="insertion sequence:ISEL1a"
FT   CDS_pept        114353..115579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0134"
FT                   /note="ORF_ID:tlr0134"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07687"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07687"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMI2"
FT                   /protein_id="BAC07687.1"
FT                   LRRNRKSQK"
FT   CDS_pept        complement(115626..116246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0135"
FT                   /note="ORF_ID:tll0135"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07688"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07688"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMI1"
FT                   /protein_id="BAC07688.1"
FT   CDS_pept        116368..117288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0136"
FT                   /note="ORF_ID:tlr0136"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07689"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07689"
FT                   /db_xref="GOA:Q8DMI0"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMI0"
FT                   /protein_id="BAC07689.1"
FT   CDS_pept        117351..118082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0137"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="ORF_ID:tlr0137"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07690"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07690"
FT                   /db_xref="GOA:Q8DMH9"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMH9"
FT                   /protein_id="BAC07690.1"
FT   CDS_pept        complement(118042..118578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0138"
FT                   /note="ORF_ID:tll0138"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07691"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07691"
FT                   /db_xref="GOA:Q8DMH8"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMH8"
FT                   /protein_id="BAC07691.1"
FT                   RCAMAAVNFPNRPQP"
FT   CDS_pept        complement(118658..119869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0139"
FT                   /product="multidrug-efflux transporter"
FT                   /note="ORF_ID:tll0139"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07692"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07692"
FT                   /db_xref="GOA:Q8DMH7"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMH7"
FT                   /protein_id="BAC07692.1"
FT                   PSSS"
FT   CDS_pept        120182..121585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0140"
FT                   /note="ORF_ID:tlr0140"
FT                   /note="similar to light-harvesting 1 (B870) complex
FT                   assembly protein PucC"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07693"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07693"
FT                   /db_xref="GOA:Q8DMH6"
FT                   /db_xref="InterPro:IPR004896"
FT                   /db_xref="InterPro:IPR026036"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMH6"
FT                   /protein_id="BAC07693.1"
FT                   AKVLAEELE"
FT   CDS_pept        complement(121592..122842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0141"
FT                   /note="ORF_ID:tll0141"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07694"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07694"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMH5"
FT                   /protein_id="BAC07694.1"
FT                   AHVTHFGKLDFSFFAHW"
FT   CDS_pept        complement(123138..123542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0142"
FT                   /note="ORF_ID:tll0142"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07695"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07695"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMH4"
FT                   /protein_id="BAC07695.1"
FT   mobile_element  124124..124206
FT                   /mobile_element_type="insertion sequence:ISEL5f"
FT   CDS_pept        124328..124969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0143"
FT                   /note="ORF_ID:tlr0143"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07696"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07696"
FT                   /db_xref="GOA:Q8DMH3"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMH3"
FT                   /protein_id="BAC07696.1"
FT   CDS_pept        125023..125790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobA"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="ORF_ID:tlr0144"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07697"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07697"
FT                   /db_xref="GOA:Q8DMH2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMH2"
FT                   /protein_id="BAC07697.1"
FT   CDS_pept        complement(125764..127650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0145"
FT                   /note="ORF_ID:tll0145"
FT                   /note="probable chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07698"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07698"
FT                   /db_xref="GOA:Q8DMH1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMH1"
FT                   /protein_id="BAC07698.1"
FT   CDS_pept        complement(127718..128443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0146"
FT                   /note="ORF_ID:tll0146"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07699"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07699"
FT                   /db_xref="GOA:Q8DMH0"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMH0"
FT                   /protein_id="BAC07699.1"
FT   CDS_pept        128769..129377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps4"
FT                   /product="30S ribosomal protein S4"
FT                   /note="ORF_ID:tlr0147"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07700"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07700"
FT                   /db_xref="GOA:P59134"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59134"
FT                   /protein_id="BAC07700.1"
FT   CDS_pept        129396..130490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /product="peptide chain release factor 1"
FT                   /note="ORF_ID:tlr0148"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07701"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07701"
FT                   /db_xref="GOA:Q8DMG9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMG9"
FT                   /protein_id="BAC07701.1"
FT   CDS_pept        130500..130769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0149"
FT                   /note="ORF_ID:tsr0149"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07702"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07702"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMG8"
FT                   /protein_id="BAC07702.1"
FT   CDS_pept        complement(130794..132002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlP"
FT                   /product="geranylgeranyl hydrogenase"
FT                   /note="ORF_ID:tll0150"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07703"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07703"
FT                   /db_xref="GOA:Q8DMG7"
FT                   /db_xref="InterPro:IPR010253"
FT                   /db_xref="InterPro:IPR011774"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMG7"
FT                   /protein_id="BAC07703.1"
FT                   LAP"
FT   CDS_pept        132288..133883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0151"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /note="ORF_ID:tlr0151"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07704"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07704"
FT                   /db_xref="GOA:P59177"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59177"
FT                   /protein_id="BAC07704.1"
FT                   YEMRLNRTPVSLKI"
FT   CDS_pept        133954..135774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0152"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:tlr0152"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07705"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07705"
FT                   /db_xref="GOA:Q8DMG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMG6"
FT                   /protein_id="BAC07705.1"
FT   CDS_pept        complement(135767..138247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0153"
FT                   /product="cation-transporting ATPase E1-E2 family"
FT                   /note="ORF_ID:tll0153"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07706"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07706"
FT                   /db_xref="GOA:Q8DMG5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMG5"
FT                   /protein_id="BAC07706.1"
FT                   RHRLLDRFLGVNLS"
FT   CDS_pept        complement(138251..138835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0154"
FT                   /note="ORF_ID:tll0154"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07707"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07707"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMG4"
FT                   /protein_id="BAC07707.1"
FT   mobile_element  complement(138887..140514)
FT                   /mobile_element_type="insertion sequence:ISEL3a"
FT   CDS_pept        complement(138904..139623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0155"
FT                   /note="ORF_ID:tll0155"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07708"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07708"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMG3"
FT                   /protein_id="BAC07708.1"
FT                   KTTSVASPSEASRIIAL"
FT   CDS_pept        complement(139660..140082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0156"
FT                   /note="ORF_ID:tll0156"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07709"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07709"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMG2"
FT                   /protein_id="BAC07709.1"
FT   CDS_pept        140134..140481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0157"
FT                   /note="ORF_ID:tlr0157"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07710"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07710"
FT                   /db_xref="GOA:Q8DMG1"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMG1"
FT                   /protein_id="BAC07710.1"
FT                   KEYMRNQKKPS"
FT   CDS_pept        complement(140740..142353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0158"
FT                   /product="sodium/hydrogen antiporter"
FT                   /note="ORF_ID:tll0158"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07711"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07711"
FT                   /db_xref="GOA:Q8DMG0"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMG0"
FT                   /protein_id="BAC07711.1"
FT   CDS_pept        142470..143291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0159"
FT                   /note="ORF_ID:tlr0159"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07712"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07712"
FT                   /db_xref="GOA:Q8DMF9"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016545"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMF9"
FT                   /protein_id="BAC07712.1"
FT   CDS_pept        143304..143711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0160"
FT                   /note="ORF_ID:tlr0160"
FT                   /note="similar to ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07713"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07713"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMF8"
FT                   /protein_id="BAC07713.1"
FT   CDS_pept        complement(143593..144174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0161"
FT                   /note="ORF_ID:tll0161"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07714"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07714"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMF7"
FT                   /protein_id="BAC07714.1"
FT   CDS_pept        complement(144171..145343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0162"
FT                   /product="ATP-binding protein of sugar ABC transportor"
FT                   /note="ORF_ID:tll0162"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07715"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07715"
FT                   /db_xref="GOA:Q8DMF6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMF6"
FT                   /protein_id="BAC07715.1"
FT   CDS_pept        complement(145407..145667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0163"
FT                   /note="ORF_ID:tsl0163"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07716"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07716"
FT                   /db_xref="GOA:Q8DMF5"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR016692"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMF5"
FT                   /protein_id="BAC07716.1"
FT   CDS_pept        145813..147147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0164"
FT                   /note="ORF_ID:tlr0164"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07717"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07717"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMF4"
FT                   /protein_id="BAC07717.1"
FT   CDS_pept        complement(147231..147674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0165"
FT                   /note="ORF_ID:tll0165"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07718"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07718"
FT                   /db_xref="InterPro:IPR025458"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMF3"
FT                   /protein_id="BAC07718.1"
FT   CDS_pept        complement(148026..148286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl27"
FT                   /product="50S ribosomal protein L27"
FT                   /note="ORF_ID:tsl0166"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07719"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07719"
FT                   /db_xref="GOA:Q8DMF2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMF2"
FT                   /protein_id="BAC07719.1"
FT   CDS_pept        complement(148288..148623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl21"
FT                   /product="50S ribosomal protein L21"
FT                   /note="ORF_ID:tll0167"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07720"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07720"
FT                   /db_xref="GOA:Q8DMF1"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMF1"
FT                   /protein_id="BAC07720.1"
FT                   NGESLGG"
FT   CDS_pept        complement(148741..149145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0168"
FT                   /note="ORF_ID:tll0168"
FT                   /note="putative phosphopeptide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07721"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07721"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMF0"
FT                   /protein_id="BAC07721.1"
FT   CDS_pept        complement(149189..149635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0169"
FT                   /note="ORF_ID:tll0169"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07722"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07722"
FT                   /db_xref="GOA:Q8DME9"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DME9"
FT                   /protein_id="BAC07722.1"
FT   CDS_pept        complement(149632..151161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0170"
FT                   /note="ORF_ID:tll0170"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07723"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07723"
FT                   /db_xref="GOA:Q8DME8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DME8"
FT                   /protein_id="BAC07723.1"
FT   CDS_pept        151259..151927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0171"
FT                   /note="ORF_ID:tlr0171"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07724"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07724"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DME7"
FT                   /protein_id="BAC07724.1"
FT                   "
FT   CDS_pept        complement(151918..153165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobL"
FT                   /product="precorrin-6y c5,15-methyltransferase"
FT                   /note="ORF_ID:tll0172"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07725"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07725"
FT                   /db_xref="GOA:Q8DME6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DME6"
FT                   /protein_id="BAC07725.1"
FT                   RLHPLNPVTLMTLTQG"
FT   CDS_pept        complement(153162..153776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobH"
FT                   /product="precorrin isomerase"
FT                   /note="ORF_ID:tll0173"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07726"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07726"
FT                   /db_xref="GOA:Q8DME5"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DME5"
FT                   /protein_id="BAC07726.1"
FT   tRNA            153813..153897
FT                   /product="trnS-GGA"
FT   CDS_pept        154052..156295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /product="single-strand-DNA-specific exonuclease"
FT                   /note="ORF_ID:tlr0174"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07727"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07727"
FT                   /db_xref="GOA:Q8DME4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DME4"
FT                   /protein_id="BAC07727.1"
FT   CDS_pept        complement(156570..157322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0175"
FT                   /note="ORF_ID:tll0175"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07728"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07728"
FT                   /db_xref="GOA:Q8DME3"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DME3"
FT                   /protein_id="BAC07728.1"
FT   CDS_pept        complement(157406..157546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbK"
FT                   /product="photosystem II protein"
FT                   /note="ORF_ID:tsl0176"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07729"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07729"
FT                   /db_xref="GOA:Q9F1K9"
FT                   /db_xref="InterPro:IPR003687"
FT                   /db_xref="InterPro:IPR037270"
FT                   /db_xref="PDB:1S5L"
FT                   /db_xref="PDB:2AXT"
FT                   /db_xref="PDB:3KZI"
FT                   /db_xref="PDB:4FBY"
FT                   /db_xref="PDB:4IXQ"
FT                   /db_xref="PDB:4IXR"
FT                   /db_xref="PDB:4PBU"
FT                   /db_xref="PDB:4PJ0"
FT                   /db_xref="PDB:4RVY"
FT                   /db_xref="PDB:4TNH"
FT                   /db_xref="PDB:4TNI"
FT                   /db_xref="PDB:4TNJ"
FT                   /db_xref="PDB:4TNK"
FT                   /db_xref="PDB:4V62"
FT                   /db_xref="PDB:4V82"
FT                   /db_xref="PDB:5E79"
FT                   /db_xref="PDB:5E7C"
FT                   /db_xref="PDB:5H2F"
FT                   /db_xref="PDB:5KAF"
FT                   /db_xref="PDB:5KAI"
FT                   /db_xref="PDB:5MX2"
FT                   /db_xref="PDB:5TIS"
FT                   /db_xref="PDB:5ZZN"
FT                   /db_xref="PDB:6DHE"
FT                   /db_xref="PDB:6DHF"
FT                   /db_xref="PDB:6DHG"
FT                   /db_xref="PDB:6DHH"
FT                   /db_xref="PDB:6DHO"
FT                   /db_xref="PDB:6DHP"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9F1K9"
FT                   /protein_id="BAC07729.1"
FT                   R"
FT   CDS_pept        157626..158120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0177"
FT                   /note="ORF_ID:tlr0177"
FT                   /note="probable cytidine or deoxycytidylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07730"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07730"
FT                   /db_xref="GOA:Q8DME2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DME2"
FT                   /protein_id="BAC07730.1"
FT                   Q"
FT   CDS_pept        complement(157948..158622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="ORF_ID:tll0178"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07731"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07731"
FT                   /db_xref="GOA:Q8DME1"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DME1"
FT                   /protein_id="BAC07731.1"
FT                   HR"
FT   CDS_pept        158692..159582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btpA"
FT                   /product="photosystem I biogenesis protein"
FT                   /note="ORF_ID:tlr0179"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07732"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07732"
FT                   /db_xref="GOA:Q8DME0"
FT                   /db_xref="InterPro:IPR005137"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DME0"
FT                   /protein_id="BAC07732.1"
FT                   SINEPLPAMFVHGQR"
FT   CDS_pept        complement(159583..160218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /note="ORF_ID:tll0180"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07733"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07733"
FT                   /db_xref="GOA:Q8DMD9"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMD9"
FT                   /protein_id="BAC07733.1"
FT   CDS_pept        complement(160222..161448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0181"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit"
FT                   /note="ORF_ID:tll0181"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07734"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07734"
FT                   /db_xref="GOA:Q8DMD8"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMD8"
FT                   /protein_id="BAC07734.1"
FT                   ATSLQIQRV"
FT   CDS_pept        complement(161455..162402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0182"
FT                   /note="ORF_ID:tll0182"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07735"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07735"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMD7"
FT                   /protein_id="BAC07735.1"
FT   CDS_pept        complement(162525..163400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purU"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="ORF_ID:tll0183"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07736"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07736"
FT                   /db_xref="GOA:Q8DMD6"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMD6"
FT                   /protein_id="BAC07736.1"
FT                   VYGNRTAVFA"
FT   CDS_pept        complement(163429..166278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /product="excinuclease ABC subunit A"
FT                   /note="ORF_ID:tll0184"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07737"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07737"
FT                   /db_xref="GOA:Q8DMD5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMD5"
FT                   /protein_id="BAC07737.1"
FT   CDS_pept        complement(166487..168124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL-1"
FT                   /product="60kD chaperonin 1"
FT                   /note="ORF_ID:tll0185"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07738"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07738"
FT                   /db_xref="GOA:Q8DMD4"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMD4"
FT                   /protein_id="BAC07738.1"
FT   CDS_pept        complement(168193..168504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /product="10kD chaperonin"
FT                   /note="ORF_ID:tll0186"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07739"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07739"
FT                   /db_xref="GOA:P0A347"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A347"
FT                   /protein_id="BAC07739.1"
FT   CDS_pept        complement(168692..169567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0187"
FT                   /note="ORF_ID:tll0187"
FT                   /note="probable sugar transport inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07740"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07740"
FT                   /db_xref="GOA:Q8DMD3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMD3"
FT                   /protein_id="BAC07740.1"
FT                   RGIATTGLKN"
FT   CDS_pept        complement(169488..171011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0188"
FT                   /product="ammonium/methylammonium permease"
FT                   /note="ORF_ID:tll0188"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07741"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07741"
FT                   /db_xref="GOA:Q8DMD2"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMD2"
FT                   /protein_id="BAC07741.1"
FT   CDS_pept        171165..171905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0189"
FT                   /note="ORF_ID:tlr0189"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07742"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07742"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMD1"
FT                   /protein_id="BAC07742.1"
FT   CDS_pept        171915..173189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /product="folylpolyglutamate synthase"
FT                   /note="ORF_ID:tlr0190"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07743"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07743"
FT                   /db_xref="GOA:Q8DMD0"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMD0"
FT                   /protein_id="BAC07743.1"
FT   CDS_pept        173441..174031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0191"
FT                   /note="ORF_ID:tlr0191"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07744"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07744"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMC9"
FT                   /protein_id="BAC07744.1"
FT   CDS_pept        174093..174485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0192"
FT                   /product="ferric uptake regulation protein"
FT                   /note="ORF_ID:tlr0192"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07745"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07745"
FT                   /db_xref="GOA:Q8DMC8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMC8"
FT                   /protein_id="BAC07745.1"
FT   CDS_pept        174461..176881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0193"
FT                   /note="ORF_ID:tlr0193"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07746"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07746"
FT                   /db_xref="GOA:Q8DMC7"
FT                   /db_xref="InterPro:IPR006775"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014551"
FT                   /db_xref="InterPro:IPR024462"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMC7"
FT                   /protein_id="BAC07746.1"
FT   CDS_pept        176999..177448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0194"
FT                   /note="ORF_ID:tlr0194"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07747"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07747"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMC6"
FT                   /protein_id="BAC07747.1"
FT   CDS_pept        177449..178606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0195"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="ORF_ID:tlr0195"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07748"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07748"
FT                   /db_xref="GOA:Q8DMC5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMC5"
FT                   /protein_id="BAC07748.1"
FT   CDS_pept        178603..179193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0196"
FT                   /note="ORF_ID:tlr0196"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07749"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07749"
FT                   /db_xref="GOA:Q8DMC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMC4"
FT                   /protein_id="BAC07749.1"
FT   CDS_pept        179299..179394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaM"
FT                   /product="photosystem I subunit XII"
FT                   /note="ORF_ID:tsr0197"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07750"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07750"
FT                   /db_xref="GOA:P0A403"
FT                   /db_xref="InterPro:IPR010010"
FT                   /db_xref="InterPro:IPR037279"
FT                   /db_xref="PDB:1JB0"
FT                   /db_xref="PDB:2PPS"
FT                   /db_xref="PDB:3PCQ"
FT                   /db_xref="PDB:4FE1"
FT                   /db_xref="PDB:5ZF0"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A403"
FT                   /protein_id="BAC07750.1"
FT                   /translation="MALTDTQVYVALVIALLPAVLAFRLSTELYK"
FT   CDS_pept        179535..179861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0198"
FT                   /note="ORF_ID:tlr0198"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07751"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07751"
FT                   /db_xref="GOA:Q8DMC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMC3"
FT                   /protein_id="BAC07751.1"
FT                   QEPD"
FT   CDS_pept        complement(179864..180613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0199"
FT                   /note="ORF_ID:tll0199"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07752"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07752"
FT                   /db_xref="GOA:Q8DMC2"
FT                   /db_xref="InterPro:IPR022170"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMC2"
FT                   /protein_id="BAC07752.1"
FT   CDS_pept        complement(180691..181290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0200"
FT                   /note="ORF_ID:tll0200"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07753"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07753"
FT                   /db_xref="GOA:Q8DMC1"
FT                   /db_xref="InterPro:IPR021468"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMC1"
FT                   /protein_id="BAC07753.1"
FT   CDS_pept        complement(181459..182145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0201"
FT                   /note="ORF_ID:tll0201"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07754"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07754"
FT                   /db_xref="GOA:Q8DMC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMC0"
FT                   /protein_id="BAC07754.1"
FT                   PRRSSL"
FT   CDS_pept        complement(182152..183105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /product="protein-export membrane protein"
FT                   /note="ORF_ID:tll0202"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07755"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07755"
FT                   /db_xref="GOA:Q8DMB9"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMB9"
FT                   /protein_id="BAC07755.1"
FT   CDS_pept        complement(183102..184532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /product="protein-export membrane protein"
FT                   /note="ORF_ID:tll0203"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07756"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07756"
FT                   /db_xref="GOA:Q8DMB8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMB8"
FT                   /protein_id="BAC07756.1"
FT                   IPSLRRPHWFCPKLESVR"
FT   CDS_pept        complement(184535..185518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0204"
FT                   /product="pyruvate dehydrogenase E1 component beta subunit"
FT                   /note="ORF_ID:tll0204"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07757"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07757"
FT                   /db_xref="GOA:Q8DMB7"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMB7"
FT                   /protein_id="BAC07757.1"
FT   mobile_element  complement(185703..187028)
FT                   /mobile_element_type="insertion sequence:ISEL1b"
FT   CDS_pept        complement(185743..186915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0205"
FT                   /note="ORF_ID:tll0205"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07758"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07758"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMB6"
FT                   /protein_id="BAC07758.1"
FT   CDS_pept        187129..187776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0206"
FT                   /note="ORF_ID:tlr0206"
FT                   /note="similar to dethiobiotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07759"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07759"
FT                   /db_xref="GOA:Q8DMB5"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMB5"
FT                   /protein_id="BAC07759.1"
FT   CDS_pept        187886..188446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0207"
FT                   /product="glutathione S-transferase"
FT                   /note="ORF_ID:tlr0207"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07760"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07760"
FT                   /db_xref="GOA:Q8DMB4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMB4"
FT                   /protein_id="BAC07760.1"
FT   CDS_pept        188443..188901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0208"
FT                   /note="ORF_ID:tlr0208"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07761"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07761"
FT                   /db_xref="InterPro:IPR021920"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMB3"
FT                   /protein_id="BAC07761.1"
FT   CDS_pept        188892..190220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /product="RNA-binding protein"
FT                   /note="ORF_ID:tlr0209"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07762"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07762"
FT                   /db_xref="GOA:Q8DMB2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMB2"
FT                   /protein_id="BAC07762.1"
FT   CDS_pept        complement(190192..190998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0210"
FT                   /note="ORF_ID:tll0210"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07763"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07763"
FT                   /db_xref="GOA:Q8DMB1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMB1"
FT                   /protein_id="BAC07763.1"
FT   CDS_pept        complement(191027..191326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0211"
FT                   /note="ORF_ID:tll0211"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07764"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07764"
FT                   /db_xref="GOA:Q8DMB0"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMB0"
FT                   /protein_id="BAC07764.1"
FT   CDS_pept        complement(191385..192905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="ORF_ID:tll0212"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07765"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07765"
FT                   /db_xref="GOA:Q8DMA9"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMA9"
FT                   /protein_id="BAC07765.1"
FT   CDS_pept        192998..195235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /product="polyphosphate kinase"
FT                   /note="ORF_ID:tlr0213"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07766"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07766"
FT                   /db_xref="GOA:Q8DMA8"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMA8"
FT                   /protein_id="BAC07766.1"
FT   CDS_pept        complement(195210..197042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0214"
FT                   /product="ATP-binding protein of ABC transporter"
FT                   /note="ORF_ID:tll0214"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07767"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07767"
FT                   /db_xref="GOA:Q8DMA7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMA7"
FT                   /protein_id="BAC07767.1"
FT   mobile_element  197063..198163
FT                   /mobile_element_type="insertion sequence:ISEL4a"
FT   CDS_pept        197131..198168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0215"
FT                   /note="ORF_ID:tlr0215"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07768"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07768"
FT                   /db_xref="GOA:Q8DMA6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMA6"
FT                   /protein_id="BAC07768.1"
FT                   TGLDT"
FT   CDS_pept        complement(198191..198964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /product="phosphorybosilformimino-5-amino-phosphorybosil-4-imidazolecarboxamideisomerase"
FT                   /note="ORF_ID:tll0216"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07769"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07769"
FT                   /db_xref="GOA:Q8DMA5"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMA5"
FT                   /protein_id="BAC07769.1"
FT   CDS_pept        complement(198991..199368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0217"
FT                   /note="ORF_ID:tll0217"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07770"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMA4"
FT                   /protein_id="BAC07770.1"
FT   tRNA            complement(199383..199454)
FT                   /product="trnG-CCC"
FT   CDS_pept        complement(199474..199872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0218"
FT                   /note="ORF_ID:tll0218"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07771"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07771"
FT                   /db_xref="GOA:Q8DMA3"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DMA3"
FT                   /protein_id="BAC07771.1"
FT   CDS_pept        200016..200255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0219"
FT                   /note="ORF_ID:tsr0219"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07772"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07772"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMA2"
FT                   /protein_id="BAC07772.1"
FT   CDS_pept        complement(200260..200709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0220"
FT                   /note="ORF_ID:tll0220"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07773"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07773"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="PDB:2MXA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMA1"
FT                   /protein_id="BAC07773.1"
FT   CDS_pept        200872..202260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0221"
FT                   /product="succinate-semialdehyde dehydrogenase (NADP+)"
FT                   /EC_number=""
FT                   /note="ORF_ID:tlr0221"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07774"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07774"
FT                   /db_xref="GOA:Q8DMA0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DMA0"
FT                   /protein_id="BAC07774.1"
FT                   NTHS"
FT   mobile_element  complement(202441..203767)
FT                   /mobile_element_type="insertion sequence:ISEL1c"
FT   CDS_pept        complement(202481..203653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0222"
FT                   /note="ORF_ID:tll0222"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07775"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07775"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM99"
FT                   /protein_id="BAC07775.1"
FT   CDS_pept        complement(203917..205767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0223"
FT                   /product="ATP-binding protein of ABC transporter"
FT                   /note="ORF_ID:tll0223"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07776"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07776"
FT                   /db_xref="GOA:Q8DM98"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM98"
FT                   /protein_id="BAC07776.1"
FT   CDS_pept        complement(205764..205970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0224"
FT                   /note="ORF_ID:tsl0224"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07777"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07777"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM97"
FT                   /protein_id="BAC07777.1"
FT   CDS_pept        205955..206596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0225"
FT                   /note="ORF_ID:tlr0225"
FT                   /note="probable acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07778"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07778"
FT                   /db_xref="GOA:Q8DM96"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM96"
FT                   /protein_id="BAC07778.1"
FT   CDS_pept        207090..207854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0226"
FT                   /product="pyruvate formate lyase activating enzyme"
FT                   /note="ORF_ID:tlr0226"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07779"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07779"
FT                   /db_xref="GOA:Q8DM95"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM95"
FT                   /protein_id="BAC07779.1"
FT   CDS_pept        207894..210551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0227"
FT                   /product="CoA-linked acetaldehyde dehydrogenase and
FT                   iron-dependent alcohol dehydrogenase /
FT                   pyruvate-formate-lyase deactivase"
FT                   /note="ORF_ID:tlr0227"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07780"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07780"
FT                   /db_xref="GOA:Q8DM94"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM94"
FT                   /protein_id="BAC07780.1"
FT                   RDAAAYYGGEATGS"
FT   CDS_pept        210500..211240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0228"
FT                   /note="ORF_ID:tlr0228"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07781"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07781"
FT                   /db_xref="GOA:Q8DM93"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM93"
FT                   /protein_id="BAC07781.1"
FT   CDS_pept        211272..211778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0229"
FT                   /note="ORF_ID:tlr0229"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07782"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07782"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM92"
FT                   /protein_id="BAC07782.1"
FT                   AQLAP"
FT   CDS_pept        211783..212676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0230"
FT                   /note="ORF_ID:tlr0230"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07783"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07783"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM91"
FT                   /protein_id="BAC07783.1"
FT                   VQTLARRLIERAVAEI"
FT   CDS_pept        complement(212692..213651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /product="quinolinate synthetase"
FT                   /note="ORF_ID:tll0231"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07784"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07784"
FT                   /db_xref="GOA:Q8DM90"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DM90"
FT                   /protein_id="BAC07784.1"
FT   CDS_pept        complement(213670..215214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0232"
FT                   /note="ORF_ID:tll0232"
FT                   /note="similar to phytoene dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07785"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07785"
FT                   /db_xref="GOA:Q8DM89"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014104"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM89"
FT                   /protein_id="BAC07785.1"
FT   CDS_pept        complement(215293..215937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisIE"
FT                   /product="histidine biosynthesis bifunctional protein"
FT                   /note="ORF_ID:tll0233"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07786"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07786"
FT                   /db_xref="GOA:Q8DM88"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DM88"
FT                   /protein_id="BAC07786.1"
FT   ncRNA           215962..216059
FT                   /product="SRP RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   CDS_pept        216196..216849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0234"
FT                   /note="ORF_ID:tlr0234"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07787"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07787"
FT                   /db_xref="GOA:Q8DM87"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM87"
FT                   /protein_id="BAC07787.1"
FT   CDS_pept        216846..217094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0235"
FT                   /note="ORF_ID:tsr0235"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07788"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07788"
FT                   /db_xref="GOA:Q8DM86"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM86"
FT                   /protein_id="BAC07788.1"
FT   CDS_pept        complement(217229..219211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0236"
FT                   /product="asparagine synthetase"
FT                   /note="ORF_ID:tll0236"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07789"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07789"
FT                   /db_xref="GOA:Q8DM85"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM85"
FT                   /protein_id="BAC07789.1"
FT   CDS_pept        complement(219534..219692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0237"
FT                   /note="ORF_ID:tsl0237"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07790"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07790"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM84"
FT                   /protein_id="BAC07790.1"
FT                   ASNAAIS"
FT   mobile_element  219750..220594
FT                   /mobile_element_type="other:TelI3f"
FT                   /note="groupII intron"
FT   CDS_pept        220776..221123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0238"
FT                   /note="ORF_ID:tlr0238"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07791"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07791"
FT                   /db_xref="GOA:Q8DM83"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM83"
FT                   /protein_id="BAC07791.1"
FT                   APAATFFLVLL"
FT   mobile_element  complement(222600..223440)
FT                   /mobile_element_type="insertion sequence:ISEL2a"
FT   CDS_pept        complement(222610..222816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0239"
FT                   /note="ORF_ID:tsl0239"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07792"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07792"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CM91"
FT                   /protein_id="BAC07792.1"
FT   CDS_pept        complement(222900..223376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0240"
FT                   /note="ORF_ID:tll0240"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07793"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07793"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLZ9"
FT                   /protein_id="BAC07793.1"
FT   CDS_pept        223913..224842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0241"
FT                   /note="ORF_ID:tlr0241"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07794"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07794"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM82"
FT                   /protein_id="BAC07794.1"
FT   CDS_pept        224839..225936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0242"
FT                   /note="ORF_ID:tlr0242"
FT                   /note="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07795"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07795"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM81"
FT                   /protein_id="BAC07795.1"
FT   CDS_pept        225933..227141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0243"
FT                   /note="ORF_ID:tlr0243"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07796"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07796"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM80"
FT                   /protein_id="BAC07796.1"
FT                   EGT"
FT   CDS_pept        227527..228081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0244"
FT                   /note="ORF_ID:tlr0244"
FT                   /note="similar to asparagine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07797"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07797"
FT                   /db_xref="GOA:Q8DM79"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM79"
FT                   /protein_id="BAC07797.1"
FT   CDS_pept        228670..229119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0245"
FT                   /note="ORF_ID:tlr0245"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07798"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07798"
FT                   /db_xref="GOA:Q8DM78"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM78"
FT                   /protein_id="BAC07798.1"
FT   mobile_element  229502..229782
FT                   /mobile_element_type="insertion sequence:ISEL5c"
FT   CDS_pept        229798..230862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0246"
FT                   /note="ORF_ID:tlr0246"
FT                   /note="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07799"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07799"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM77"
FT                   /protein_id="BAC07799.1"
FT                   GDRVAELFLDVAKS"
FT   mobile_element  231185..232142
FT                   /mobile_element_type="insertion sequence:ISEL5a"
FT   CDS_pept        231607..232107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0247"
FT                   /note="ORF_ID:tlr0247"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07800"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07800"
FT                   /db_xref="GOA:Q8DM76"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM76"
FT                   /protein_id="BAC07800.1"
FT                   LIT"
FT   CDS_pept        complement(232628..232930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0248"
FT                   /note="ORF_ID:tll0248"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07801"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07801"
FT                   /db_xref="InterPro:IPR021336"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM75"
FT                   /protein_id="BAC07801.1"
FT   mobile_element  232653..232727
FT                   /mobile_element_type="other:TelI3g"
FT                   /note="groupII intron"
FT   CDS_pept        233133..233942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0249"
FT                   /note="ORF_ID:tlr0249"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07802"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07802"
FT                   /db_xref="GOA:Q8DM74"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM74"
FT                   /protein_id="BAC07802.1"
FT   CDS_pept        234028..235734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0250"
FT                   /note="ORF_ID:tlr0250"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07803"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07803"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM73"
FT                   /protein_id="BAC07803.1"
FT   tmRNA           236045..236428
FT                   /product="tmRNA"
FT   CDS_pept        complement(236426..238252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0251"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /note="ORF_ID:tll0251"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07804"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07804"
FT                   /db_xref="GOA:Q8DM72"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM72"
FT                   /protein_id="BAC07804.1"
FT   CDS_pept        238505..238996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0252"
FT                   /note="ORF_ID:tlr0252"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07805"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07805"
FT                   /db_xref="GOA:Q8DM71"
FT                   /db_xref="InterPro:IPR019250"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM71"
FT                   /protein_id="BAC07805.1"
FT                   "
FT   CDS_pept        complement(238993..239238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0253"
FT                   /note="ORF_ID:tsl0253"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07806"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07806"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM70"
FT                   /protein_id="BAC07806.1"
FT   CDS_pept        239421..239966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0254"
FT                   /note="ORF_ID:tlr0254"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07807"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07807"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM69"
FT                   /protein_id="BAC07807.1"
FT                   TQPMTRQNFQRAFALRIQ"
FT   CDS_pept        complement(239936..241072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0255"
FT                   /product="amino acid permease family protein"
FT                   /note="ORF_ID:tll0255"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07808"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07808"
FT                   /db_xref="GOA:Q8DM68"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM68"
FT                   /protein_id="BAC07808.1"
FT   mobile_element  241108..242780
FT                   /mobile_element_type="insertion sequence:ISEL3b"
FT   CDS_pept        complement(241141..241533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0256"
FT                   /note="ORF_ID:tll0256"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07809"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07809"
FT                   /db_xref="GOA:Q8DM67"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM67"
FT                   /protein_id="BAC07809.1"
FT   CDS_pept        241585..242763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0257"
FT                   /note="ORF_ID:tlr0257"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07810"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07810"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM66"
FT                   /protein_id="BAC07810.1"
FT   CDS_pept        242877..243044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0258"
FT                   /note="ORF_ID:tsr0258"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07811"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07811"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM65"
FT                   /protein_id="BAC07811.1"
FT                   SPELRHLPGT"
FT   CDS_pept        complement(243046..243594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrf"
FT                   /product="ribosome releasing factor"
FT                   /note="ORF_ID:tll0259"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07812"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07812"
FT                   /db_xref="GOA:Q8DM64"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DM64"
FT                   /protein_id="BAC07812.1"
FT   CDS_pept        complement(243581..244309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /product="uridine monophosphate kinase"
FT                   /note="ORF_ID:tll0260"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07813"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07813"
FT                   /db_xref="GOA:Q8DM63"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DM63"
FT                   /protein_id="BAC07813.1"
FT   tRNA            complement(244362..244435)
FT                   /product="trnR-UCU"
FT   CDS_pept        244501..245190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0261"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:tlr0261"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07814"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07814"
FT                   /db_xref="GOA:Q8DM62"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM62"
FT                   /protein_id="BAC07814.1"
FT                   GYVLREA"
FT   CDS_pept        245171..245683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0262"
FT                   /note="ORF_ID:tlr0262"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07815"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07815"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM61"
FT                   /protein_id="BAC07815.1"
FT                   EIQYLEP"
FT   mobile_element  complement(245778..246622)
FT                   /mobile_element_type="other:TelI3q"
FT                   /note="groupII intron"
FT   CDS_pept        246692..247132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0263"
FT                   /note="ORF_ID:tlr0263"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07816"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07816"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM60"
FT                   /protein_id="BAC07816.1"
FT   CDS_pept        247496..248443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigD"
FT                   /product="group2 RNA polymerase sigma factor"
FT                   /note="ORF_ID:tlr0264"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07817"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07817"
FT                   /db_xref="GOA:Q8DM59"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM59"
FT                   /protein_id="BAC07817.1"
FT   CDS_pept        248447..249049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobO"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /note="ORF_ID:tlr0265"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07818"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07818"
FT                   /db_xref="GOA:Q8DM58"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR025826"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM58"
FT                   /protein_id="BAC07818.1"
FT   CDS_pept        complement(249046..249921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0266"
FT                   /note="ORF_ID:tll0266"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07819"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07819"
FT                   /db_xref="GOA:Q8DM57"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM57"
FT                   /protein_id="BAC07819.1"
FT                   VTIFSGELLL"
FT   CDS_pept        249899..250351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0267"
FT                   /product="nucleoside diphosphate kinase"
FT                   /note="ORF_ID:tlr0267"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07820"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07820"
FT                   /db_xref="GOA:Q8DM56"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DM56"
FT                   /protein_id="BAC07820.1"
FT   CDS_pept        complement(250326..251066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0268"
FT                   /note="ORF_ID:tll0268"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07821"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07821"
FT                   /db_xref="GOA:Q8DM55"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM55"
FT                   /protein_id="BAC07821.1"
FT   CDS_pept        complement(251216..252127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0269"
FT                   /note="ORF_ID:tll0269"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07822"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07822"
FT                   /db_xref="GOA:Q8DM54"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM54"
FT                   /protein_id="BAC07822.1"
FT   CDS_pept        252210..252794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0270"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:tlr0270"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07823"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07823"
FT                   /db_xref="GOA:Q8DM53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM53"
FT                   /protein_id="BAC07823.1"
FT   CDS_pept        253022..257002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlH"
FT                   /product="magnesium-protoporphyrin methyltransferase"
FT                   /note="ORF_ID:tlr0271"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07824"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07824"
FT                   /db_xref="GOA:Q8DM52"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011771"
FT                   /db_xref="InterPro:IPR022571"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM52"
FT                   /protein_id="BAC07824.1"
FT   CDS_pept        257115..257321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0272"
FT                   /note="ORF_ID:tsr0272"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07825"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07825"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM51"
FT                   /protein_id="BAC07825.1"
FT   mobile_element  257362..258688
FT                   /mobile_element_type="insertion sequence:ISEL1d"
FT   CDS_pept        257476..258648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0273"
FT                   /note="ORF_ID:tlr0273"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07826"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07826"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM50"
FT                   /protein_id="BAC07826.1"
FT   CDS_pept        258849..259895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbpA"
FT                   /product="sulfate transport system substrate-binding
FT                   protein"
FT                   /note="ORF_ID:tlr0274"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07827"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07827"
FT                   /db_xref="GOA:Q8DM49"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM49"
FT                   /protein_id="BAC07827.1"
FT                   QIQQENQA"
FT   CDS_pept        259895..260746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /product="sulfate transport system permease protein"
FT                   /note="ORF_ID:tlr0275"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07828"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07828"
FT                   /db_xref="GOA:Q8DM48"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM48"
FT                   /protein_id="BAC07828.1"
FT                   ER"
FT   CDS_pept        260733..261572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /product="sulfate transport system permease protein"
FT                   /note="ORF_ID:tlr0276"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07829"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07829"
FT                   /db_xref="GOA:Q8DM47"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM47"
FT                   /protein_id="BAC07829.1"
FT   CDS_pept        complement(261569..262855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /product="homoserine dehydrogenase"
FT                   /note="ORF_ID:tll0277"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07830"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07830"
FT                   /db_xref="GOA:Q8DM46"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM46"
FT                   /protein_id="BAC07830.1"
FT   CDS_pept        complement(262900..264423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0278"
FT                   /note="ORF_ID:tll0278"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07831"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07831"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM45"
FT                   /protein_id="BAC07831.1"
FT   CDS_pept        264532..265329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /note="ORF_ID:tlr0279"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07832"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07832"
FT                   /db_xref="GOA:Q8DM44"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DM44"
FT                   /protein_id="BAC07832.1"
FT   CDS_pept        complement(265331..266266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /product="heat shock protein"
FT                   /note="ORF_ID:tll0280"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07833"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07833"
FT                   /db_xref="GOA:Q8DM43"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM43"
FT                   /protein_id="BAC07833.1"
FT   CDS_pept        266381..267496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0281"
FT                   /product="histidinol-phosphate amidotransferase"
FT                   /note="ORF_ID:tlr0281"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07834"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07834"
FT                   /db_xref="GOA:Q8DM42"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DM42"
FT                   /protein_id="BAC07834.1"
FT   CDS_pept        complement(267493..267909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0282"
FT                   /note="ORF_ID:tll0282"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07835"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07835"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM41"
FT                   /protein_id="BAC07835.1"
FT   CDS_pept        268049..268780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0283"
FT                   /note="ORF_ID:tlr0283"
FT                   /note="lipid transfer protein M30 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07836"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07836"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM40"
FT                   /protein_id="BAC07836.1"
FT   CDS_pept        268790..269692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0284"
FT                   /note="ORF_ID:tlr0284"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07837"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07837"
FT                   /db_xref="GOA:Q8DM39"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM39"
FT                   /protein_id="BAC07837.1"
FT   CDS_pept        269689..271065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /product="anthranilate synthase component I"
FT                   /note="ORF_ID:tlr0285"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07838"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07838"
FT                   /db_xref="GOA:Q8DM38"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR010118"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM38"
FT                   /protein_id="BAC07838.1"
FT                   "
FT   CDS_pept        complement(271062..271538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0286"
FT                   /note="ORF_ID:tll0286"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07839"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07839"
FT                   /db_xref="InterPro:IPR021469"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM37"
FT                   /protein_id="BAC07839.1"
FT   CDS_pept        complement(271551..272126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0287"
FT                   /note="ORF_ID:tll0287"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07840"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07840"
FT                   /db_xref="GOA:Q8DM36"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="PDB:5B82"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM36"
FT                   /protein_id="BAC07840.1"
FT   CDS_pept        complement(272171..273469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0288"
FT                   /product="sulfide quinone reductase"
FT                   /note="ORF_ID:tll0288"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07841"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07841"
FT                   /db_xref="GOA:Q8DM35"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM35"
FT                   /protein_id="BAC07841.1"
FT   CDS_pept        273646..274059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf41"
FT                   /note="ORF_ID:tlr0289"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07842"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07842"
FT                   /db_xref="GOA:Q8DM34"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM34"
FT                   /protein_id="BAC07842.1"
FT   CDS_pept        complement(274056..277130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0290"
FT                   /note="ORF_ID:tll0290"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07843"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07843"
FT                   /db_xref="GOA:Q8DM33"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041147"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM33"
FT                   /protein_id="BAC07843.1"
FT   CDS_pept        277253..278053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0291"
FT                   /note="ORF_ID:tlr0291"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07844"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07844"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM32"
FT                   /protein_id="BAC07844.1"
FT   CDS_pept        complement(278114..278986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0292"
FT                   /note="ORF_ID:tll0292"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07845"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07845"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM31"
FT                   /protein_id="BAC07845.1"
FT                   IDRYLSQLR"
FT   CDS_pept        279082..279297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /product="preprotein translocase SecE subunit"
FT                   /note="ORF_ID:tsr0293"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07846"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07846"
FT                   /db_xref="GOA:Q8DM30"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM30"
FT                   /protein_id="BAC07846.1"
FT   CDS_pept        279328..280011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /product="transcription antitermination protein"
FT                   /note="ORF_ID:tlr0294"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07847"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07847"
FT                   /db_xref="GOA:Q8DM29"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM29"
FT                   /protein_id="BAC07847.1"
FT                   VEKVD"
FT   CDS_pept        280026..280451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl11"
FT                   /product="50S ribosomal protein L11"
FT                   /note="ORF_ID:tlr0295"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07848"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07848"
FT                   /db_xref="GOA:Q8DM28"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DM28"
FT                   /protein_id="BAC07848.1"
FT   CDS_pept        280538..281251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl1"
FT                   /product="50S ribosomal protein L1"
FT                   /note="ORF_ID:tlr0296"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07849"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07849"
FT                   /db_xref="GOA:Q8DM27"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DM27"
FT                   /protein_id="BAC07849.1"
FT                   VDINALRELKLAEAA"
FT   CDS_pept        281421..281957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl10"
FT                   /product="50S ribosomal protein L10"
FT                   /note="ORF_ID:tlr0297"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07850"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07850"
FT                   /db_xref="GOA:Q8DM26"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DM26"
FT                   /protein_id="BAC07850.1"
FT                   SLARATQAIADKGAA"
FT   CDS_pept        282033..282431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl12"
FT                   /product="50S ribosomal protein L12"
FT                   /note="ORF_ID:tlr0298"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07851"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07851"
FT                   /db_xref="GOA:Q8DM25"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DM25"
FT                   /protein_id="BAC07851.1"
FT   CDS_pept        282505..282984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /product="ribonuclease H"
FT                   /note="ORF_ID:tlr0299"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07852"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07852"
FT                   /db_xref="GOA:Q8DM24"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DM24"
FT                   /protein_id="BAC07852.1"
FT   CDS_pept        complement(282917..283672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0300"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /note="ORF_ID:tll0300"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07853"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07853"
FT                   /db_xref="GOA:Q8DM23"
FT                   /db_xref="InterPro:IPR006438"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM23"
FT                   /protein_id="BAC07853.1"
FT   CDS_pept        283778..284104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf65"
FT                   /note="ORF_ID:tlr0301"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07854"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07854"
FT                   /db_xref="GOA:P59327"
FT                   /db_xref="InterPro:IPR006924"
FT                   /db_xref="InterPro:IPR038447"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59327"
FT                   /protein_id="BAC07854.1"
FT                   VGTA"
FT   CDS_pept        284304..285380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0302"
FT                   /product="isocitrate dehydrogenase"
FT                   /note="ORF_ID:tlr0302"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07855"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07855"
FT                   /db_xref="GOA:Q8DM22"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM22"
FT                   /protein_id="BAC07855.1"
FT                   EPVGTQEMAAAIAEYAAP"
FT   CDS_pept        complement(285377..286741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0303"
FT                   /product="Na+-transporting ATP synthase"
FT                   /note="ORF_ID:tll0303"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07856"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07856"
FT                   /db_xref="GOA:Q8DM21"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM21"
FT                   /protein_id="BAC07856.1"
FT   tRNA            complement(286820..286896)
FT                   /product="trnP-UGG"
FT   CDS_pept        287000..288811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0304"
FT                   /product="GTP-binding protein"
FT                   /note="ORF_ID:tlr0304"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07857"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07857"
FT                   /db_xref="GOA:Q8DM20"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027518"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DM20"
FT                   /protein_id="BAC07857.1"
FT   CDS_pept        288822..288977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0305"
FT                   /note="ORF_ID:tsr0305"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07858"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07858"
FT                   /db_xref="GOA:Q8DM19"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM19"
FT                   /protein_id="BAC07858.1"
FT                   LPLLLP"
FT   CDS_pept        complement(288984..290705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0306"
FT                   /note="ORF_ID:tll0306"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07859"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07859"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM18"
FT                   /protein_id="BAC07859.1"
FT   CDS_pept        complement(290720..293194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /product="ATP-dependent Clp protease regulatory subunit"
FT                   /note="ORF_ID:tll0307"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07860"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07860"
FT                   /db_xref="GOA:Q8DM17"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM17"
FT                   /protein_id="BAC07860.1"
FT                   QPRRELLPQAVE"
FT   mobile_element  join(293406..294033,294873..296628)
FT                   /mobile_element_type="other:TelI4b"
FT                   /note="groupII intron"
FT   mobile_element  294034..294872
FT                   /mobile_element_type="other:TelI3b"
FT                   /note="groupII intron"
FT   CDS_pept        294853..296547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0308"
FT                   /product="reverse transcriptase"
FT                   /note="ORF_ID:tlr0308"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07861"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07861"
FT                   /db_xref="GOA:Q8CM00"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CM00"
FT                   /protein_id="BAC07861.1"
FT   CDS_pept        296858..297466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0310"
FT                   /note="ORF_ID:tlr0310"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07862"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07862"
FT                   /db_xref="GOA:Q8DM16"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM16"
FT                   /protein_id="BAC07862.1"
FT   CDS_pept        297514..298152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0311"
FT                   /note="ORF_ID:tlr0311"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07863"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07863"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM15"
FT                   /protein_id="BAC07863.1"
FT   CDS_pept        complement(298133..300457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0312"
FT                   /note="ORF_ID:tll0312"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07864"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07864"
FT                   /db_xref="GOA:Q8DM14"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM14"
FT                   /protein_id="BAC07864.1"
FT   CDS_pept        300633..301007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0313"
FT                   /note="ORF_ID:tlr0313"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07865"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07865"
FT                   /db_xref="InterPro:IPR025458"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM13"
FT                   /protein_id="BAC07865.1"
FT   CDS_pept        complement(301107..302204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0314"
FT                   /note="ORF_ID:tll0314"
FT                   /note="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07866"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07866"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM12"
FT                   /protein_id="BAC07866.1"
FT   CDS_pept        complement(302205..302606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0315"
FT                   /note="ORF_ID:tll0315"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07867"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07867"
FT                   /db_xref="InterPro:IPR021503"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM11"
FT                   /protein_id="BAC07867.1"
FT   CDS_pept        complement(302794..303648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0316"
FT                   /product="biopolymer transport ExbB like protein"
FT                   /note="ORF_ID:tll0316"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07868"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07868"
FT                   /db_xref="GOA:Q8DM10"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM10"
FT                   /protein_id="BAC07868.1"
FT                   TLF"
FT   CDS_pept        303612..304217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /product="group3 RNA polymerase sigma factor"
FT                   /note="ORF_ID:tlr0317"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07869"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07869"
FT                   /db_xref="GOA:Q8DM09"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM09"
FT                   /protein_id="BAC07869.1"
FT   CDS_pept        304214..304537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0318"
FT                   /note="ORF_ID:tlr0318"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07870"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07870"
FT                   /db_xref="GOA:Q8DM08"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM08"
FT                   /protein_id="BAC07870.1"
FT                   LFE"
FT   CDS_pept        304621..305049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0319"
FT                   /note="ORF_ID:tlr0319"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07871"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07871"
FT                   /db_xref="GOA:Q8DM07"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="InterPro:IPR025961"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM07"
FT                   /protein_id="BAC07871.1"
FT   CDS_pept        305202..307889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0320"
FT                   /note="ORF_ID:tlr0320"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07872"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07872"
FT                   /db_xref="GOA:Q8DM06"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM06"
FT                   /protein_id="BAC07872.1"
FT   CDS_pept        complement(308609..309772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0321"
FT                   /product="lipid A disaccharide synthase"
FT                   /note="ORF_ID:tll0321"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07873"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07873"
FT                   /db_xref="GOA:Q8DM05"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM05"
FT                   /protein_id="BAC07873.1"
FT   CDS_pept        complement(309775..310914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0322"
FT                   /note="ORF_ID:tll0322"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07874"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07874"
FT                   /db_xref="GOA:Q8DM04"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011792"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM04"
FT                   /protein_id="BAC07874.1"
FT   CDS_pept        311083..311553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0323"
FT                   /note="ORF_ID:tlr0323"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07875"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07875"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM03"
FT                   /protein_id="BAC07875.1"
FT   mobile_element  complement(311724..311806)
FT                   /mobile_element_type="insertion sequence:ISEL4b"
FT   CDS_pept        312288..313193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0324"
FT                   /note="ORF_ID:tlr0324"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07876"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07876"
FT                   /db_xref="GOA:Q8DM02"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM02"
FT                   /protein_id="BAC07876.1"
FT   CDS_pept        313340..314923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="ORF_ID:tlr0325"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07877"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07877"
FT                   /db_xref="GOA:Q8DM01"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DM01"
FT                   /protein_id="BAC07877.1"
FT                   GIRDAYIVNL"
FT   CDS_pept        314932..315831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0326"
FT                   /note="ORF_ID:tlr0326"
FT                   /note="probable methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07878"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07878"
FT                   /db_xref="GOA:Q8DM00"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DM00"
FT                   /protein_id="BAC07878.1"
FT                   WRRNEWCCLNARFERLPD"
FT   CDS_pept        complement(315838..317001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0327"
FT                   /note="ORF_ID:tll0327"
FT                   /note="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07879"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07879"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLZ9"
FT                   /protein_id="BAC07879.1"
FT   CDS_pept        complement(317051..317857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0328"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:tll0328"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07880"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07880"
FT                   /db_xref="GOA:Q8DLZ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLZ8"
FT                   /protein_id="BAC07880.1"
FT   CDS_pept        complement(317861..318616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0329"
FT                   /note="ORF_ID:tll0329"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07881"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07881"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLZ7"
FT                   /protein_id="BAC07881.1"
FT   CDS_pept        complement(318650..318955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureB"
FT                   /product="urease beta subunit"
FT                   /note="ORF_ID:tll0330"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07882"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07882"
FT                   /db_xref="GOA:Q8DLZ6"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLZ6"
FT                   /protein_id="BAC07882.1"
FT   CDS_pept        complement(318995..319630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /note="ORF_ID:tll0331"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07883"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07883"
FT                   /db_xref="GOA:Q8DLZ5"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLZ5"
FT                   /protein_id="BAC07883.1"
FT   CDS_pept        complement(319627..321414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0332"
FT                   /note="ORF_ID:tll0332"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07884"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07884"
FT                   /db_xref="GOA:Q8DLZ4"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLZ4"
FT                   /protein_id="BAC07884.1"
FT   CDS_pept        321932..322867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0333"
FT                   /note="ORF_ID:tlr0333"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07885"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07885"
FT                   /db_xref="GOA:Q8DLZ3"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLZ3"
FT                   /protein_id="BAC07885.1"
FT   CDS_pept        323008..324393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /product="thiamine biosynthesis protein"
FT                   /note="ORF_ID:tlr0334"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07886"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07886"
FT                   /db_xref="GOA:Q8DLZ2"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLZ2"
FT                   /protein_id="BAC07886.1"
FT                   ASA"
FT   CDS_pept        324397..325386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0335"
FT                   /product="phosphate transport protein"
FT                   /note="ORF_ID:tlr0335"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07887"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07887"
FT                   /db_xref="GOA:Q8DLZ1"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLZ1"
FT                   /protein_id="BAC07887.1"
FT   CDS_pept        complement(325394..325843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0336"
FT                   /note="ORF_ID:tll0336"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07888"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07888"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLZ0"
FT                   /protein_id="BAC07888.1"
FT   CDS_pept        complement(325840..327279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtQ"
FT                   /product="zeta-carotene desaturase"
FT                   /note="ORF_ID:tll0337"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07889"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07889"
FT                   /db_xref="GOA:Q8DLY9"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014103"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLY9"
FT                   /protein_id="BAC07889.1"
FT   CDS_pept        327432..327608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0338"
FT                   /note="ORF_ID:tsr0338"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07890"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLY8"
FT                   /protein_id="BAC07890.1"
FT                   WQKDCASKEEPSC"
FT   CDS_pept        327700..329634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sir"
FT                   /product="ferredoxin-sulfite reductase"
FT                   /note="ORF_ID:tlr0339"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07891"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07891"
FT                   /db_xref="GOA:Q8DLY7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR011787"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLY7"
FT                   /protein_id="BAC07891.1"
FT                   EQSRQNKQG"
FT   tRNA            329671..329742
FT                   /product="trnC-GCA"
FT   CDS_pept        complement(329758..330774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0340"
FT                   /note="ORF_ID:tll0340"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07892"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07892"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLY6"
FT                   /protein_id="BAC07892.1"
FT   CDS_pept        330848..331675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0341"
FT                   /note="ORF_ID:tlr0341"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07893"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07893"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLY5"
FT                   /protein_id="BAC07893.1"
FT   CDS_pept        331689..332231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0342"
FT                   /note="ORF_ID:tlr0342"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07894"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07894"
FT                   /db_xref="InterPro:IPR030816"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLY4"
FT                   /protein_id="BAC07894.1"
FT                   RLELQTALEELKRSMGL"
FT   CDS_pept        332279..333601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="ORF_ID:tlr0343"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07895"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07895"
FT                   /db_xref="GOA:Q8DLY3"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLY3"
FT                   /protein_id="BAC07895.1"
FT   CDS_pept        333914..334549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0344"
FT                   /note="ORF_ID:tlr0344"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07896"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07896"
FT                   /db_xref="GOA:Q8DLY2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLY2"
FT                   /protein_id="BAC07896.1"
FT   CDS_pept        334620..335810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0345"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:tlr0345"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07897"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07897"
FT                   /db_xref="GOA:Q8DLY1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024186"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLY1"
FT                   /protein_id="BAC07897.1"
FT   CDS_pept        335897..336262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0346"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:tlr0346"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07898"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07898"
FT                   /db_xref="GOA:Q8DLY0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLY0"
FT                   /protein_id="BAC07898.1"
FT                   PFDPKELVGTIKQLLRG"
FT   CDS_pept        336268..336798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /note="ORF_ID:tlr0347"
FT                   /note="similar to chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07899"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07899"
FT                   /db_xref="GOA:Q8DLX9"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLX9"
FT                   /protein_id="BAC07899.1"
FT                   DPLAILRSARWGL"
FT   CDS_pept        336997..340161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0348"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="ORF_ID:tlr0348"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07900"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07900"
FT                   /db_xref="GOA:Q8DLX8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLX8"
FT                   /protein_id="BAC07900.1"
FT                   NTEDQA"
FT   CDS_pept        340180..344481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0349"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /note="ORF_ID:tlr0349"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07901"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07901"
FT                   /db_xref="GOA:Q8DLX7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLX7"
FT                   /protein_id="BAC07901.1"
FT   CDS_pept        344478..347147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0350"
FT                   /note="ORF_ID:tlr0350"
FT                   /note="putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07902"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07902"
FT                   /db_xref="GOA:Q8DLX6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLX6"
FT                   /protein_id="BAC07902.1"
FT                   RFPVNDLLEGVELEVATL"
FT   tRNA            complement(347190..347262)
FT                   /product="trnM-CAU"
FT   CDS_pept        347391..347765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0351"
FT                   /note="ORF_ID:tlr0351"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07903"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07903"
FT                   /db_xref="InterPro:IPR017260"
FT                   /db_xref="InterPro:IPR025595"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLX5"
FT                   /protein_id="BAC07903.1"
FT   CDS_pept        347737..348255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0352"
FT                   /note="ORF_ID:tlr0352"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07904"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07904"
FT                   /db_xref="InterPro:IPR018588"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLX4"
FT                   /protein_id="BAC07904.1"
FT                   LSPQWLDSP"
FT   CDS_pept        348289..349077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0353"
FT                   /note="ORF_ID:tlr0353"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07905"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07905"
FT                   /db_xref="GOA:Q8DLX3"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLX3"
FT                   /protein_id="BAC07905.1"
FT   CDS_pept        349082..349789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0354"
FT                   /note="ORF_ID:tlr0354"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07906"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07906"
FT                   /db_xref="GOA:Q8DLX2"
FT                   /db_xref="InterPro:IPR010840"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLX2"
FT                   /protein_id="BAC07906.1"
FT                   HSQMPPIKEREDA"
FT   tRNA            complement(349801..349873)
FT                   /product="trnV-UAC"
FT   CDS_pept        350059..350607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="ORF_ID:tlr0355"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07907"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07907"
FT                   /db_xref="GOA:Q8DLX1"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLX1"
FT                   /protein_id="BAC07907.1"
FT   CDS_pept        350611..350937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0356"
FT                   /note="ORF_ID:tlr0356"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07908"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07908"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLX0"
FT                   /protein_id="BAC07908.1"
FT                   SLMG"
FT   CDS_pept        complement(350918..351406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0357"
FT                   /note="ORF_ID:tll0357"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07909"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07909"
FT                   /db_xref="GOA:Q8DLW9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLW9"
FT                   /protein_id="BAC07909.1"
FT   CDS_pept        complement(351426..352457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /product="carboxysome formation protein"
FT                   /note="ORF_ID:tll0358"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07910"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07910"
FT                   /db_xref="GOA:Q8DLW8"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLW8"
FT                   /protein_id="BAC07910.1"
FT                   LSR"
FT   CDS_pept        352527..353390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0359"
FT                   /note="ORF_ID:tlr0359"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07911"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07911"
FT                   /db_xref="GOA:Q8DLW7"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLW7"
FT                   /protein_id="BAC07911.1"
FT                   CGDSLP"
FT   CDS_pept        complement(353387..354259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0360"
FT                   /note="ORF_ID:tll0360"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07912"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07912"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLW6"
FT                   /protein_id="BAC07912.1"
FT                   LETFLGRYF"
FT   CDS_pept        354876..357524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0361"
FT                   /note="ORF_ID:tlr0361"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07913"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07913"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLW5"
FT                   /protein_id="BAC07913.1"
FT                   SIDLNAETSSV"
FT   CDS_pept        358411..360996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0362"
FT                   /note="ORF_ID:tlr0362"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07914"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07914"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLW4"
FT                   /protein_id="BAC07914.1"
FT   CDS_pept        361093..361683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0363"
FT                   /note="ORF_ID:tlr0363"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07915"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07915"
FT                   /db_xref="GOA:Q8DLW3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLW3"
FT                   /protein_id="BAC07915.1"
FT   CDS_pept        361809..363131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0364"
FT                   /note="ORF_ID:tlr0364"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07916"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07916"
FT                   /db_xref="GOA:Q8DLW2"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLW2"
FT                   /protein_id="BAC07916.1"
FT   CDS_pept        complement(363157..363876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ho1"
FT                   /product="heme oxygenase 1"
FT                   /note="ORF_ID:tll0365"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07917"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07917"
FT                   /db_xref="GOA:Q8DLW1"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR018207"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLW1"
FT                   /protein_id="BAC07917.1"
FT                   TLTRRKQRGSTELATAD"
FT   CDS_pept        complement(363972..365363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /product="L-argininosuccinate lyase"
FT                   /note="ORF_ID:tll0366"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07918"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07918"
FT                   /db_xref="GOA:Q8DLW0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLW0"
FT                   /protein_id="BAC07918.1"
FT                   RLNDF"
FT   CDS_pept        complement(365379..365582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0367"
FT                   /note="ORF_ID:tsl0367"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07919"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07919"
FT                   /db_xref="GOA:Q8DLV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLV9"
FT                   /protein_id="BAC07919.1"
FT   CDS_pept        complement(365680..365970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0368"
FT                   /note="ORF_ID:tsl0368"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07920"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07920"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLV8"
FT                   /protein_id="BAC07920.1"
FT   CDS_pept        complement(366287..367384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0369"
FT                   /note="ORF_ID:tll0369"
FT                   /note="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07921"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07921"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLV7"
FT                   /protein_id="BAC07921.1"
FT   CDS_pept        complement(367390..368295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0370"
FT                   /product="UDP-N-acetylenolpyruvylglucosamine reductase"
FT                   /note="ORF_ID:tll0370"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07922"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07922"
FT                   /db_xref="GOA:Q8DLV6"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLV6"
FT                   /protein_id="BAC07922.1"
FT   CDS_pept        complement(368292..369719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /product="UDP-N-acetylmuramate-alanine ligase"
FT                   /note="ORF_ID:tll0371"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07923"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07923"
FT                   /db_xref="GOA:Q8DLV5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLV5"
FT                   /protein_id="BAC07923.1"
FT                   ADQEQFSVSSLTEAIAL"
FT   CDS_pept        370100..371191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0372"
FT                   /note="ORF_ID:tlr0372"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07924"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07924"
FT                   /db_xref="GOA:Q8DLV4"
FT                   /db_xref="InterPro:IPR010004"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLV4"
FT                   /protein_id="BAC07924.1"
FT   CDS_pept        371732..371935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0373"
FT                   /note="ORF_ID:tsr0373"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07925"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07925"
FT                   /db_xref="InterPro:IPR021231"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLV3"
FT                   /protein_id="BAC07925.1"
FT   CDS_pept        371960..373363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0374"
FT                   /product="protoporphyrinogen oxidase"
FT                   /note="ORF_ID:tlr0374"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07926"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07926"
FT                   /db_xref="GOA:Q8DLV2"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLV2"
FT                   /protein_id="BAC07926.1"
FT                   AAYLAGGQS"
FT   CDS_pept        373366..373611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0375"
FT                   /note="ORF_ID:tsr0375"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07927"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07927"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLV1"
FT                   /protein_id="BAC07927.1"
FT   CDS_pept        373771..374850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbaA"
FT                   /product="class II fructose-bisphosphate aldolase"
FT                   /note="ORF_ID:tlr0376"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07928"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07928"
FT                   /db_xref="GOA:Q8DLV0"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLV0"
FT                   /protein_id="BAC07928.1"
FT   tRNA            complement(374990..375063)
FT                   /product="trnR-ACG"
FT   CDS_pept        375239..376849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0377"
FT                   /note="ORF_ID:tlr0377"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07929"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07929"
FT                   /db_xref="GOA:Q8DLU9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLU9"
FT                   /protein_id="BAC07929.1"
FT   tRNA            376874..376955
FT                   /product="trnL-CAA"
FT   CDS_pept        complement(376960..378399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0378"
FT                   /note="ORF_ID:tll0378"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07930"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07930"
FT                   /db_xref="GOA:Q8DLU8"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLU8"
FT                   /protein_id="BAC07930.1"
FT   CDS_pept        378445..379080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0379"
FT                   /note="ORF_ID:tlr0379"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07931"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07931"
FT                   /db_xref="GOA:Q8DLU7"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLU7"
FT                   /protein_id="BAC07931.1"
FT   CDS_pept        complement(379113..380810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0380"
FT                   /note="ORF_ID:tll0380"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07932"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07932"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLU6"
FT                   /protein_id="BAC07932.1"
FT   CDS_pept        complement(381079..381483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0381"
FT                   /note="ORF_ID:tll0381"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07933"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07933"
FT                   /db_xref="GOA:Q8DLU5"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLU5"
FT                   /protein_id="BAC07933.1"
FT   CDS_pept        complement(381495..382487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0382"
FT                   /note="ORF_ID:tll0382"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07934"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07934"
FT                   /db_xref="GOA:Q8DLU4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLU4"
FT                   /protein_id="BAC07934.1"
FT   mobile_element  complement(381500..382600)
FT                   /mobile_element_type="insertion sequence:ISEL4c"
FT   CDS_pept        complement(382438..383235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0383"
FT                   /note="ORF_ID:tll0383"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07935"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07935"
FT                   /db_xref="GOA:Q8DLU3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLU3"
FT                   /protein_id="BAC07935.1"
FT   CDS_pept        complement(383319..384308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0384"
FT                   /note="ORF_ID:tll0384"
FT                   /note="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07936"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07936"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLU2"
FT                   /protein_id="BAC07936.1"
FT   CDS_pept        complement(384400..385347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /product="H+-transporting ATP synthase gamma chain"
FT                   /note="ORF_ID:tll0385"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07937"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07937"
FT                   /db_xref="GOA:Q8DLU1"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="PDB:5ZWL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLU1"
FT                   /protein_id="BAC07937.1"
FT   CDS_pept        complement(385410..386330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0386"
FT                   /note="ORF_ID:tll0386"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07938"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07938"
FT                   /db_xref="GOA:Q8DLU0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLU0"
FT                   /protein_id="BAC07938.1"
FT   mobile_element  complement(386509..388173)
FT                   /mobile_element_type="insertion sequence:ISEL3c"
FT   CDS_pept        complement(386526..387251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0387"
FT                   /note="ORF_ID:tll0387"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07939"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07939"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLT9"
FT                   /protein_id="BAC07939.1"
FT   CDS_pept        complement(387424..387696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0388"
FT                   /note="ORF_ID:tsl0388"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07940"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07940"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CME6"
FT                   /protein_id="BAC07940.1"
FT   CDS_pept        387748..388140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0389"
FT                   /note="ORF_ID:tlr0389"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07941"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07941"
FT                   /db_xref="GOA:Q8CM61"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CM61"
FT                   /protein_id="BAC07941.1"
FT   CDS_pept        complement(388164..388553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0390"
FT                   /note="ORF_ID:tll0390"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07942"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07942"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLT8"
FT                   /protein_id="BAC07942.1"
FT   CDS_pept        complement(388597..389766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0391"
FT                   /note="ORF_ID:tll0391"
FT                   /note="sporulation protein spoIID homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07943"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07943"
FT                   /db_xref="GOA:Q8DLT7"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLT7"
FT                   /protein_id="BAC07943.1"
FT   CDS_pept        complement(389804..390532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0392"
FT                   /note="ORF_ID:tll0392"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07944"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07944"
FT                   /db_xref="GOA:Q8DLT6"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLT6"
FT                   /protein_id="BAC07944.1"
FT   CDS_pept        390663..392093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0393"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="ORF_ID:tlr0393"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07945"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07945"
FT                   /db_xref="GOA:Q8DLT5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLT5"
FT                   /protein_id="BAC07945.1"
FT                   LVIARCRQVVKPNWEPEA"
FT   CDS_pept        complement(392090..392422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0394"
FT                   /note="ORF_ID:tll0394"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07946"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07946"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLT4"
FT                   /protein_id="BAC07946.1"
FT                   PCCGAG"
FT   tRNA            complement(392494..392565)
FT                   /product="trnV-CAC"
FT   CDS_pept        complement(392616..393281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /product="orotidine 5' monophosphate decarboxylase"
FT                   /note="ORF_ID:tll0395"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07947"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07947"
FT                   /db_xref="GOA:Q8DLT3"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLT3"
FT                   /protein_id="BAC07947.1"
FT   CDS_pept        complement(393345..393941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0396"
FT                   /note="ORF_ID:tll0396"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07948"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07948"
FT                   /db_xref="GOA:Q8DLT2"
FT                   /db_xref="InterPro:IPR022051"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLT2"
FT                   /protein_id="BAC07948.1"
FT   CDS_pept        complement(393972..394808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0397"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /note="ORF_ID:tll0397"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07949"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07949"
FT                   /db_xref="GOA:Q8DLT1"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLT1"
FT                   /protein_id="BAC07949.1"
FT   CDS_pept        complement(394815..395966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0398"
FT                   /product="sulfolipid biosynthesis protein"
FT                   /note="ORF_ID:tll0398"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07950"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07950"
FT                   /db_xref="GOA:Q8DLT0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLT0"
FT                   /protein_id="BAC07950.1"
FT   CDS_pept        complement(396060..397058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0399"
FT                   /note="ORF_ID:tll0399"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07951"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07951"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLS9"
FT                   /protein_id="BAC07951.1"
FT   mobile_element  397188..398866
FT                   /mobile_element_type="insertion sequence:ISEL3d"
FT   CDS_pept        complement(397221..397619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0400"
FT                   /note="ORF_ID:tll0400"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07952"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07952"
FT                   /db_xref="GOA:Q8DLS8"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLS8"
FT                   /protein_id="BAC07952.1"
FT   CDS_pept        397671..398849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0401"
FT                   /note="ORF_ID:tlr0401"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07953"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07953"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLS7"
FT                   /protein_id="BAC07953.1"
FT   CDS_pept        399326..400231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /product="4-hydroxybenzoate-octaprenyl transferase"
FT                   /note="ORF_ID:tlr0402"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07954"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07954"
FT                   /db_xref="GOA:Q8DLS6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLS6"
FT                   /protein_id="BAC07954.1"
FT   CDS_pept        complement(400221..400955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0403"
FT                   /note="ORF_ID:tll0403"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07955"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07955"
FT                   /db_xref="GOA:Q8DLS5"
FT                   /db_xref="InterPro:IPR005238"
FT                   /db_xref="InterPro:IPR036702"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLS5"
FT                   /protein_id="BAC07955.1"
FT   CDS_pept        complement(400975..401661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0404"
FT                   /note="ORF_ID:tll0404"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07956"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07956"
FT                   /db_xref="GOA:Q8DLS4"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLS4"
FT                   /protein_id="BAC07956.1"
FT                   MYQGSS"
FT   CDS_pept        402001..402570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0405"
FT                   /product="signal peptidase I"
FT                   /note="ORF_ID:tlr0405"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07957"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07957"
FT                   /db_xref="GOA:Q8DLS3"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLS3"
FT                   /protein_id="BAC07957.1"
FT   mobile_element  403280..404606
FT                   /mobile_element_type="insertion sequence:ISEL1e"
FT   CDS_pept        403394..404566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0406"
FT                   /note="ORF_ID:tlr0406"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07958"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07958"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLS2"
FT                   /protein_id="BAC07958.1"
FT   CDS_pept        404608..405441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0407"
FT                   /note="ORF_ID:tlr0407"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07959"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07959"
FT                   /db_xref="GOA:Q8DLS1"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLS1"
FT                   /protein_id="BAC07959.1"
FT   CDS_pept        405371..406771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0408"
FT                   /product="omega-amino acid:pyruvate aminotransferase"
FT                   /note="ORF_ID:tlr0408"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07960"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07960"
FT                   /db_xref="GOA:Q8DLS0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLS0"
FT                   /protein_id="BAC07960.1"
FT                   SRVLQELP"
FT   CDS_pept        406822..407136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0409"
FT                   /note="ORF_ID:tlr0409"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07961"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07961"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLR9"
FT                   /protein_id="BAC07961.1"
FT                   "
FT   CDS_pept        407244..407711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0410"
FT                   /note="ORF_ID:tlr0410"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07962"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07962"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLR8"
FT                   /protein_id="BAC07962.1"
FT   CDS_pept        407708..407986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0411"
FT                   /note="ORF_ID:tsr0411"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07963"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07963"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLR7"
FT                   /protein_id="BAC07963.1"
FT   CDS_pept        408028..408741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0412"
FT                   /note="ORF_ID:tlr0412"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07964"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07964"
FT                   /db_xref="GOA:Q8DLR6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLR6"
FT                   /protein_id="BAC07964.1"
FT                   DNNDIERFLRSQHVH"
FT   CDS_pept        408692..409459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0413"
FT                   /note="ORF_ID:tlr0413"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07965"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07965"
FT                   /db_xref="GOA:Q8DLR5"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLR5"
FT                   /protein_id="BAC07965.1"
FT   CDS_pept        409530..410444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0414"
FT                   /note="ORF_ID:tlr0414"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07966"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07966"
FT                   /db_xref="GOA:Q8DLR4"
FT                   /db_xref="InterPro:IPR007354"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLR4"
FT                   /protein_id="BAC07966.1"
FT   CDS_pept        complement(410400..412952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0415"
FT                   /product="primosomal replication factor Y"
FT                   /note="ORF_ID:tll0415"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07967"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07967"
FT                   /db_xref="GOA:Q8DLR3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLR3"
FT                   /protein_id="BAC07967.1"
FT   CDS_pept        413438..416380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /product="proline oxidase"
FT                   /note="ORF_ID:tlr0416"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07968"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07968"
FT                   /db_xref="GOA:Q8DLR2"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="InterPro:IPR041514"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLR2"
FT                   /protein_id="BAC07968.1"
FT   CDS_pept        416380..417537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0417"
FT                   /note="ORF_ID:tlr0417"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07969"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07969"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLR1"
FT                   /protein_id="BAC07969.1"
FT   CDS_pept        complement(417531..418670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0418"
FT                   /product="sulfolipid sulfoquinovosyldiacylglycerol
FT                   biosynthesis protein"
FT                   /note="ORF_ID:tll0418"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07970"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07970"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLR0"
FT                   /protein_id="BAC07970.1"
FT   CDS_pept        418777..419358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0419"
FT                   /product="fibrillin"
FT                   /note="ORF_ID:tlr0419"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07971"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07971"
FT                   /db_xref="InterPro:IPR006843"
FT                   /db_xref="InterPro:IPR039633"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLQ9"
FT                   /protein_id="BAC07971.1"
FT   CDS_pept        419418..420452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0420"
FT                   /note="ORF_ID:tlr0420"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07972"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07972"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLQ8"
FT                   /protein_id="BAC07972.1"
FT                   EVSS"
FT   CDS_pept        420523..421071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0421"
FT                   /note="ORF_ID:tlr0421"
FT                   /note="similar to arsenical resistance protein ArsH"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07973"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07973"
FT                   /db_xref="GOA:Q8DLQ7"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLQ7"
FT                   /protein_id="BAC07973.1"
FT   CDS_pept        complement(421068..422054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /product="porphobilinogen synthase"
FT                   /note="ORF_ID:tll0422"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07974"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07974"
FT                   /db_xref="GOA:Q8DLQ6"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLQ6"
FT                   /protein_id="BAC07974.1"
FT   CDS_pept        complement(422222..422770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0423"
FT                   /note="ORF_ID:tll0423"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07975"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07975"
FT                   /db_xref="GOA:Q8DLQ5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLQ5"
FT                   /protein_id="BAC07975.1"
FT   CDS_pept        complement(422776..423780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0424"
FT                   /product="methionyl aminopeptidase"
FT                   /note="ORF_ID:tll0424"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07976"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07976"
FT                   /db_xref="GOA:Q8DLQ4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLQ4"
FT                   /protein_id="BAC07976.1"
FT   CDS_pept        complement(423683..425125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrA"
FT                   /product="DNA photolyase"
FT                   /note="ORF_ID:tll0425"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07977"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07977"
FT                   /db_xref="GOA:Q8DLQ3"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR019947"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLQ3"
FT                   /protein_id="BAC07977.1"
FT   CDS_pept        complement(425169..425486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0426"
FT                   /note="ORF_ID:tll0426"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07978"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07978"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLQ2"
FT                   /protein_id="BAC07978.1"
FT                   F"
FT   CDS_pept        425781..426041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0427"
FT                   /note="ORF_ID:tsr0427"
FT                   /note="similar to anti-sigma f factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07979"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07979"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLQ1"
FT                   /protein_id="BAC07979.1"
FT   CDS_pept        426092..426547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0428"
FT                   /note="ORF_ID:tlr0428"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07980"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07980"
FT                   /db_xref="GOA:Q8DLQ0"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLQ0"
FT                   /protein_id="BAC07980.1"
FT   CDS_pept        426563..427018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atp1"
FT                   /product="H+-transporting ATP synthase chain"
FT                   /note="ORF_ID:tlr0429"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07981"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07981"
FT                   /db_xref="GOA:Q8DLP9"
FT                   /db_xref="InterPro:IPR017581"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLP9"
FT                   /protein_id="BAC07981.1"
FT   CDS_pept        427060..427818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI"
FT                   /product="H+-transporting ATP synthase chain a"
FT                   /note="ORF_ID:tlr0430"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07982"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07982"
FT                   /db_xref="GOA:Q8DLP8"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLP8"
FT                   /protein_id="BAC07982.1"
FT   CDS_pept        427851..428150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /product="ATP synthase subunit c"
FT                   /note="ORF_ID:tlr0431"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07983"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07983"
FT                   /db_xref="GOA:Q8DLP7"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLP7"
FT                   /protein_id="BAC07983.1"
FT   CDS_pept        428212..428628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /product="H+-transporting ATP synthase chain b'"
FT                   /note="ORF_ID:tlr0432"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07984"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07984"
FT                   /db_xref="GOA:Q8DLP6"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR034679"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLP6"
FT                   /protein_id="BAC07984.1"
FT   CDS_pept        428631..429170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /product="H+-transporting ATP synthase chain b"
FT                   /note="ORF_ID:tlr0433"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07985"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07985"
FT                   /db_xref="GOA:Q8DLP5"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLP5"
FT                   /protein_id="BAC07985.1"
FT                   LQRTLIDRSIALLGGK"
FT   CDS_pept        429167..429724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /product="H+-transporting ATP synthase delta chain"
FT                   /note="ORF_ID:tlr0434"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07986"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07986"
FT                   /db_xref="GOA:Q8DLP4"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLP4"
FT                   /protein_id="BAC07986.1"
FT   CDS_pept        429766..431277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /product="H+-transporting ATP synthase alpha chain"
FT                   /note="ORF_ID:tlr0435"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07987"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07987"
FT                   /db_xref="GOA:Q8DLP3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLP3"
FT                   /protein_id="BAC07987.1"
FT   CDS_pept        431501..434032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0436"
FT                   /product="mannose-1-phosphate guanyltransferase"
FT                   /note="ORF_ID:tlr0436"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07988"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07988"
FT                   /db_xref="GOA:Q8DLP2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLP2"
FT                   /protein_id="BAC07988.1"
FT   CDS_pept        434079..436037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0437"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="ORF_ID:tlr0437"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07989"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07989"
FT                   /db_xref="GOA:Q8DLP1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLP1"
FT                   /protein_id="BAC07989.1"
FT                   ALVDNPDGRAETALPPA"
FT   CDS_pept        436201..437949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0438"
FT                   /note="ORF_ID:tlr0438"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07990"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07990"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLP0"
FT                   /protein_id="BAC07990.1"
FT                   SLTVRP"
FT   CDS_pept        complement(437946..438746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /product="tryptophan synthase alpha chain"
FT                   /note="ORF_ID:tll0439"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07991"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07991"
FT                   /db_xref="GOA:Q8DLN9"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLN9"
FT                   /protein_id="BAC07991.1"
FT   CDS_pept        438752..440119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /product="cell division protein"
FT                   /note="ORF_ID:tlr0440"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07992"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07992"
FT                   /db_xref="GOA:Q8DLN8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLN8"
FT                   /protein_id="BAC07992.1"
FT   mobile_element  complement(440384..441224)
FT                   /mobile_element_type="insertion sequence:ISEL2b"
FT   CDS_pept        complement(440394..440600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0441"
FT                   /note="ORF_ID:tsl0441"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07993"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07993"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CM91"
FT                   /protein_id="BAC07993.1"
FT   CDS_pept        complement(440684..441160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0442"
FT                   /note="ORF_ID:tll0442"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07994"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07994"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLZ9"
FT                   /protein_id="BAC07994.1"
FT   CDS_pept        complement(441247..442842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0443"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:tll0443"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07995"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07995"
FT                   /db_xref="GOA:B9A0M9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9A0M9"
FT                   /protein_id="BAC07995.1"
FT                   QHPYTQKLLAAALS"
FT   CDS_pept        complement(442855..443673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbO"
FT                   /product="photosystem II manganese-stabilizing polypeptide"
FT                   /note="ORF_ID:tll0444"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07996"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07996"
FT                   /db_xref="GOA:P0A431"
FT                   /db_xref="InterPro:IPR002628"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="PDB:1S5L"
FT                   /db_xref="PDB:2AXT"
FT                   /db_xref="PDB:3KZI"
FT                   /db_xref="PDB:4FBY"
FT                   /db_xref="PDB:4IXQ"
FT                   /db_xref="PDB:4IXR"
FT                   /db_xref="PDB:4PBU"
FT                   /db_xref="PDB:4PJ0"
FT                   /db_xref="PDB:4RVY"
FT                   /db_xref="PDB:4TNH"
FT                   /db_xref="PDB:4TNI"
FT                   /db_xref="PDB:4TNJ"
FT                   /db_xref="PDB:4TNK"
FT                   /db_xref="PDB:4V62"
FT                   /db_xref="PDB:4V82"
FT                   /db_xref="PDB:5E79"
FT                   /db_xref="PDB:5E7C"
FT                   /db_xref="PDB:5H2F"
FT                   /db_xref="PDB:5KAF"
FT                   /db_xref="PDB:5KAI"
FT                   /db_xref="PDB:5MX2"
FT                   /db_xref="PDB:5TIS"
FT                   /db_xref="PDB:5ZZN"
FT                   /db_xref="PDB:6DHE"
FT                   /db_xref="PDB:6DHF"
FT                   /db_xref="PDB:6DHG"
FT                   /db_xref="PDB:6DHH"
FT                   /db_xref="PDB:6DHO"
FT                   /db_xref="PDB:6DHP"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A431"
FT                   /protein_id="BAC07996.1"
FT   mobile_element  join(444131..444771,445611..445814)
FT                   /mobile_element_type="other:TelI3h"
FT                   /note="groupII intron"
FT   mobile_element  444772..445610
FT                   /mobile_element_type="other:TelI3i"
FT                   /note="groupII intron"
FT   CDS_pept        445894..447441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0445"
FT                   /product="serine/threonine protein kinase"
FT                   /note="ORF_ID:tlr0445"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07997"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07997"
FT                   /db_xref="GOA:Q8DLN7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLN7"
FT                   /protein_id="BAC07997.1"
FT   CDS_pept        447557..447727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0446"
FT                   /product="CAB/ELIP/HLIP superfamily protein"
FT                   /note="ORF_ID:tsr0446"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07998"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07998"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLN6"
FT                   /protein_id="BAC07998.1"
FT                   KQGVLHFWGLL"
FT   CDS_pept        complement(447976..448311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0447"
FT                   /note="ORF_ID:tll0447"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC07999"
FT                   /db_xref="EnsemblGenomes-Tr:BAC07999"
FT                   /db_xref="GOA:Q8DLN5"
FT                   /db_xref="InterPro:IPR018922"
FT                   /db_xref="PDB:6HUM"
FT                   /db_xref="PDB:6NBQ"
FT                   /db_xref="PDB:6NBX"
FT                   /db_xref="PDB:6NBY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLN5"
FT                   /protein_id="BAC07999.1"
FT                   IPRVNHS"
FT   CDS_pept        complement(448945..449208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0448"
FT                   /note="ORF_ID:tsl0448"
FT                   /note="probable two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08000"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08000"
FT                   /db_xref="GOA:Q8DLN4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLN4"
FT                   /protein_id="BAC08000.1"
FT   CDS_pept        449602..450999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0449"
FT                   /product="Na+/H+ antiporter"
FT                   /note="ORF_ID:tlr0449"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08001"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08001"
FT                   /db_xref="GOA:Q8DLN3"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLN3"
FT                   /protein_id="BAC08001.1"
FT                   VESPPEG"
FT   CDS_pept        451002..452375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0450"
FT                   /product="glucose inhibited division protein"
FT                   /note="ORF_ID:tlr0450"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08002"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08002"
FT                   /db_xref="GOA:P59109"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004417"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59109"
FT                   /protein_id="BAC08002.1"
FT   CDS_pept        complement(452733..453449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlM"
FT                   /product="Mg-protoporphyrin IX methyl transferase"
FT                   /note="ORF_ID:tll0451"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08003"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08003"
FT                   /db_xref="GOA:Q8DLN2"
FT                   /db_xref="InterPro:IPR010251"
FT                   /db_xref="InterPro:IPR010940"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLN2"
FT                   /protein_id="BAC08003.1"
FT                   KTRFYFSRLLEAVPAK"
FT   CDS_pept        complement(453458..454372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0452"
FT                   /note="ORF_ID:tll0452"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08004"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08004"
FT                   /db_xref="GOA:Q8DLN1"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLN1"
FT                   /protein_id="BAC08004.1"
FT   CDS_pept        complement(454341..455114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0453"
FT                   /product="cell division ATP-binding protein"
FT                   /note="ORF_ID:tll0453"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08005"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08005"
FT                   /db_xref="GOA:Q8DLN0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLN0"
FT                   /protein_id="BAC08005.1"
FT   CDS_pept        complement(455060..456016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0454"
FT                   /note="ORF_ID:tll0454"
FT                   /note="probable techoic acid biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08006"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08006"
FT                   /db_xref="GOA:Q8DLM9"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLM9"
FT                   /protein_id="BAC08006.1"
FT   CDS_pept        456131..457189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbD2"
FT                   /product="photosystem II reaction center D2 protein"
FT                   /note="ORF_ID:tlr0455"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08007"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08007"
FT                   /db_xref="GOA:Q8CM25"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005868"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="PDB:1S5L"
FT                   /db_xref="PDB:1W5C"
FT                   /db_xref="PDB:2AXT"
FT                   /db_xref="PDB:3KZI"
FT                   /db_xref="PDB:4FBY"
FT                   /db_xref="PDB:4IXQ"
FT                   /db_xref="PDB:4IXR"
FT                   /db_xref="PDB:4PBU"
FT                   /db_xref="PDB:4PJ0"
FT                   /db_xref="PDB:4RVY"
FT                   /db_xref="PDB:4TNH"
FT                   /db_xref="PDB:4TNI"
FT                   /db_xref="PDB:4TNJ"
FT                   /db_xref="PDB:4TNK"
FT                   /db_xref="PDB:4V62"
FT                   /db_xref="PDB:4V82"
FT                   /db_xref="PDB:5E79"
FT                   /db_xref="PDB:5E7C"
FT                   /db_xref="PDB:5H2F"
FT                   /db_xref="PDB:5KAF"
FT                   /db_xref="PDB:5KAI"
FT                   /db_xref="PDB:5MX2"
FT                   /db_xref="PDB:5TIS"
FT                   /db_xref="PDB:5ZZN"
FT                   /db_xref="PDB:6DHE"
FT                   /db_xref="PDB:6DHF"
FT                   /db_xref="PDB:6DHG"
FT                   /db_xref="PDB:6DHH"
FT                   /db_xref="PDB:6DHO"
FT                   /db_xref="PDB:6DHP"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CM25"
FT                   /protein_id="BAC08007.1"
FT                   FPEEVLPRGNAL"
FT   CDS_pept        complement(457250..457798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /note="ORF_ID:tll0456"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08008"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08008"
FT                   /db_xref="GOA:Q8DLM8"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLM8"
FT                   /protein_id="BAC08008.1"
FT   CDS_pept        complement(457767..458777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="ORF_ID:tll0457"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08009"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08009"
FT                   /db_xref="GOA:Q8DLM7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLM7"
FT                   /protein_id="BAC08009.1"
FT   CDS_pept        complement(458675..459754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="ORF_ID:tll0458"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08010"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08010"
FT                   /db_xref="GOA:Q8DLM6"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLM6"
FT                   /protein_id="BAC08010.1"
FT   CDS_pept        459772..460353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0459"
FT                   /product="cytosine deaminase"
FT                   /note="ORF_ID:tlr0459"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08011"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08011"
FT                   /db_xref="GOA:Q8DLM5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLM5"
FT                   /protein_id="BAC08011.1"
FT   CDS_pept        complement(460360..461598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0460"
FT                   /product="alanine racemase"
FT                   /note="ORF_ID:tll0460"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08012"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08012"
FT                   /db_xref="GOA:Q8DLM4"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLM4"
FT                   /protein_id="BAC08012.1"
FT                   CGFKNRLPRIPVS"
FT   CDS_pept        461829..462722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0461"
FT                   /product="glutamate racemase"
FT                   /note="ORF_ID:tlr0461"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08013"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08013"
FT                   /db_xref="GOA:Q8DLM3"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLM3"
FT                   /protein_id="BAC08013.1"
FT                   LGITVPPPKPSAVVAS"
FT   CDS_pept        462659..463522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0462"
FT                   /note="ORF_ID:tlr0462"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08014"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08014"
FT                   /db_xref="GOA:Q8DLM2"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLM2"
FT                   /protein_id="BAC08014.1"
FT                   ALNRSR"
FT   CDS_pept        complement(463519..464610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /product="chorismate synthase"
FT                   /note="ORF_ID:tll0463"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08015"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08015"
FT                   /db_xref="GOA:Q8DLM1"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLM1"
FT                   /protein_id="BAC08015.1"
FT   CDS_pept        complement(464625..464963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0464"
FT                   /note="ORF_ID:tll0464"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08016"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08016"
FT                   /db_xref="GOA:Q8DLM0"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="PDB:1X0G"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLM0"
FT                   /protein_id="BAC08016.1"
FT                   MAFRVSRS"
FT   CDS_pept        complement(464975..465913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0465"
FT                   /note="ORF_ID:tll0465"
FT                   /note="putative sugar nucleotide epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08017"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08017"
FT                   /db_xref="GOA:Q8DLL9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLL9"
FT                   /protein_id="BAC08017.1"
FT   CDS_pept        complement(465931..466407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0466"
FT                   /note="ORF_ID:tll0466"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08018"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08018"
FT                   /db_xref="InterPro:IPR010413"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLL8"
FT                   /protein_id="BAC08018.1"
FT   CDS_pept        complement(466453..467628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0467"
FT                   /product="transaldolase"
FT                   /note="ORF_ID:tll0467"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08019"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08019"
FT                   /db_xref="GOA:Q8DLL7"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLL7"
FT                   /protein_id="BAC08019.1"
FT   mobile_element  complement(467712..469376)
FT                   /mobile_element_type="insertion sequence:ISEL3e"
FT   CDS_pept        complement(467729..468454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0468"
FT                   /note="ORF_ID:tll0468"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08020"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08020"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLL6"
FT                   /protein_id="BAC08020.1"
FT   CDS_pept        complement(468627..468899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0469"
FT                   /note="ORF_ID:tsl0469"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08021"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08021"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CME6"
FT                   /protein_id="BAC08021.1"
FT   CDS_pept        468951..469343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0470"
FT                   /note="ORF_ID:tlr0470"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08022"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08022"
FT                   /db_xref="GOA:Q8CM61"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CM61"
FT                   /protein_id="BAC08022.1"
FT   CDS_pept        complement(469399..469941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0471"
FT                   /note="ORF_ID:tll0471"
FT                   /note="probable acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08023"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08023"
FT                   /db_xref="GOA:Q8DLL5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLL5"
FT                   /protein_id="BAC08023.1"
FT                   HWRSRVEAQGWSLSDRT"
FT   CDS_pept        469940..470380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0472"
FT                   /note="ORF_ID:tlr0472"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08024"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08024"
FT                   /db_xref="InterPro:IPR021374"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLL4"
FT                   /protein_id="BAC08024.1"
FT   CDS_pept        470612..470842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0473"
FT                   /note="ORF_ID:tsr0473"
FT                   /note="probable bacterioferritin comigratory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08025"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08025"
FT                   /db_xref="GOA:Q8DLL3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLL3"
FT                   /protein_id="BAC08025.1"
FT   CDS_pept        470973..471314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0474"
FT                   /note="ORF_ID:tlr0474"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08026"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08026"
FT                   /db_xref="InterPro:IPR010328"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLL2"
FT                   /protein_id="BAC08026.1"
FT                   VKTRDIIYP"
FT   CDS_pept        complement(471279..472316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0475"
FT                   /note="ORF_ID:tll0475"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08027"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08027"
FT                   /db_xref="GOA:Q8DLL1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLL1"
FT                   /protein_id="BAC08027.1"
FT                   TGLDS"
FT   mobile_element  complement(471284..472384)
FT                   /mobile_element_type="insertion sequence:ISEL4d"
FT   CDS_pept        complement(472386..473132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0476"
FT                   /product="type 4 prepilin-like proteins leader peptide
FT                   processing enzyme"
FT                   /note="ORF_ID:tll0476"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08028"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08028"
FT                   /db_xref="GOA:Q8DLL0"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLL0"
FT                   /protein_id="BAC08028.1"
FT   CDS_pept        complement(473183..473428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0477"
FT                   /note="ORF_ID:tsl0477"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08029"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08029"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLK9"
FT                   /protein_id="BAC08029.1"
FT   CDS_pept        complement(473625..474308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0478"
FT                   /note="ORF_ID:tll0478"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08030"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08030"
FT                   /db_xref="GOA:Q8CM10"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CM10"
FT                   /protein_id="BAC08030.1"
FT                   TGLDT"
FT   mobile_element  complement(473630..474376)
FT                   /mobile_element_type="insertion sequence:ISEL4e"
FT   CDS_pept        474723..475958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /product="glutamate-1-semialdehyde aminomutase"
FT                   /note="ORF_ID:tlr0479"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08031"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08031"
FT                   /db_xref="GOA:Q8DLK8"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PDB:2CFB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLK8"
FT                   /protein_id="BAC08031.1"
FT                   TIAAARTVLSQL"
FT   CDS_pept        complement(475949..478081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0480"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="ORF_ID:tll0480"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08032"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08032"
FT                   /db_xref="GOA:Q8DLK7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLK7"
FT                   /protein_id="BAC08032.1"
FT                   DLMDVVLLAATVKAQS"
FT   CDS_pept        478298..479149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kaiA"
FT                   /note="ORF_ID:tlr0481"
FT                   /note="circadian clock protein KaiA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08033"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08033"
FT                   /db_xref="GOA:Q79V62"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011648"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR020844"
FT                   /db_xref="InterPro:IPR020856"
FT                   /db_xref="PDB:1Q6A"
FT                   /db_xref="PDB:1Q6B"
FT                   /db_xref="PDB:1SUY"
FT                   /db_xref="PDB:1SV1"
FT                   /db_xref="PDB:1V2Z"
FT                   /db_xref="PDB:5JWR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q79V62"
FT                   /protein_id="BAC08033.1"
FT                   EV"
FT   CDS_pept        479155..479481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kaiB"
FT                   /note="ORF_ID:tlr0482"
FT                   /note="circadian clock protein KaiB homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08034"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08034"
FT                   /db_xref="GOA:Q79V61"
FT                   /db_xref="InterPro:IPR011649"
FT                   /db_xref="InterPro:IPR013474"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039022"
FT                   /db_xref="PDB:1VGL"
FT                   /db_xref="PDB:2QKE"
FT                   /db_xref="PDB:5JWO"
FT                   /db_xref="PDB:5JWQ"
FT                   /db_xref="PDB:5JWR"
FT                   /db_xref="PDB:5JYT"
FT                   /db_xref="PDB:5JYV"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q79V61"
FT                   /protein_id="BAC08034.1"
FT                   LGLE"
FT   CDS_pept        479557..481113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kaiC"
FT                   /note="ORF_ID:tlr0483"
FT                   /note="circadian clock protein KaiC homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08035"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08035"
FT                   /db_xref="GOA:Q79V60"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR013503"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="PDB:1SUY"
FT                   /db_xref="PDB:1SV1"
FT                   /db_xref="PDB:4O0M"
FT                   /db_xref="PDB:5JWO"
FT                   /db_xref="PDB:5JWQ"
FT                   /db_xref="PDB:5JWR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q79V60"
FT                   /protein_id="BAC08035.1"
FT                   E"
FT   CDS_pept        481118..482038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0484"
FT                   /note="ORF_ID:tlr0484"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08036"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08036"
FT                   /db_xref="GOA:Q8RR32"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RR32"
FT                   /protein_id="BAC08036.1"
FT   CDS_pept        482099..483712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0485"
FT                   /note="ORF_ID:tlr0485"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08037"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08037"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLK6"
FT                   /protein_id="BAC08037.1"
FT   CDS_pept        complement(483709..484305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0486"
FT                   /note="ORF_ID:tll0486"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08038"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08038"
FT                   /db_xref="GOA:Q8DLK5"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLK5"
FT                   /protein_id="BAC08038.1"
FT   CDS_pept        complement(484310..484636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0487"
FT                   /product="ferredoxin"
FT                   /note="ORF_ID:tll0487"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08039"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08039"
FT                   /db_xref="GOA:Q8DLK4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLK4"
FT                   /protein_id="BAC08039.1"
FT                   FQKA"
FT   CDS_pept        complement(484679..485119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf83"
FT                   /note="ORF_ID:tll0488"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08040"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08040"
FT                   /db_xref="GOA:Q8DLK3"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR022829"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLK3"
FT                   /protein_id="BAC08040.1"
FT   CDS_pept        485244..486293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0489"
FT                   /product="WD-40 repeat protein"
FT                   /note="ORF_ID:tlr0489"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08041"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08041"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLK2"
FT                   /protein_id="BAC08041.1"
FT                   VWRLFPETP"
FT   CDS_pept        complement(486379..487815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf24"
FT                   /product="ABC transporter subunit"
FT                   /note="ORF_ID:tll0490"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08042"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08042"
FT                   /db_xref="GOA:Q8DLK1"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLK1"
FT                   /protein_id="BAC08042.1"
FT   CDS_pept        487948..488607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0491"
FT                   /product="transcriptional regulator"
FT                   /note="ORF_ID:tlr0491"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08043"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08043"
FT                   /db_xref="GOA:Q8DLK0"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014075"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLK0"
FT                   /protein_id="BAC08043.1"
FT   CDS_pept        488609..489487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0492"
FT                   /note="ORF_ID:tlr0492"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08044"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08044"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLJ9"
FT                   /protein_id="BAC08044.1"
FT                   MIYSLRRDFLV"
FT   CDS_pept        489529..489879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbW"
FT                   /product="photosystem II reaction center W protein"
FT                   /note="ORF_ID:tlr0493"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08045"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08045"
FT                   /db_xref="GOA:Q8DLJ8"
FT                   /db_xref="InterPro:IPR005610"
FT                   /db_xref="InterPro:IPR038676"
FT                   /db_xref="PDB:3ZPN"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLJ8"
FT                   /protein_id="BAC08045.1"
FT                   SHGLGFQKSENS"
FT   CDS_pept        490196..490630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /note="ORF_ID:tlr0494"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08046"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08046"
FT                   /db_xref="GOA:Q8DLJ7"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLJ7"
FT                   /protein_id="BAC08046.1"
FT   CDS_pept        complement(490620..491159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0495"
FT                   /note="ORF_ID:tll0495"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08047"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08047"
FT                   /db_xref="GOA:Q8DLJ6"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLJ6"
FT                   /protein_id="BAC08047.1"
FT                   ARQLGTPLAIAPPAKN"
FT   CDS_pept        491303..491800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0496"
FT                   /note="ORF_ID:tlr0496"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08048"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08048"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLJ5"
FT                   /protein_id="BAC08048.1"
FT                   GA"
FT   CDS_pept        491984..492694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0497"
FT                   /note="ORF_ID:tlr0497"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08049"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08049"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLJ4"
FT                   /protein_id="BAC08049.1"
FT                   NLPQLEQLAQQGLN"
FT   CDS_pept        492763..493347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0498"
FT                   /note="ORF_ID:tlr0498"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08050"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08050"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLJ3"
FT                   /protein_id="BAC08050.1"
FT   CDS_pept        493445..494572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigC"
FT                   /product="group 2 RNA polymerase sigma factor"
FT                   /note="ORF_ID:tlr0499"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08051"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08051"
FT                   /db_xref="GOA:Q8DLJ2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLJ2"
FT                   /protein_id="BAC08051.1"
FT   CDS_pept        complement(494569..495504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0500"
FT                   /product="isopentenyl monophosphate kinase"
FT                   /note="ORF_ID:tll0500"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08052"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08052"
FT                   /db_xref="GOA:Q8DLJ1"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLJ1"
FT                   /protein_id="BAC08052.1"
FT   CDS_pept        495588..496442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0501"
FT                   /product="zinc ABC transporter, permease protein"
FT                   /note="ORF_ID:tlr0501"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08053"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08053"
FT                   /db_xref="GOA:Q8DLJ0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLJ0"
FT                   /protein_id="BAC08053.1"
FT                   PTS"
FT   CDS_pept        complement(496387..497448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0502"
FT                   /product="glycoprotein endopeptidase"
FT                   /note="ORF_ID:tll0502"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08054"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08054"
FT                   /db_xref="GOA:Q8DLI9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLI9"
FT                   /protein_id="BAC08054.1"
FT                   ISALYGPTPLAVS"
FT   CDS_pept        497664..498101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0503"
FT                   /note="ORF_ID:tlr0503"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08055"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08055"
FT                   /db_xref="GOA:Q8DLI8"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLI8"
FT                   /protein_id="BAC08055.1"
FT   CDS_pept        498165..499130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /product="cysteine synthase"
FT                   /note="ORF_ID:tlr0504"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08056"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08056"
FT                   /db_xref="GOA:Q8DLI7"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLI7"
FT                   /protein_id="BAC08056.1"
FT   CDS_pept        499243..499824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0505"
FT                   /note="ORF_ID:tlr0505"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08057"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08057"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLI6"
FT                   /protein_id="BAC08057.1"
FT   CDS_pept        complement(499821..501278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="ORF_ID:tll0506"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08058"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08058"
FT                   /db_xref="GOA:Q8DLI5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="PDB:2CFO"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLI5"
FT                   /protein_id="BAC08058.1"
FT   CDS_pept        complement(501337..503436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0507"
FT                   /note="ORF_ID:tll0507"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08059"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08059"
FT                   /db_xref="InterPro:IPR005239"
FT                   /db_xref="InterPro:IPR007545"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLI4"
FT                   /protein_id="BAC08059.1"
FT                   PYTLA"
FT   CDS_pept        503725..505146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0508"
FT                   /product="trigger factor"
FT                   /note="ORF_ID:tlr0508"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08060"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08060"
FT                   /db_xref="GOA:Q8DLI3"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLI3"
FT                   /protein_id="BAC08060.1"
FT                   QKRSGKKASSAPSQE"
FT   CDS_pept        505242..505931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP1"
FT                   /product="ATP-dependent Clp protease proteolytic subunit 1"
FT                   /note="ORF_ID:tlr0509"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08061"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08061"
FT                   /db_xref="GOA:Q8DLI2"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLI2"
FT                   /protein_id="BAC08061.1"
FT                   RQTLLSP"
FT   CDS_pept        505964..507286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /product="ATP-dependent protease ATPase subunit"
FT                   /note="ORF_ID:tlr0510"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08062"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08062"
FT                   /db_xref="GOA:Q8DLI1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLI1"
FT                   /protein_id="BAC08062.1"
FT   CDS_pept        complement(507304..508023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0511"
FT                   /note="ORF_ID:tll0511"
FT                   /note="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08063"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08063"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLI0"
FT                   /protein_id="BAC08063.1"
FT                   HAVPLELSLMPESHVFF"
FT   mobile_element  complement(508183..509509)
FT                   /mobile_element_type="insertion sequence:ISEL1f"
FT   CDS_pept        complement(508223..509395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0512"
FT                   /note="ORF_ID:tll0512"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08064"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08064"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CME0"
FT                   /protein_id="BAC08064.1"
FT   CDS_pept        complement(509534..510601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0513"
FT                   /product="iron binding protein component of ABC iron
FT                   transporter"
FT                   /note="ORF_ID:tll0513"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08065"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08065"
FT                   /db_xref="GOA:Q8DLH9"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLH9"
FT                   /protein_id="BAC08065.1"
FT                   NNAEALRIMDRAGWR"
FT   CDS_pept        complement(510682..511014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0514"
FT                   /note="ORF_ID:tll0514"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08066"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08066"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLH8"
FT                   /protein_id="BAC08066.1"
FT                   WWYGKS"
FT   CDS_pept        complement(511083..511415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0515"
FT                   /note="ORF_ID:tll0515"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08067"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08067"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLH7"
FT                   /protein_id="BAC08067.1"
FT                   IAAQEP"
FT   CDS_pept        511807..513327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0516"
FT                   /product="pyruvate kinase"
FT                   /note="ORF_ID:tlr0516"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08068"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08068"
FT                   /db_xref="GOA:Q8DLH6"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLH6"
FT                   /protein_id="BAC08068.1"
FT   CDS_pept        complement(513324..514577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0517"
FT                   /note="ORF_ID:tll0517"
FT                   /note="probable RND efflux membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08069"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08069"
FT                   /db_xref="GOA:Q8DLH5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLH5"
FT                   /protein_id="BAC08069.1"
FT                   SRPLRDGDKIRPSIFSEG"
FT   CDS_pept        complement(514603..515538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /product="DNA polymerase III delta prime subunit"
FT                   /note="ORF_ID:tll0518"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08070"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08070"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLH4"
FT                   /protein_id="BAC08070.1"
FT   CDS_pept        complement(515535..518258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0519"
FT                   /note="ORF_ID:tll0519"
FT                   /note="similar to polyA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08071"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08071"
FT                   /db_xref="GOA:Q8DLH3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLH3"
FT                   /protein_id="BAC08071.1"
FT   CDS_pept        complement(518350..518844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0520"
FT                   /note="ORF_ID:tll0520"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08072"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08072"
FT                   /db_xref="GOA:Q8DLH2"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLH2"
FT                   /protein_id="BAC08072.1"
FT                   Y"
FT   CDS_pept        complement(518913..519461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0521"
FT                   /note="ORF_ID:tll0521"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08073"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08073"
FT                   /db_xref="GOA:Q8DLH1"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLH1"
FT                   /protein_id="BAC08073.1"
FT   mobile_element  join(519483..520110,520950..522705)
FT                   /mobile_element_type="other:TelI4c"
FT                   /note="groupII intron"
FT   mobile_element  520111..520949
FT                   /mobile_element_type="other:TelI3c"
FT                   /note="groupII intron"
FT   CDS_pept        520930..522624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0522"
FT                   /product="reverse transcriptase"
FT                   /note="ORF_ID:tlr0522"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08074"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08074"
FT                   /db_xref="GOA:Q8CM00"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CM00"
FT                   /protein_id="BAC08074.1"
FT   CDS_pept        complement(522781..523812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0523"
FT                   /product="D-alanine:D-alanine ligase"
FT                   /note="ORF_ID:tll0523"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08075"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08075"
FT                   /db_xref="GOA:Q8DLH0"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLH0"
FT                   /protein_id="BAC08075.1"
FT                   WHA"
FT   CDS_pept        523885..524079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0524"
FT                   /note="ORF_ID:tsr0524"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08076"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08076"
FT                   /db_xref="InterPro:IPR021291"
FT                   /db_xref="PDB:2N5U"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLG9"
FT                   /protein_id="BAC08076.1"
FT   CDS_pept        524306..525754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /product="ATP synthase beta subunit"
FT                   /note="ORF_ID:tlr0525"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08077"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08077"
FT                   /db_xref="GOA:Q8DLG8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLG8"
FT                   /protein_id="BAC08077.1"
FT   CDS_pept        525822..526238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /product="ATP synthase epsilon subunit"
FT                   /note="ORF_ID:tlr0526"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08078"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08078"
FT                   /db_xref="GOA:Q8DLG7"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="PDB:2RQ6"
FT                   /db_xref="PDB:2RQ7"
FT                   /db_xref="PDB:5ZWL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLG7"
FT                   /protein_id="BAC08078.1"
FT   CDS_pept        complement(526308..527180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /product="peptide chain release factor 2"
FT                   /note="ORF_ID:tll0527"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08079"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08079"
FT                   /db_xref="GOA:Q8DLG6"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLG6"
FT                   /protein_id="BAC08079.1"
FT                   YLRQQTAAS"
FT   CDS_pept        527625..529484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /product="cell division protein"
FT                   /note="ORF_ID:tlr0528"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08080"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08080"
FT                   /db_xref="GOA:Q8DLG5"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLG5"
FT                   /protein_id="BAC08080.1"
FT   CDS_pept        complement(529722..531188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /note="ORF_ID:tll0529"
FT                   /note="putative modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08081"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08081"
FT                   /db_xref="GOA:Q8DLG4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLG4"
FT                   /protein_id="BAC08081.1"
FT   CDS_pept        complement(531240..531545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl25"
FT                   /product="50S ribosomal protein L25"
FT                   /note="ORF_ID:tll0530"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08082"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08082"
FT                   /db_xref="GOA:Q8DLG3"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLG3"
FT                   /protein_id="BAC08082.1"
FT   CDS_pept        complement(531560..532903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /product="adenylosuccinate synthetase"
FT                   /note="ORF_ID:tll0531"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08083"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08083"
FT                   /db_xref="GOA:Q8DLG2"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLG2"
FT                   /protein_id="BAC08083.1"
FT   tRNA            533046..533117
FT                   /product="trnT-CGU"
FT   CDS_pept        533159..533791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /product="Holliday junction DNA helicase"
FT                   /note="ORF_ID:tlr0532"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08084"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08084"
FT                   /db_xref="GOA:Q8DLG1"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLG1"
FT                   /protein_id="BAC08084.1"
FT   CDS_pept        complement(533879..534691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0533"
FT                   /note="ORF_ID:tll0533"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08085"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08085"
FT                   /db_xref="GOA:Q8DLG0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLG0"
FT                   /protein_id="BAC08085.1"
FT   CDS_pept        534984..535274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf19"
FT                   /note="ORF_ID:tsr0534"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08086"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08086"
FT                   /db_xref="GOA:Q8DLF9"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLF9"
FT                   /protein_id="BAC08086.1"
FT   CDS_pept        535306..537219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0535"
FT                   /product="glucose inhibited division protein"
FT                   /note="ORF_ID:tlr0535"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08087"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08087"
FT                   /db_xref="GOA:Q8DLF8"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLF8"
FT                   /protein_id="BAC08087.1"
FT                   GG"
FT   CDS_pept        537226..538050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureD"
FT                   /product="urease accessory protein D"
FT                   /note="ORF_ID:tlr0536"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08088"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08088"
FT                   /db_xref="GOA:Q8DLF7"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLF7"
FT                   /protein_id="BAC08088.1"
FT   CDS_pept        538038..538892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0537"
FT                   /note="ORF_ID:tlr0537"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08089"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08089"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLF6"
FT                   /protein_id="BAC08089.1"
FT                   ACS"
FT   CDS_pept        complement(538856..541105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0538"
FT                   /note="ORF_ID:tll0538"
FT                   /note="putative potassium/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08090"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08090"
FT                   /db_xref="GOA:Q8DLF5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLF5"
FT                   /protein_id="BAC08090.1"
FT   CDS_pept        complement(541117..542463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opcA"
FT                   /note="ORF_ID:tll0539"
FT                   /note="putative OxPPCycle protein OpcA"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08091"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08091"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR004555"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLF4"
FT                   /protein_id="BAC08091.1"
FT   CDS_pept        complement(542533..544062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /product="glucose 6-phosphate dehydrogenase"
FT                   /note="ORF_ID:tll0540"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08092"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08092"
FT                   /db_xref="GOA:Q8DLF3"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLF3"
FT                   /protein_id="BAC08092.1"
FT   CDS_pept        complement(544066..545112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbpII"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /note="ORF_ID:tll0541"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08093"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08093"
FT                   /db_xref="GOA:Q8DLF2"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLF2"
FT                   /protein_id="BAC08093.1"
FT                   AQPTVTQV"
FT   CDS_pept        complement(545190..545483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0542"
FT                   /note="ORF_ID:tsl0542"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08094"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08094"
FT                   /db_xref="GOA:Q8DLF1"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLF1"
FT                   /protein_id="BAC08094.1"
FT   CDS_pept        complement(545470..545658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0543"
FT                   /note="ORF_ID:tsl0543"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08095"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08095"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLF0"
FT                   /protein_id="BAC08095.1"
FT                   RPEVSHDPQGHPYSGSE"
FT   mobile_element  complement(545998..546838)
FT                   /mobile_element_type="insertion sequence:ISEL2c"
FT   CDS_pept        complement(546008..546214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0544"
FT                   /note="ORF_ID:tsl0544"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08096"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08096"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CM91"
FT                   /protein_id="BAC08096.1"
FT   CDS_pept        complement(546298..546774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0545"
FT                   /note="ORF_ID:tll0545"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08097"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08097"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CLZ9"
FT                   /protein_id="BAC08097.1"
FT   CDS_pept        complement(546816..547049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0546"
FT                   /note="ORF_ID:tsl0546"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08098"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08098"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLE9"
FT                   /protein_id="BAC08098.1"
FT   CDS_pept        547271..547879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0547"
FT                   /note="ORF_ID:tlr0547"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08099"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08099"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLE8"
FT                   /protein_id="BAC08099.1"
FT   CDS_pept        547922..549169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0548"
FT                   /note="ORF_ID:tlr0548"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08100"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08100"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLE7"
FT                   /protein_id="BAC08100.1"
FT                   AREKGDPWCEFYAQRL"
FT   CDS_pept        549184..549480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0549"
FT                   /note="ORF_ID:tsr0549"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08101"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08101"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLE6"
FT                   /protein_id="BAC08101.1"
FT   CDS_pept        549489..550433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0550"
FT                   /product="branched-chain amino acid ABC transporter
FT                   permease protein"
FT                   /note="ORF_ID:tlr0550"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08102"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08102"
FT                   /db_xref="GOA:Q8DLE5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLE5"
FT                   /protein_id="BAC08102.1"
FT   CDS_pept        550474..550911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0551"
FT                   /product="sigma-B activity negative regulator"
FT                   /note="ORF_ID:tlr0551"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08103"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08103"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLE4"
FT                   /protein_id="BAC08103.1"
FT   CDS_pept        complement(550914..551744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0552"
FT                   /note="ORF_ID:tll0552"
FT                   /note="similar to deoxyribodipyrimidine photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08104"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08104"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLE3"
FT                   /protein_id="BAC08104.1"
FT   CDS_pept        complement(551746..552549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0553"
FT                   /product="circadian oscillation regulator"
FT                   /note="ORF_ID:tll0553"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08105"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08105"
FT                   /db_xref="GOA:Q8DLE2"
FT                   /db_xref="InterPro:IPR011649"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039022"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLE2"
FT                   /protein_id="BAC08105.1"
FT   CDS_pept        complement(552479..553819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /product="twitching mobility protein"
FT                   /note="ORF_ID:tll0554"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08106"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08106"
FT                   /db_xref="GOA:Q8DLE1"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLE1"
FT                   /protein_id="BAC08106.1"
FT   CDS_pept        complement(553903..554886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0555"
FT                   /note="ORF_ID:tll0555"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08107"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08107"
FT                   /db_xref="GOA:Q8DLE0"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLE0"
FT                   /protein_id="BAC08107.1"
FT   CDS_pept        554923..555318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0556"
FT                   /note="ORF_ID:tlr0556"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08108"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08108"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLD9"
FT                   /protein_id="BAC08108.1"
FT   CDS_pept        555400..555633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0557"
FT                   /note="ORF_ID:tsr0557"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08109"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08109"
FT                   /db_xref="GOA:Q8DLD8"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLD8"
FT                   /protein_id="BAC08109.1"
FT   CDS_pept        555777..556091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0558"
FT                   /note="ORF_ID:tlr0558"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08110"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08110"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLD7"
FT                   /protein_id="BAC08110.1"
FT                   "
FT   CDS_pept        complement(556088..557902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0559"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:tll0559"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08111"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08111"
FT                   /db_xref="GOA:Q8DLD6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLD6"
FT                   /protein_id="BAC08111.1"
FT   CDS_pept        558350..559954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0560"
FT                   /note="ORF_ID:tlr0560"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08112"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08112"
FT                   /db_xref="GOA:Q8DLD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLD5"
FT                   /protein_id="BAC08112.1"
FT                   EKCQGLIEVKQGRFYAR"
FT   CDS_pept        complement(559966..560532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0561"
FT                   /note="ORF_ID:tll0561"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08113"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08113"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLD4"
FT                   /protein_id="BAC08113.1"
FT   CDS_pept        complement(560545..561162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0562"
FT                   /note="ORF_ID:tll0562"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08114"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08114"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLD3"
FT                   /protein_id="BAC08114.1"
FT   CDS_pept        561243..562028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobM"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /note="ORF_ID:tlr0563"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08115"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08115"
FT                   /db_xref="GOA:Q8DLD2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLD2"
FT                   /protein_id="BAC08115.1"
FT   CDS_pept        562071..562343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0564"
FT                   /note="ORF_ID:tsr0564"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08116"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08116"
FT                   /db_xref="GOA:Q8DLD1"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLD1"
FT                   /protein_id="BAC08116.1"
FT   CDS_pept        complement(562518..563270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0565"
FT                   /product="histone deacetylase family protein"
FT                   /note="ORF_ID:tll0565"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08117"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08117"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLD0"
FT                   /protein_id="BAC08117.1"
FT   CDS_pept        complement(563288..564325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0566"
FT                   /note="ORF_ID:tll0566"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08118"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08118"
FT                   /db_xref="GOA:Q8CMI8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CMI8"
FT                   /protein_id="BAC08118.1"
FT                   TGLDS"
FT   mobile_element  complement(563293..564393)
FT                   /mobile_element_type="insertion sequence:ISEL4f"
FT   CDS_pept        complement(565255..565752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0567"
FT                   /note="ORF_ID:tll0567"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08119"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08119"
FT                   /db_xref="GOA:Q8DLC9"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLC9"
FT                   /protein_id="BAC08119.1"
FT                   TR"
FT   CDS_pept        complement(565745..568537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0568"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /note="ORF_ID:tll0568"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08120"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08120"
FT                   /db_xref="GOA:Q8DLC8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLC8"
FT                   /protein_id="BAC08120.1"
FT                   "
FT   CDS_pept        complement(568540..571362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0569"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="ORF_ID:tll0569"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08121"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08121"
FT                   /db_xref="GOA:Q8DLC7"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="PDB:2M7U"
FT                   /db_xref="PDB:2M7V"
FT                   /db_xref="PDB:3VV4"
FT                   /db_xref="PDB:4FOF"
FT                   /db_xref="PDB:4GLQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLC7"
FT                   /protein_id="BAC08121.1"
FT                   VNIFKVTAEG"
FT   CDS_pept        complement(571387..571905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0570"
FT                   /note="ORF_ID:tll0570"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08122"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08122"
FT                   /db_xref="GOA:Q8DLC6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLC6"
FT                   /protein_id="BAC08122.1"
FT                   SSVLTVDVG"
FT   CDS_pept        complement(571908..572270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0571"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:tll0571"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08123"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08123"
FT                   /db_xref="GOA:Q8DLC5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLC5"
FT                   /protein_id="BAC08123.1"
FT                   PFSREDLVRALKSVVV"
FT   CDS_pept        complement(572337..573644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0572"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:tll0572"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08124"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08124"
FT                   /db_xref="GOA:Q8DLC4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024186"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLC4"
FT                   /protein_id="BAC08124.1"
FT   CDS_pept        complement(573844..575634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0573"
FT                   /note="ORF_ID:tll0573"
FT                   /note="probable porin; major outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08125"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08125"
FT                   /db_xref="GOA:Q8DLC3"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLC3"
FT                   /protein_id="BAC08125.1"
FT   CDS_pept        complement(575809..576681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0574"
FT                   /product="lipoic acid synthetase"
FT                   /note="ORF_ID:tll0574"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08126"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08126"
FT                   /db_xref="GOA:Q8DLC2"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="PDB:4U0O"
FT                   /db_xref="PDB:4U0P"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLC2"
FT                   /protein_id="BAC08126.1"
FT                   SSYHAAEGG"
FT   CDS_pept        576854..577822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="por"
FT                   /product="light-dependent NADPH-protochlorophyllide
FT                   oxidoreductase"
FT                   /note="ORF_ID:tlr0575"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08127"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08127"
FT                   /db_xref="GOA:Q8DLC1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR005979"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLC1"
FT                   /protein_id="BAC08127.1"
FT   CDS_pept        577902..579344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0576"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /note="ORF_ID:tlr0576"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08128"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08128"
FT                   /db_xref="GOA:Q8DLC0"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLC0"
FT                   /protein_id="BAC08128.1"
FT   CDS_pept        579381..581231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0577"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:tlr0577"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08129"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08129"
FT                   /db_xref="GOA:Q8DLB9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLB9"
FT                   /protein_id="BAC08129.1"
FT   CDS_pept        complement(581243..583543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="ORF_ID:tll0578"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08130"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08130"
FT                   /db_xref="GOA:Q8DLB8"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLB8"
FT                   /protein_id="BAC08130.1"
FT                   KTVAERARYNLQS"
FT   CDS_pept        complement(583627..584721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /note="ORF_ID:tll0579"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08131"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08131"
FT                   /db_xref="GOA:Q8DLB7"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLB7"
FT                   /protein_id="BAC08131.1"
FT   CDS_pept        complement(584772..585338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0580"
FT                   /note="ORF_ID:tll0580"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08132"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08132"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLB6"
FT                   /protein_id="BAC08132.1"
FT   CDS_pept        complement(585457..586143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0581"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:tll0581"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08133"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08133"
FT                   /db_xref="GOA:Q8DLB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLB5"
FT                   /protein_id="BAC08133.1"
FT                   IPLLHA"
FT   CDS_pept        586207..588357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sps"
FT                   /product="sucrose phosphate synthase"
FT                   /note="ORF_ID:tlr0582"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08134"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08134"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR012821"
FT                   /db_xref="InterPro:IPR012822"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLB4"
FT                   /protein_id="BAC08134.1"
FT   CDS_pept        complement(588397..590436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0583"
FT                   /note="ORF_ID:tll0583"
FT                   /note="probable phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08135"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08135"
FT                   /db_xref="GOA:Q8DLB3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLB3"
FT                   /protein_id="BAC08135.1"
FT   CDS_pept        complement(590511..592769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0584"
FT                   /product="GTP pyrophosphokinase"
FT                   /note="ORF_ID:tll0584"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08136"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08136"
FT                   /db_xref="GOA:Q8DLB2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLB2"
FT                   /protein_id="BAC08136.1"
FT   CDS_pept        592940..593635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0585"
FT                   /note="ORF_ID:tlr0585"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08137"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08137"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLB1"
FT                   /protein_id="BAC08137.1"
FT                   EITAVADKR"
FT   CDS_pept        complement(593610..594101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic chain"
FT                   /note="ORF_ID:tll0586"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08138"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08138"
FT                   /db_xref="GOA:Q8DLB0"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLB0"
FT                   /protein_id="BAC08138.1"
FT                   "
FT   CDS_pept        594073..595143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0587"
FT                   /note="ORF_ID:tlr0587"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08139"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08139"
FT                   /db_xref="GOA:Q8DLA9"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLA9"
FT                   /protein_id="BAC08139.1"
FT                   QWRRNAQAVLSSNPYD"
FT   CDS_pept        595163..596086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0588"
FT                   /note="ORF_ID:tlr0588"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08140"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08140"
FT                   /db_xref="GOA:Q8DLA8"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLA8"
FT                   /protein_id="BAC08140.1"
FT   CDS_pept        596142..596912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0589"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:tlr0589"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08141"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08141"
FT                   /db_xref="GOA:Q8DLA7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLA7"
FT                   /protein_id="BAC08141.1"
FT   CDS_pept        complement(597089..597949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="ORF_ID:tll0590"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08142"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08142"
FT                   /db_xref="GOA:Q8DLA6"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLA6"
FT                   /protein_id="BAC08142.1"
FT                   LGTEK"
FT   CDS_pept        complement(597956..598294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="ORF_ID:tll0591"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08143"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08143"
FT                   /db_xref="GOA:Q8DLA5"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLA5"
FT                   /protein_id="BAC08143.1"
FT                   SEKDHEAV"
FT   CDS_pept        598451..599200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0592"
FT                   /product="ribonuclease PH"
FT                   /note="ORF_ID:tlr0592"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08144"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08144"
FT                   /db_xref="GOA:Q8DLA4"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DLA4"
FT                   /protein_id="BAC08144.1"
FT   CDS_pept        599193..599804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0593"
FT                   /note="ORF_ID:tlr0593"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08145"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08145"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLA3"
FT                   /protein_id="BAC08145.1"
FT   CDS_pept        599976..601505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0594"
FT                   /note="ORF_ID:tlr0594"
FT                   /note="competence protein ComM homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08146"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08146"
FT                   /db_xref="GOA:Q8DLA2"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLA2"
FT                   /protein_id="BAC08146.1"
FT   CDS_pept        601438..602748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0595"
FT                   /note="ORF_ID:tlr0595"
FT                   /note="probable sugar transporter sugar binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08147"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08147"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLA1"
FT                   /protein_id="BAC08147.1"
FT   CDS_pept        complement(602745..603755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0596"
FT                   /note="ORF_ID:tll0596"
FT                   /note="probable heme d1 biosynthesis protein NirJ"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08148"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08148"
FT                   /db_xref="GOA:Q8DLA0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017833"
FT                   /db_xref="InterPro:IPR022563"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DLA0"
FT                   /protein_id="BAC08148.1"
FT   CDS_pept        604291..606297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rne"
FT                   /product="ribonuclease E"
FT                   /note="ORF_ID:tlr0597"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08149"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08149"
FT                   /db_xref="GOA:Q8DL99"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL99"
FT                   /protein_id="BAC08149.1"
FT   CDS_pept        606306..607190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0598"
FT                   /note="ORF_ID:tlr0598"
FT                   /note="putative glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08150"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08150"
FT                   /db_xref="GOA:Q8DL98"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL98"
FT                   /protein_id="BAC08150.1"
FT                   QRISRHLGLSPLG"
FT   CDS_pept        complement(607137..607673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0599"
FT                   /note="ORF_ID:tll0599"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08151"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08151"
FT                   /db_xref="GOA:Q8DL97"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL97"
FT                   /protein_id="BAC08151.1"
FT                   QGTEAEVTADALEQV"
FT   CDS_pept        complement(607682..608887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0600"
FT                   /note="ORF_ID:tll0600"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08152"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08152"
FT                   /db_xref="GOA:Q8DL96"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL96"
FT                   /protein_id="BAC08152.1"
FT                   SS"
FT   CDS_pept        complement(608935..609672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0601"
FT                   /note="ORF_ID:tll0601"
FT                   /note="probable ribonuclease P"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08153"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08153"
FT                   /db_xref="GOA:Q8DL95"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL95"
FT                   /protein_id="BAC08153.1"
FT   CDS_pept        complement(609672..609809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl34"
FT                   /product="50S ribosomal protein L34"
FT                   /note="ORF_ID:tsl0602"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08154"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08154"
FT                   /db_xref="GOA:Q8DL94"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL94"
FT                   /protein_id="BAC08154.1"
FT                   "
FT   CDS_pept        609990..611351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /product="chromosomal replication initiator protein"
FT                   /note="ORF_ID:tlr0603"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08155"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08155"
FT                   /db_xref="GOA:Q8DL93"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL93"
FT                   /protein_id="BAC08155.1"
FT   mobile_element  complement(611376..612702)
FT                   /mobile_element_type="insertion sequence:ISEL1g"
FT   CDS_pept        complement(611416..612588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0604"
FT                   /note="ORF_ID:tll0604"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08156"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08156"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL92"
FT                   /protein_id="BAC08156.1"
FT   CDS_pept        612703..613407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0605"
FT                   /product="4-Diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /note="ORF_ID:tlr0605"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08157"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08157"
FT                   /db_xref="GOA:Q8DL91"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL91"
FT                   /protein_id="BAC08157.1"
FT                   QHRREQEQDTLG"
FT   CDS_pept        complement(613399..613788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0606"
FT                   /note="ORF_ID:tll0606"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08158"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08158"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL90"
FT                   /protein_id="BAC08158.1"
FT   CDS_pept        complement(613888..615126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0607"
FT                   /note="ORF_ID:tll0607"
FT                   /note="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08159"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08159"
FT                   /db_xref="GOA:Q8DL89"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL89"
FT                   /protein_id="BAC08159.1"
FT                   LLSGTPRQRLSQS"
FT   CDS_pept        615521..615688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0608"
FT                   /note="ORF_ID:tsr0608"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08160"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08160"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL88"
FT                   /protein_id="BAC08160.1"
FT                   NPRLNIPHLN"
FT   CDS_pept        615743..616126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0609"
FT                   /note="ORF_ID:tlr0609"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08161"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08161"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL87"
FT                   /protein_id="BAC08161.1"
FT   CDS_pept        616378..617076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0610"
FT                   /note="ORF_ID:tlr0610"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08162"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08162"
FT                   /db_xref="GOA:Q8DL86"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL86"
FT                   /protein_id="BAC08162.1"
FT                   LYHGRVYALD"
FT   CDS_pept        617148..618293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0611"
FT                   /product="mannose-1-phosphate guanyltransferase"
FT                   /note="ORF_ID:tlr0611"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08163"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08163"
FT                   /db_xref="GOA:Q8DL85"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037538"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL85"
FT                   /protein_id="BAC08163.1"
FT   CDS_pept        618310..619314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0612"
FT                   /note="ORF_ID:tlr0612"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08164"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08164"
FT                   /db_xref="GOA:Q8DL84"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL84"
FT                   /protein_id="BAC08164.1"
FT   CDS_pept        619305..620213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0613"
FT                   /product="lipoic acid synthetase"
FT                   /note="ORF_ID:tlr0613"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08165"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08165"
FT                   /db_xref="GOA:Q8DL83"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL83"
FT                   /protein_id="BAC08165.1"
FT   CDS_pept        complement(620348..620878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpsA"
FT                   /product="starvation induced DNA binding protein"
FT                   /note="ORF_ID:tll0614"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08166"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08166"
FT                   /db_xref="GOA:Q8DL82"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="PDB:2VXX"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL82"
FT                   /protein_id="BAC08166.1"
FT                   HIGHFLANDSLKV"
FT   CDS_pept        621086..621385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0615"
FT                   /note="ORF_ID:tlr0615"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08167"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08167"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL81"
FT                   /protein_id="BAC08167.1"
FT   CDS_pept        complement(621800..622165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0616"
FT                   /note="ORF_ID:tll0616"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08168"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08168"
FT                   /db_xref="GOA:Q8DL80"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL80"
FT                   /protein_id="BAC08168.1"
FT                   LPESEGTERSEDMTPIT"
FT   CDS_pept        complement(622140..623396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigA"
FT                   /product="principal RNA polymerase sigma factor"
FT                   /note="ORF_ID:tll0617"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08169"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08169"
FT                   /db_xref="GOA:Q8DL79"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL79"
FT                   /protein_id="BAC08169.1"
FT   CDS_pept        complement(623862..624557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0618"
FT                   /note="ORF_ID:tll0618"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08170"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08170"
FT                   /db_xref="GOA:Q8DL78"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL78"
FT                   /protein_id="BAC08170.1"
FT                   WLWNCTMGG"
FT   mobile_element  624954..627338
FT                   /mobile_element_type="other:TelI4f"
FT                   /note="groupII intron"
FT   CDS_pept        625568..627256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0620"
FT                   /product="reverse transcriptase"
FT                   /note="ORF_ID:tlr0620"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08171"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08171"
FT                   /db_xref="GOA:Q8DL77"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL77"
FT                   /protein_id="BAC08171.1"
FT   CDS_pept        complement(627342..627695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0621"
FT                   /product="divalent cation tolerance protein"
FT                   /note="ORF_ID:tll0621"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08172"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08172"
FT                   /db_xref="GOA:Q8DL76"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL76"
FT                   /protein_id="BAC08172.1"
FT                   NWIKEQTHKPSRG"
FT   CDS_pept        627750..628844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0622"
FT                   /product="beta ketoacyl-acyl carrier protein synthase"
FT                   /note="ORF_ID:tlr0622"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08173"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08173"
FT                   /db_xref="GOA:Q8DL75"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL75"
FT                   /protein_id="BAC08173.1"
FT   CDS_pept        complement(628841..630808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0623"
FT                   /product="1-deoxy-xylulose 5-phosphate synthase"
FT                   /note="ORF_ID:tll0623"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08174"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08174"
FT                   /db_xref="GOA:Q8DL74"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL74"
FT                   /protein_id="BAC08174.1"
FT   CDS_pept        complement(630862..631350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0624"
FT                   /note="ORF_ID:tll0624"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08175"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08175"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL73"
FT                   /protein_id="BAC08175.1"
FT   CDS_pept        complement(631528..632040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0625"
FT                   /note="ORF_ID:tll0625"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08176"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08176"
FT                   /db_xref="GOA:Q8DL72"
FT                   /db_xref="InterPro:IPR021919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL72"
FT                   /protein_id="BAC08176.1"
FT                   EDTVLRA"
FT   CDS_pept        632184..633602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0626"
FT                   /note="ORF_ID:tlr0626"
FT                   /note="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08177"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08177"
FT                   /db_xref="GOA:Q8DL71"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL71"
FT                   /protein_id="BAC08177.1"
FT                   VETVRIVLFGTGAY"
FT   CDS_pept        complement(633546..636083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0627"
FT                   /note="ORF_ID:tll0627"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08178"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08178"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL70"
FT                   /protein_id="BAC08178.1"
FT   CDS_pept        636364..637815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0628"
FT                   /product="processing proteinase"
FT                   /note="ORF_ID:tlr0628"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08179"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08179"
FT                   /db_xref="GOA:Q8DL69"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL69"
FT                   /protein_id="BAC08179.1"
FT   CDS_pept        637961..638134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0629"
FT                   /note="ORF_ID:tsr0629"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08180"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08180"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL68"
FT                   /protein_id="BAC08180.1"
FT                   QMRGQPPLNQLC"
FT   CDS_pept        638164..638586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0630"
FT                   /note="ORF_ID:tlr0630"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08181"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08181"
FT                   /db_xref="GOA:Q8DL67"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL67"
FT                   /protein_id="BAC08181.1"
FT   CDS_pept        638596..639039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0631"
FT                   /note="ORF_ID:tlr0631"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08182"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08182"
FT                   /db_xref="GOA:Q8DL66"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL66"
FT                   /protein_id="BAC08182.1"
FT   CDS_pept        complement(639068..639454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0632"
FT                   /note="ORF_ID:tll0632"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08183"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08183"
FT                   /db_xref="GOA:Q8DL65"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR026350"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL65"
FT                   /protein_id="BAC08183.1"
FT   CDS_pept        complement(639451..640392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0633"
FT                   /product="GDP-fucose synthetase"
FT                   /note="ORF_ID:tll0633"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08184"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08184"
FT                   /db_xref="GOA:Q8DL64"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL64"
FT                   /protein_id="BAC08184.1"
FT   CDS_pept        complement(640395..641474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0634"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="ORF_ID:tll0634"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08185"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08185"
FT                   /db_xref="GOA:Q8DL63"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL63"
FT                   /protein_id="BAC08185.1"
FT   CDS_pept        complement(641478..643235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0635"
FT                   /note="ORF_ID:tll0635"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08186"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08186"
FT                   /db_xref="GOA:Q8DL62"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL62"
FT                   /protein_id="BAC08186.1"
FT                   ESTGLGGRQ"
FT   tRNA            643469..643560
FT                   /product="trnS-GCU"
FT   CDS_pept        643572..643904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0636"
FT                   /note="ORF_ID:tlr0636"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08187"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08187"
FT                   /db_xref="GOA:Q8DL61"
FT                   /db_xref="InterPro:IPR021659"
FT                   /db_xref="PDB:6A7K"
FT                   /db_xref="PDB:6HUM"
FT                   /db_xref="PDB:6NBQ"
FT                   /db_xref="PDB:6NBX"
FT                   /db_xref="PDB:6NBY"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL61"
FT                   /protein_id="BAC08187.1"
FT                   KAKAKK"
FT   CDS_pept        643908..644510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0637"
FT                   /note="ORF_ID:tlr0637"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08188"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08188"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL60"
FT                   /protein_id="BAC08188.1"
FT   CDS_pept        complement(644494..645159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0638"
FT                   /note="ORF_ID:tll0638"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08189"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08189"
FT                   /db_xref="GOA:Q8DL59"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL59"
FT                   /protein_id="BAC08189.1"
FT   CDS_pept        complement(645162..645992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0639"
FT                   /note="ORF_ID:tll0639"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08190"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08190"
FT                   /db_xref="GOA:Q8DL58"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL58"
FT                   /protein_id="BAC08190.1"
FT   CDS_pept        complement(646190..650164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC2"
FT                   /product="RNA polymerase beta prime subunit"
FT                   /note="ORF_ID:tll0640"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08191"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08191"
FT                   /db_xref="GOA:Q8DL57"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012756"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL57"
FT                   /protein_id="BAC08191.1"
FT   CDS_pept        complement(650184..652052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC1"
FT                   /product="RNA polymerase gamma-subunit"
FT                   /note="ORF_ID:tll0641"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08192"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08192"
FT                   /db_xref="GOA:Q8DL56"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR012755"
FT                   /db_xref="InterPro:IPR034678"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL56"
FT                   /protein_id="BAC08192.1"
FT   CDS_pept        complement(652128..655454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /product="RNA polymerase beta subunit"
FT                   /note="ORF_ID:tll0642"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08193"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08193"
FT                   /db_xref="GOA:Q8DL55"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL55"
FT                   /protein_id="BAC08193.1"
FT                   F"
FT   CDS_pept        complement(655852..656547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0643"
FT                   /product="ATP-binding protein of devA-like ABC transporter"
FT                   /note="ORF_ID:tll0643"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08194"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08194"
FT                   /db_xref="GOA:Q8DL54"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014324"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL54"
FT                   /protein_id="BAC08194.1"
FT                   SETTLGISA"
FT   CDS_pept        complement(656556..657710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0644"
FT                   /product="devC-like ABC transporter permease protein"
FT                   /note="ORF_ID:tll0644"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08195"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08195"
FT                   /db_xref="GOA:Q8DL53"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR005891"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL53"
FT                   /protein_id="BAC08195.1"
FT   CDS_pept        complement(657720..658883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0645"
FT                   /product="devB-like secretion protein"
FT                   /note="ORF_ID:tll0645"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08196"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08196"
FT                   /db_xref="GOA:Q8DL52"
FT                   /db_xref="InterPro:IPR014315"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL52"
FT                   /protein_id="BAC08196.1"
FT   CDS_pept        complement(658972..659559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0646"
FT                   /note="ORF_ID:tll0646"
FT                   /note="probable pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08197"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08197"
FT                   /db_xref="GOA:Q8DL51"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL51"
FT                   /protein_id="BAC08197.1"
FT   ncRNA           659569..659757
FT                   /gene="ssaA"
FT                   /product="6Sa RNA"
FT                   /note="ssaA is functional when cells divide actively"
FT                   /ncRNA_class="other"
FT   CDS_pept        complement(659794..661716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /product="DNA gyrase subunit B"
FT                   /note="ORF_ID:tll0647"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08198"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08198"
FT                   /db_xref="GOA:Q8DL50"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL50"
FT                   /protein_id="BAC08198.1"
FT                   ENLDI"
FT   CDS_pept        661843..662781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0648"
FT                   /product="tRNA isopentenylpyrophosphate transferase"
FT                   /note="ORF_ID:tlr0648"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08199"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08199"
FT                   /db_xref="GOA:Q8CWM5"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CWM5"
FT                   /protein_id="BAC08199.1"
FT   CDS_pept        complement(662724..663467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0649"
FT                   /note="ORF_ID:tll0649"
FT                   /note="putative amino transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08200"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08200"
FT                   /db_xref="GOA:Q8DL49"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL49"
FT                   /protein_id="BAC08200.1"
FT   CDS_pept        complement(663474..665069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0650"
FT                   /note="ORF_ID:tll0650"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08201"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08201"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL48"
FT                   /protein_id="BAC08201.1"
FT                   QRPPTPQPIEISKP"
FT   CDS_pept        665112..665543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0651"
FT                   /note="ORF_ID:tlr0651"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08202"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08202"
FT                   /db_xref="GOA:Q8DL47"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL47"
FT                   /protein_id="BAC08202.1"
FT   CDS_pept        665582..667606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0652"
FT                   /product="ribonuclease II"
FT                   /note="ORF_ID:tlr0652"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08203"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08203"
FT                   /db_xref="GOA:Q8DL46"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL46"
FT                   /protein_id="BAC08203.1"
FT   CDS_pept        667617..668006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0653"
FT                   /note="ORF_ID:tlr0653"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08204"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08204"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL45"
FT                   /protein_id="BAC08204.1"
FT   CDS_pept        668052..668405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0654"
FT                   /note="ORF_ID:tlr0654"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08205"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08205"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL44"
FT                   /protein_id="BAC08205.1"
FT                   VEDLNQFLESATP"
FT   CDS_pept        668433..670202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0655"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:tlr0655"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08206"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08206"
FT                   /db_xref="GOA:Q8DL43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL43"
FT                   /protein_id="BAC08206.1"
FT                   SLWEQYQLESSLA"
FT   CDS_pept        670571..671323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0656"
FT                   /product="pseudouridylate synthase"
FT                   /note="ORF_ID:tlr0656"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08207"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08207"
FT                   /db_xref="GOA:Q8DL42"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL42"
FT                   /protein_id="BAC08207.1"
FT   CDS_pept        complement(671310..673619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0657"
FT                   /product="cation-transporting ATPase"
FT                   /note="ORF_ID:tll0657"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08208"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08208"
FT                   /db_xref="GOA:Q8DL41"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL41"
FT                   /protein_id="BAC08208.1"
FT                   HPDHPVQHRPPKVTGS"
FT   CDS_pept        673847..675127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0658"
FT                   /product="enolase"
FT                   /note="ORF_ID:tlr0658"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08209"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08209"
FT                   /db_xref="GOA:Q8DL40"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL40"
FT                   /protein_id="BAC08209.1"
FT   CDS_pept        675128..675925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0659"
FT                   /product="dimethyladenosine transferase"
FT                   /note="ORF_ID:tlr0659"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08210"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08210"
FT                   /db_xref="GOA:P59157"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59157"
FT                   /protein_id="BAC08210.1"
FT   CDS_pept        complement(675911..676675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0660"
FT                   /note="ORF_ID:tll0660"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08211"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08211"
FT                   /db_xref="GOA:Q8DL39"
FT                   /db_xref="InterPro:IPR022170"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL39"
FT                   /protein_id="BAC08211.1"
FT   CDS_pept        complement(676861..677943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /product="biotin synthetase"
FT                   /note="ORF_ID:tll0661"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08212"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08212"
FT                   /db_xref="GOA:Q8DL38"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL38"
FT                   /protein_id="BAC08212.1"
FT   CDS_pept        complement(677879..680404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /product="phenylalanyl-tRNA synthetase"
FT                   /note="ORF_ID:tll0662"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08213"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08213"
FT                   /db_xref="GOA:Q8DL37"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL37"
FT                   /protein_id="BAC08213.1"
FT   CDS_pept        complement(680385..681029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhnB"
FT                   /product="ribonuclease H"
FT                   /note="ORF_ID:tll0663"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08214"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08214"
FT                   /db_xref="GOA:Q8DL36"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL36"
FT                   /protein_id="BAC08214.1"
FT   CDS_pept        complement(681032..682411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0664"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /note="ORF_ID:tll0664"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08215"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08215"
FT                   /db_xref="GOA:Q8DL35"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL35"
FT                   /protein_id="BAC08215.1"
FT                   H"
FT   CDS_pept        complement(682426..683382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="ORF_ID:tll0665"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08216"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08216"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL34"
FT                   /protein_id="BAC08216.1"
FT   CDS_pept        complement(683908..685221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0666"
FT                   /product="dihydroorotase"
FT                   /note="ORF_ID:tll0666"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08217"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08217"
FT                   /db_xref="GOA:Q8DL33"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL33"
FT                   /protein_id="BAC08217.1"
FT   CDS_pept        685391..686530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhA"
FT                   /product="NADH dehydrogenase subunit 1"
FT                   /note="ORF_ID:tlr0667"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08218"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08218"
FT                   /db_xref="GOA:Q8DL32"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="PDB:6HUM"
FT                   /db_xref="PDB:6NBX"
FT                   /db_xref="PDB:6NBY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL32"
FT                   /protein_id="BAC08218.1"
FT   CDS_pept        686560..687150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhI"
FT                   /product="NADH dehydrogenase subunit"
FT                   /note="ORF_ID:tlr0668"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08219"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08219"
FT                   /db_xref="GOA:Q8DL31"
FT                   /db_xref="InterPro:IPR004497"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="PDB:6HUM"
FT                   /db_xref="PDB:6NBQ"
FT                   /db_xref="PDB:6NBX"
FT                   /db_xref="PDB:6NBY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL31"
FT                   /protein_id="BAC08219.1"
FT   CDS_pept        687162..687764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhG"
FT                   /product="NADH dehydrogenase subunit 6"
FT                   /note="ORF_ID:tlr0669"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08220"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08220"
FT                   /db_xref="GOA:Q8DL30"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="PDB:6HUM"
FT                   /db_xref="PDB:6NBQ"
FT                   /db_xref="PDB:6NBX"
FT                   /db_xref="PDB:6NBY"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL30"
FT                   /protein_id="BAC08220.1"
FT   CDS_pept        687774..688079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhE"
FT                   /product="NADH dehydrogenase subunit 4L"
FT                   /note="ORF_ID:tlr0670"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08221"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08221"
FT                   /db_xref="GOA:Q8DL29"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="PDB:6HUM"
FT                   /db_xref="PDB:6NBQ"
FT                   /db_xref="PDB:6NBX"
FT                   /db_xref="PDB:6NBY"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL29"
FT                   /protein_id="BAC08221.1"
FT   CDS_pept        688153..689322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0671"
FT                   /product="periplasmic serine proteinase"
FT                   /note="ORF_ID:tlr0671"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08222"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08222"
FT                   /db_xref="GOA:Q8DL28"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL28"
FT                   /protein_id="BAC08222.1"
FT   CDS_pept        689324..690337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0672"
FT                   /note="ORF_ID:tlr0672"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08223"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08223"
FT                   /db_xref="InterPro:IPR021763"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL27"
FT                   /protein_id="BAC08223.1"
FT   CDS_pept        690361..690810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0673"
FT                   /note="ORF_ID:tlr0673"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08224"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08224"
FT                   /db_xref="InterPro:IPR022573"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL26"
FT                   /protein_id="BAC08224.1"
FT   CDS_pept        690818..691747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0674"
FT                   /note="ORF_ID:tlr0674"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08225"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08225"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="InterPro:IPR022573"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL25"
FT                   /protein_id="BAC08225.1"
FT   CDS_pept        691755..692660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0675"
FT                   /note="ORF_ID:tlr0675"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08226"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08226"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="InterPro:IPR022573"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL24"
FT                   /protein_id="BAC08226.1"
FT   CDS_pept        692668..693561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0676"
FT                   /note="ORF_ID:tlr0676"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08227"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08227"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="InterPro:IPR022573"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL23"
FT                   /protein_id="BAC08227.1"
FT                   DFRELEEVAAWLEQTS"
FT   CDS_pept        693569..694522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0677"
FT                   /note="ORF_ID:tlr0677"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08228"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08228"
FT                   /db_xref="GOA:Q8DL22"
FT                   /db_xref="InterPro:IPR000563"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="InterPro:IPR022573"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL22"
FT                   /protein_id="BAC08228.1"
FT   CDS_pept        694822..699930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0678"
FT                   /note="ORF_ID:tlr0678"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08229"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08229"
FT                   /db_xref="GOA:Q8DL21"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL21"
FT                   /protein_id="BAC08229.1"
FT                   AQCDA"
FT   CDS_pept        699951..700592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0679"
FT                   /note="ORF_ID:tlr0679"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08230"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08230"
FT                   /db_xref="GOA:Q8DL20"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL20"
FT                   /protein_id="BAC08230.1"
FT   CDS_pept        700602..701729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0680"
FT                   /note="ORF_ID:tlr0680"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08231"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08231"
FT                   /db_xref="GOA:Q8DL19"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL19"
FT                   /protein_id="BAC08231.1"
FT   CDS_pept        701739..702362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0681"
FT                   /note="ORF_ID:tlr0681"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08232"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08232"
FT                   /db_xref="GOA:Q8DL18"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL18"
FT                   /protein_id="BAC08232.1"
FT   CDS_pept        702425..703027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0682"
FT                   /note="ORF_ID:tlr0682"
FT                   /note="similar to general secretory pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08233"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08233"
FT                   /db_xref="GOA:Q8DL17"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031975"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL17"
FT                   /protein_id="BAC08233.1"
FT   CDS_pept        complement(703113..704441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccs1"
FT                   /product="c-type cytochrome biogenesis protein"
FT                   /note="ORF_ID:tll0683"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08234"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08234"
FT                   /db_xref="GOA:Q8DL16"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="InterPro:IPR023494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL16"
FT                   /protein_id="BAC08234.1"
FT   CDS_pept        complement(704487..705545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /note="ORF_ID:tll0684"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08235"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08235"
FT                   /db_xref="GOA:Q8DL15"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL15"
FT                   /protein_id="BAC08235.1"
FT                   FLKPQDWVNWPV"
FT   CDS_pept        complement(705564..706205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0685"
FT                   /note="ORF_ID:tll0685"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08236"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08236"
FT                   /db_xref="GOA:Q8DL14"
FT                   /db_xref="InterPro:IPR021325"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL14"
FT                   /protein_id="BAC08236.1"
FT   CDS_pept        706272..706553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0686"
FT                   /note="ORF_ID:tsr0686"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08237"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08237"
FT                   /db_xref="GOA:Q8DL13"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL13"
FT                   /protein_id="BAC08237.1"
FT   mobile_element  complement(706533..707859)
FT                   /mobile_element_type="insertion sequence:ISEL1h"
FT   CDS_pept        complement(706573..707799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0687"
FT                   /note="ORF_ID:tll0687"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08238"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08238"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL12"
FT                   /protein_id="BAC08238.1"
FT                   LRRSRKSQK"
FT   CDS_pept        707856..708110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0688"
FT                   /note="ORF_ID:tsr0688"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08239"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08239"
FT                   /db_xref="GOA:Q8DL11"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL11"
FT                   /protein_id="BAC08239.1"
FT   CDS_pept        complement(708107..709471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0689"
FT                   /note="ORF_ID:tll0689"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08240"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08240"
FT                   /db_xref="GOA:Q8DL10"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL10"
FT                   /protein_id="BAC08240.1"
FT   CDS_pept        709577..710587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /product="phenylalanyl-tRNA synthetase alpha chain"
FT                   /note="ORF_ID:tlr0690"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08241"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08241"
FT                   /db_xref="GOA:Q8DL09"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DL09"
FT                   /protein_id="BAC08241.1"
FT   CDS_pept        710620..711234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0691"
FT                   /note="ORF_ID:tlr0691"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08242"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08242"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL08"
FT                   /protein_id="BAC08242.1"
FT   CDS_pept        711483..711674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0692"
FT                   /note="ORF_ID:tsr0692"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08243"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08243"
FT                   /db_xref="GOA:Q8DL07"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL07"
FT                   /protein_id="BAC08243.1"
FT                   AMALGWRLFSGNRPAGFL"
FT   CDS_pept        711749..714367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0693"
FT                   /product="aconitate hydratase"
FT                   /note="ORF_ID:tlr0693"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08244"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08244"
FT                   /db_xref="GOA:Q8DL06"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL06"
FT                   /protein_id="BAC08244.1"
FT                   A"
FT   CDS_pept        715307..716461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntA"
FT                   /product="pyridine nucleotide transhydrogenase alpha
FT                   subunit"
FT                   /note="ORF_ID:tlr0694"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08245"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08245"
FT                   /db_xref="GOA:Q8DL05"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL05"
FT                   /protein_id="BAC08245.1"
FT   CDS_pept        716477..716764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsr0695"
FT                   /note="ORF_ID:tsr0695"
FT                   /note="similar to pyridine nucleotide transhydrogenase
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08246"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08246"
FT                   /db_xref="GOA:Q8DL04"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL04"
FT                   /protein_id="BAC08246.1"
FT   CDS_pept        716770..718170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /product="pyridine nucleotide transhydrogenase beta
FT                   subunit"
FT                   /note="ORF_ID:tlr0696"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08247"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08247"
FT                   /db_xref="GOA:Q8DL03"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL03"
FT                   /protein_id="BAC08247.1"
FT                   LIAEVKHL"
FT   CDS_pept        complement(718145..718879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0697"
FT                   /note="ORF_ID:tll0697"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08248"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08248"
FT                   /db_xref="GOA:Q8DL02"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL02"
FT                   /protein_id="BAC08248.1"
FT   CDS_pept        complement(718882..719799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /note="ORF_ID:tll0698"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08249"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08249"
FT                   /db_xref="GOA:Q8DL01"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL01"
FT                   /protein_id="BAC08249.1"
FT   CDS_pept        719923..720552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0699"
FT                   /note="ORF_ID:tlr0699"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08250"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08250"
FT                   /db_xref="InterPro:IPR007357"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DL00"
FT                   /protein_id="BAC08250.1"
FT   mobile_element  720543..720735
FT                   /mobile_element_type="insertion sequence:ISEL3n"
FT   CDS_pept        720850..721293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0700"
FT                   /note="ORF_ID:tlr0700"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08251"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08251"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DKZ9"
FT                   /protein_id="BAC08251.1"
FT   CDS_pept        721293..721610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0701"
FT                   /note="ORF_ID:tlr0701"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08252"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08252"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DKZ8"
FT                   /protein_id="BAC08252.1"
FT                   S"
FT   CDS_pept        complement(721623..721820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsl0702"
FT                   /note="ORF_ID:tsl0702"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08253"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08253"
FT                   /db_xref="GOA:Q8DKZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DKZ7"
FT                   /protein_id="BAC08253.1"
FT   CDS_pept        721872..723047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0703"
FT                   /note="ORF_ID:tlr0703"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08254"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08254"
FT                   /db_xref="GOA:Q8DKZ6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DKZ6"
FT                   /protein_id="BAC08254.1"
FT   CDS_pept        723118..724044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0704"
FT                   /product="asparaginase"
FT                   /note="ORF_ID:tlr0704"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08255"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08255"
FT                   /db_xref="GOA:Q8DKZ5"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DKZ5"
FT                   /protein_id="BAC08255.1"
FT   CDS_pept        724165..724878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhK"
FT                   /product="NADH dehydrogenase subunit"
FT                   /note="ORF_ID:tlr0705"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08256"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08256"
FT                   /db_xref="GOA:Q8DKZ4"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="PDB:6HUM"
FT                   /db_xref="PDB:6NBQ"
FT                   /db_xref="PDB:6NBX"
FT                   /db_xref="PDB:6NBY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DKZ4"
FT                   /protein_id="BAC08256.1"
FT                   PALGEAVSETTSVAE"
FT   CDS_pept        724917..725147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhL"
FT                   /product="NADH dehydrogenase subunit"
FT                   /note="ORF_ID:tsr0706"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08257"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08257"
FT                   /db_xref="GOA:Q8DKZ3"
FT                   /db_xref="InterPro:IPR019654"
FT                   /db_xref="PDB:6HUM"
FT                   /db_xref="PDB:6NBQ"
FT                   /db_xref="PDB:6NBX"
FT                   /db_xref="PDB:6NBY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DKZ3"
FT                   /protein_id="BAC08257.1"
FT   CDS_pept        725153..725485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0707"
FT                   /note="ORF_ID:tlr0707"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08258"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08258"
FT                   /db_xref="GOA:Q8DKZ2"
FT                   /db_xref="InterPro:IPR021562"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DKZ2"
FT                   /protein_id="BAC08258.1"
FT                   PELGDN"
FT   CDS_pept        725511..727067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0708"
FT                   /product="4-alpha-glucanotransferase"
FT                   /note="ORF_ID:tlr0708"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08259"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08259"
FT                   /db_xref="GOA:Q8DKZ1"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DKZ1"
FT                   /protein_id="BAC08259.1"
FT                   P"
FT   CDS_pept        complement(727064..728413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0709"
FT                   /note="ORF_ID:tll0709"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08260"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08260"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DKZ0"
FT                   /protein_id="BAC08260.1"
FT   CDS_pept        728624..729826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0710"
FT                   /note="ORF_ID:tlr0710"
FT                   /note="probable aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08261"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08261"
FT                   /db_xref="GOA:Q8DKY9"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DKY9"
FT                   /protein_id="BAC08261.1"
FT                   S"
FT   CDS_pept        730061..731065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0711"
FT                   /product="D-lactate dehydrogenase"
FT                   /note="ORF_ID:tlr0711"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08262"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08262"
FT                   /db_xref="GOA:Q8DKY8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DKY8"
FT                   /protein_id="BAC08262.1"
FT   CDS_pept        731164..732369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /product="argininosuccinate synthetase"
FT                   /note="ORF_ID:tlr0712"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08263"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08263"
FT                   /db_xref="GOA:Q8DKY7"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DKY7"
FT                   /protein_id="BAC08263.1"
FT                   QG"
FT   CDS_pept        complement(732366..732665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0713"
FT                   /note="ORF_ID:tll0713"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08264"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08264"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DKY6"
FT                   /protein_id="BAC08264.1"
FT   CDS_pept        732732..734051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0714"
FT                   /note="ORF_ID:tlr0714"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08265"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08265"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DKY5"
FT                   /protein_id="BAC08265.1"
FT   CDS_pept        734051..735331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0715"
FT                   /product="polyA polymerase"
FT                   /note="ORF_ID:tlr0715"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08266"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08266"
FT                   /db_xref="GOA:Q8DKY4"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032810"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DKY4"
FT                   /protein_id="BAC08266.1"
FT   CDS_pept        complement(735328..736386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0716"
FT                   /note="ORF_ID:tll0716"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08267"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08267"
FT                   /db_xref="GOA:Q8DKY3"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DKY3"
FT                   /protein_id="BAC08267.1"
FT                   DTLWQEIFLTSS"
FT   CDS_pept        complement(736374..737963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0717"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /note="ORF_ID:tll0717"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08268"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08268"
FT                   /db_xref="GOA:Q8DKY2"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DKY2"
FT                   /protein_id="BAC08268.1"
FT                   AQPSQLQFRWQR"
FT   CDS_pept        738338..738748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlr0718"
FT                   /note="ORF_ID:tlr0718"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08269"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08269"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DKY1"
FT                   /protein_id="BAC08269.1"
FT   CDS_pept        complement(738808..740352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhD1"
FT                   /product="NADH dehydrogenase subunit 4"
FT                   /note="ORF_ID:tll0719"
FT                   /note="involved in photosystem-1 cyclic electron flow"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08270"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08270"
FT                   /db_xref="GOA:Q8DKY0"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="InterPro:IPR022997"
FT                   /db_xref="PDB:6HUM"
FT                   /db_xref="PDB:6NBQ"
FT                   /db_xref="PDB:6NBX"
FT                   /db_xref="PDB:6NBY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8DKY0"
FT                   /protein_id="BAC08270.1"
FT   CDS_pept        complement(740446..742416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhF1"
FT                   /product="NADH dehydrogenase subunit 5"
FT                   /note="ORF_ID:tll0720"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08271"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08271"
FT                   /db_xref="GOA:Q8DKX9"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR002128"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="PDB:6HUM"
FT                   /db_xref="PDB:6NBQ"
FT                   /db_xref="PDB:6NBX"
FT                   /db_xref="PDB:6NBY"
FT                   /db_xref="UniProtKB/TrEMBL:Q8DKX9"
FT                   /protein_id="BAC08271.1"
FT   CDS_pept        complement(742517..743557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tll0721"
FT                   /note="ORF_ID:tll0721"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC08272"
FT                   /db_xref="EnsemblGenomes-Tr:BAC08272"
FT                   /db_xref="GOA:Q8DKX8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038