(data stored in ACNUC7421 zone)

EMBL: BA000040

ID   BA000040; SV 2; circular; genomic DNA; STD; PRO; 9105828 BP.
XX
AC   BA000040; AP005935-AP005965;
XX
PR   Project:PRJNA17;
XX
DT   31-OCT-2004 (Rel. 81, Created)
DT   10-OCT-2016 (Rel. 130, Last updated, Version 10)
XX
DE   Bradyrhizobium diazoefficiens USDA 110 DNA, complete genome.
XX
KW   .
XX
OS   Bradyrhizobium diazoefficiens USDA 110
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Bradyrhizobiaceae; Bradyrhizobium.
XX
RN   [1]
RP   1-9105828
RA   Sato S., Kaneko T.;
RT   ;
RL   Submitted (20-NOV-2002) to the INSDC.
RL   Contact:Shusei Sato Kazusa DNA Research Institute, Department of Plant
RL   Genome Research; 2-6-7 Kazusa-kamatari, Kisarazu, Chiba 292-0812, Japan URL
RL      :http://www.kazusa.or.jp/rhizobase/
XX
RN   [2]
RA   Kaneko T., Nakamura Y., Sato S., Minamisawa K., Uchiumi T., Sasamoto S.,
RA   Watanabe A., Idesawa K., Iriguchi M., Kawashima K., Kohara M.,
RA   Matsumoto M., Shimpo S., Tsuruoka H., Wada T., Yamada M., Tabata S.;
RT   "Complete genomic sequence of nitrogen-fixing symbiotic bacterium
RT   Bradyrhizobium japonicum USDA110";
RL   DNA Res. 9:189-197(2003).
XX
RN   [3]
RA   Kaneko T., Nakamura Y., Sato S., Minamisawa K., Uchiumi T., Sasamoto S.,
RA   Watanabe A., Idesawa K., Iriguchi M., Kawashima K., Kohara M.,
RA   Matsumoto M., Shimpo S., Tsuruoka H., Wada T., Yamada M., Tabata S.;
RT   "Complete genomic sequence of nitrogen-fixing symbiotic bacterium
RT   Bradyrhizobium japonicum USDA110 (Supplement)";
RL   DNA Res. 9:225-256(2003).
XX
DR   MD5; aa83c9a871d5dc7ed0f1daf4784c77f3.
DR   BioSample; SAMD00061083.
DR   EnsemblGenomes-Gn; EBG00000038905.
DR   EnsemblGenomes-Gn; EBG00000038906.
DR   EnsemblGenomes-Gn; EBG00000038907.
DR   EnsemblGenomes-Gn; EBG00000038908.
DR   EnsemblGenomes-Gn; EBG00000038909.
DR   EnsemblGenomes-Gn; EBG00000038910.
DR   EnsemblGenomes-Gn; EBG00000038911.
DR   EnsemblGenomes-Gn; EBG00000038912.
DR   EnsemblGenomes-Gn; EBG00000038913.
DR   EnsemblGenomes-Gn; EBG00000038914.
DR   EnsemblGenomes-Gn; EBG00000038915.
DR   EnsemblGenomes-Gn; EBG00000038916.
DR   EnsemblGenomes-Gn; EBG00000038917.
DR   EnsemblGenomes-Gn; EBG00000038918.
DR   EnsemblGenomes-Gn; EBG00000038919.
DR   EnsemblGenomes-Gn; EBG00000038920.
DR   EnsemblGenomes-Gn; EBG00000038921.
DR   EnsemblGenomes-Gn; EBG00000038922.
DR   EnsemblGenomes-Gn; EBG00000038923.
DR   EnsemblGenomes-Gn; EBG00000038924.
DR   EnsemblGenomes-Gn; EBG00000038925.
DR   EnsemblGenomes-Gn; EBG00000038926.
DR   EnsemblGenomes-Gn; EBG00000038927.
DR   EnsemblGenomes-Gn; EBG00000038928.
DR   EnsemblGenomes-Gn; EBG00000038929.
DR   EnsemblGenomes-Gn; EBG00000038930.
DR   EnsemblGenomes-Gn; EBG00000038931.
DR   EnsemblGenomes-Gn; EBG00000038932.
DR   EnsemblGenomes-Gn; EBG00000038933.
DR   EnsemblGenomes-Gn; EBG00000038934.
DR   EnsemblGenomes-Gn; EBG00000038935.
DR   EnsemblGenomes-Gn; EBG00000038936.
DR   EnsemblGenomes-Gn; EBG00000038937.
DR   EnsemblGenomes-Gn; EBG00000038938.
DR   EnsemblGenomes-Gn; EBG00000038939.
DR   EnsemblGenomes-Gn; EBG00000038940.
DR   EnsemblGenomes-Gn; EBG00000038941.
DR   EnsemblGenomes-Gn; EBG00000038942.
DR   EnsemblGenomes-Gn; EBG00000038943.
DR   EnsemblGenomes-Gn; EBG00000038944.
DR   EnsemblGenomes-Gn; EBG00000038945.
DR   EnsemblGenomes-Gn; EBG00000038946.
DR   EnsemblGenomes-Gn; EBG00000038947.
DR   EnsemblGenomes-Gn; EBG00000038948.
DR   EnsemblGenomes-Gn; EBG00000038949.
DR   EnsemblGenomes-Gn; EBG00000038950.
DR   EnsemblGenomes-Gn; EBG00000038951.
DR   EnsemblGenomes-Gn; EBG00000038952.
DR   EnsemblGenomes-Gn; EBG00000038953.
DR   EnsemblGenomes-Gn; EBG00000038954.
DR   EnsemblGenomes-Gn; EBG00000038955.
DR   EnsemblGenomes-Gn; EBG00000038956.
DR   EnsemblGenomes-Gn; EBG00000038957.
DR   EnsemblGenomes-Gn; EBG00000038958.
DR   EnsemblGenomes-Gn; EBG00000622818.
DR   EnsemblGenomes-Gn; EBG00000622819.
DR   EnsemblGenomes-Gn; EBG00001179082.
DR   EnsemblGenomes-Gn; EBG00001179083.
DR   EnsemblGenomes-Gn; EBG00001179084.
DR   EnsemblGenomes-Gn; EBG00001179085.
DR   EnsemblGenomes-Gn; EBG00001179086.
DR   EnsemblGenomes-Gn; EBG00001179087.
DR   EnsemblGenomes-Gn; EBG00001179088.
DR   EnsemblGenomes-Gn; EBG00001179089.
DR   EnsemblGenomes-Gn; EBG00001179090.
DR   EnsemblGenomes-Gn; EBG00001179091.
DR   EnsemblGenomes-Gn; EBG00001179092.
DR   EnsemblGenomes-Gn; EBG00001179093.
DR   EnsemblGenomes-Gn; EBG00001179094.
DR   EnsemblGenomes-Gn; EBG00001179095.
DR   EnsemblGenomes-Gn; EBG00001179096.
DR   EnsemblGenomes-Gn; EBG00001179097.
DR   EnsemblGenomes-Gn; EBG00001179098.
DR   EnsemblGenomes-Gn; EBG00001179099.
DR   EnsemblGenomes-Gn; EBG00001179100.
DR   EnsemblGenomes-Gn; EBG00001179101.
DR   EnsemblGenomes-Gn; EBG00001179102.
DR   EnsemblGenomes-Gn; EBG00001179103.
DR   EnsemblGenomes-Gn; EBG00001179104.
DR   EnsemblGenomes-Gn; EBG00001179105.
DR   EnsemblGenomes-Gn; EBG00001179106.
DR   EnsemblGenomes-Gn; EBG00001179107.
DR   EnsemblGenomes-Gn; EBG00001179108.
DR   EnsemblGenomes-Gn; EBG00001179109.
DR   EnsemblGenomes-Gn; EBG00001179110.
DR   EnsemblGenomes-Gn; EBG00001179111.
DR   EnsemblGenomes-Gn; EBG00001179112.
DR   EnsemblGenomes-Gn; EBG00001179113.
DR   EnsemblGenomes-Gn; EBG00001179114.
DR   EnsemblGenomes-Gn; EBG00001179115.
DR   EnsemblGenomes-Gn; EBG00001179116.
DR   EnsemblGenomes-Gn; EBG00001179117.
DR   EnsemblGenomes-Gn; EBG00001179118.
DR   EnsemblGenomes-Gn; EBG00001179119.
DR   EnsemblGenomes-Gn; EBG00001179120.
DR   EnsemblGenomes-Gn; EBG00001179121.
DR   EnsemblGenomes-Gn; EBG00001179122.
DR   EnsemblGenomes-Gn; EBG00001179123.
DR   EnsemblGenomes-Gn; EBG00001179124.
DR   EnsemblGenomes-Gn; EBG00001179125.
DR   EnsemblGenomes-Gn; EBG00001179126.
DR   EnsemblGenomes-Gn; EBG00001179127.
DR   EnsemblGenomes-Gn; EBG00001179128.
DR   EnsemblGenomes-Gn; EBG00001179129.
DR   EnsemblGenomes-Gn; EBG00001179130.
DR   EnsemblGenomes-Gn; EBG00001179131.
DR   EnsemblGenomes-Gn; EBG00001179132.
DR   EnsemblGenomes-Gn; EBG00001179133.
DR   EnsemblGenomes-Gn; EBG00001179134.
DR   EnsemblGenomes-Gn; EBG00001179135.
DR   EnsemblGenomes-Gn; EBG00001179136.
DR   EnsemblGenomes-Gn; EBG00001179137.
DR   EnsemblGenomes-Gn; EBG00001179138.
DR   EnsemblGenomes-Gn; EBG00001179139.
DR   EnsemblGenomes-Gn; EBG00001179140.
DR   EnsemblGenomes-Gn; EBG00001179141.
DR   EnsemblGenomes-Gn; EBG00001179142.
DR   EnsemblGenomes-Gn; EBG00001179143.
DR   EnsemblGenomes-Gn; EBG00001179144.
DR   EnsemblGenomes-Gn; EBG00001179145.
DR   EnsemblGenomes-Gn; EBG00001179146.
DR   EnsemblGenomes-Gn; EBG00001179147.
DR   EnsemblGenomes-Gn; EBG00001179148.
DR   EnsemblGenomes-Gn; EBG00001179149.
DR   EnsemblGenomes-Gn; EBG00001179150.
DR   EnsemblGenomes-Tr; EBG00000038905-1.
DR   EnsemblGenomes-Tr; EBG00000038906-1.
DR   EnsemblGenomes-Tr; EBG00000038907-1.
DR   EnsemblGenomes-Tr; EBG00000038908-1.
DR   EnsemblGenomes-Tr; EBG00000038909-1.
DR   EnsemblGenomes-Tr; EBG00000038910-1.
DR   EnsemblGenomes-Tr; EBG00000038911-1.
DR   EnsemblGenomes-Tr; EBG00000038912-1.
DR   EnsemblGenomes-Tr; EBG00000038913-1.
DR   EnsemblGenomes-Tr; EBG00000038914-1.
DR   EnsemblGenomes-Tr; EBG00000038915-1.
DR   EnsemblGenomes-Tr; EBG00000038916-1.
DR   EnsemblGenomes-Tr; EBG00000038917-1.
DR   EnsemblGenomes-Tr; EBG00000038918-1.
DR   EnsemblGenomes-Tr; EBG00000038919-1.
DR   EnsemblGenomes-Tr; EBG00000038920-1.
DR   EnsemblGenomes-Tr; EBG00000038921-1.
DR   EnsemblGenomes-Tr; EBG00000038922-1.
DR   EnsemblGenomes-Tr; EBG00000038923-1.
DR   EnsemblGenomes-Tr; EBG00000038924-1.
DR   EnsemblGenomes-Tr; EBG00000038925-1.
DR   EnsemblGenomes-Tr; EBG00000038926-1.
DR   EnsemblGenomes-Tr; EBG00000038927-1.
DR   EnsemblGenomes-Tr; EBG00000038928-1.
DR   EnsemblGenomes-Tr; EBG00000038929-1.
DR   EnsemblGenomes-Tr; EBG00000038930-1.
DR   EnsemblGenomes-Tr; EBG00000038931-1.
DR   EnsemblGenomes-Tr; EBG00000038932-1.
DR   EnsemblGenomes-Tr; EBG00000038933-1.
DR   EnsemblGenomes-Tr; EBG00000038934-1.
DR   EnsemblGenomes-Tr; EBG00000038935-1.
DR   EnsemblGenomes-Tr; EBG00000038936-1.
DR   EnsemblGenomes-Tr; EBG00000038937-1.
DR   EnsemblGenomes-Tr; EBG00000038938-1.
DR   EnsemblGenomes-Tr; EBG00000038939-1.
DR   EnsemblGenomes-Tr; EBG00000038940-1.
DR   EnsemblGenomes-Tr; EBG00000038941-1.
DR   EnsemblGenomes-Tr; EBG00000038942-1.
DR   EnsemblGenomes-Tr; EBG00000038943-1.
DR   EnsemblGenomes-Tr; EBG00000038944-1.
DR   EnsemblGenomes-Tr; EBG00000038945-1.
DR   EnsemblGenomes-Tr; EBG00000038946-1.
DR   EnsemblGenomes-Tr; EBG00000038947-1.
DR   EnsemblGenomes-Tr; EBG00000038948-1.
DR   EnsemblGenomes-Tr; EBG00000038949-1.
DR   EnsemblGenomes-Tr; EBG00000038950-1.
DR   EnsemblGenomes-Tr; EBG00000038951-1.
DR   EnsemblGenomes-Tr; EBG00000038952-1.
DR   EnsemblGenomes-Tr; EBG00000038953-1.
DR   EnsemblGenomes-Tr; EBG00000038954-1.
DR   EnsemblGenomes-Tr; EBG00000038955-1.
DR   EnsemblGenomes-Tr; EBG00000038956-1.
DR   EnsemblGenomes-Tr; EBG00000038957-1.
DR   EnsemblGenomes-Tr; EBG00000038958-1.
DR   EnsemblGenomes-Tr; EBG00000622818-1.
DR   EnsemblGenomes-Tr; EBG00000622819-1.
DR   EnsemblGenomes-Tr; EBT00001758922.
DR   EnsemblGenomes-Tr; EBT00001758923.
DR   EnsemblGenomes-Tr; EBT00001758924.
DR   EnsemblGenomes-Tr; EBT00001758925.
DR   EnsemblGenomes-Tr; EBT00001758926.
DR   EnsemblGenomes-Tr; EBT00001758927.
DR   EnsemblGenomes-Tr; EBT00001758928.
DR   EnsemblGenomes-Tr; EBT00001758929.
DR   EnsemblGenomes-Tr; EBT00001758930.
DR   EnsemblGenomes-Tr; EBT00001758931.
DR   EnsemblGenomes-Tr; EBT00001758932.
DR   EnsemblGenomes-Tr; EBT00001758933.
DR   EnsemblGenomes-Tr; EBT00001758934.
DR   EnsemblGenomes-Tr; EBT00001758935.
DR   EnsemblGenomes-Tr; EBT00001758936.
DR   EnsemblGenomes-Tr; EBT00001758937.
DR   EnsemblGenomes-Tr; EBT00001758938.
DR   EnsemblGenomes-Tr; EBT00001758939.
DR   EnsemblGenomes-Tr; EBT00001758940.
DR   EnsemblGenomes-Tr; EBT00001758941.
DR   EnsemblGenomes-Tr; EBT00001758942.
DR   EnsemblGenomes-Tr; EBT00001758943.
DR   EnsemblGenomes-Tr; EBT00001758944.
DR   EnsemblGenomes-Tr; EBT00001758945.
DR   EnsemblGenomes-Tr; EBT00001758946.
DR   EnsemblGenomes-Tr; EBT00001758947.
DR   EnsemblGenomes-Tr; EBT00001758948.
DR   EnsemblGenomes-Tr; EBT00001758949.
DR   EnsemblGenomes-Tr; EBT00001758950.
DR   EnsemblGenomes-Tr; EBT00001758951.
DR   EnsemblGenomes-Tr; EBT00001758952.
DR   EnsemblGenomes-Tr; EBT00001758953.
DR   EnsemblGenomes-Tr; EBT00001758954.
DR   EnsemblGenomes-Tr; EBT00001758955.
DR   EnsemblGenomes-Tr; EBT00001758956.
DR   EnsemblGenomes-Tr; EBT00001758957.
DR   EnsemblGenomes-Tr; EBT00001758958.
DR   EnsemblGenomes-Tr; EBT00001758959.
DR   EnsemblGenomes-Tr; EBT00001758960.
DR   EnsemblGenomes-Tr; EBT00001758961.
DR   EnsemblGenomes-Tr; EBT00001758962.
DR   EnsemblGenomes-Tr; EBT00001758963.
DR   EnsemblGenomes-Tr; EBT00001758964.
DR   EnsemblGenomes-Tr; EBT00001758965.
DR   EnsemblGenomes-Tr; EBT00001758966.
DR   EnsemblGenomes-Tr; EBT00001758967.
DR   EnsemblGenomes-Tr; EBT00001758968.
DR   EnsemblGenomes-Tr; EBT00001758969.
DR   EnsemblGenomes-Tr; EBT00001758970.
DR   EnsemblGenomes-Tr; EBT00001758971.
DR   EnsemblGenomes-Tr; EBT00001758972.
DR   EnsemblGenomes-Tr; EBT00001758973.
DR   EnsemblGenomes-Tr; EBT00001758974.
DR   EnsemblGenomes-Tr; EBT00001758975.
DR   EnsemblGenomes-Tr; EBT00001758976.
DR   EnsemblGenomes-Tr; EBT00001758977.
DR   EnsemblGenomes-Tr; EBT00001758978.
DR   EnsemblGenomes-Tr; EBT00001758979.
DR   EnsemblGenomes-Tr; EBT00001758980.
DR   EnsemblGenomes-Tr; EBT00001758981.
DR   EnsemblGenomes-Tr; EBT00001758982.
DR   EnsemblGenomes-Tr; EBT00001758983.
DR   EnsemblGenomes-Tr; EBT00001758985.
DR   EnsemblGenomes-Tr; EBT00001758989.
DR   EnsemblGenomes-Tr; EBT00001758992.
DR   EnsemblGenomes-Tr; EBT00001758993.
DR   EnsemblGenomes-Tr; EBT00001758995.
DR   EnsemblGenomes-Tr; EBT00001758996.
DR   EnsemblGenomes-Tr; EBT00001758997.
DR   EuropePMC; PMC1489667; 16751554.
DR   EuropePMC; PMC1950976; 17557843.
DR   EuropePMC; PMC2266912; 18226217.
DR   EuropePMC; PMC2292606; 18263752.
DR   EuropePMC; PMC2394895; 18326675.
DR   EuropePMC; PMC2620714; 19011059.
DR   EuropePMC; PMC3147472; 21642401.
DR   EuropePMC; PMC3406152; 22660709.
DR   EuropePMC; PMC3754576; 23749981.
DR   EuropePMC; PMC3796525; 24155888.
DR   EuropePMC; PMC3837482; 24294095.
DR   EuropePMC; PMC3907030; 24279426.
DR   EuropePMC; PMC3957732; 24600043.
DR   EuropePMC; PMC4070871; 24888481.
DR   EuropePMC; PMC4448311; 25928324.
DR   EuropePMC; PMC4510166; 26048934.
DR   EuropePMC; PMC4676552; 26582551.
DR   GOA; Q45218.
DR   InterPro; IPR001080; 3Fe4S_ferredoxin.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00435; ROSE.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01059; mir-598.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01723; Rhizobiales-2.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01736; flg-Rhizobiales.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   SILVA-LSU; BA000040.
DR   SILVA-SSU; BA000040.
DR   StrainInfo; 84001; 1.
DR   UniProtKB/Swiss-Prot; Q45218; FE45_BRADU.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..9105828
FT                   /organism="Bradyrhizobium diazoefficiens USDA 110"
FT                   /strain="USDA110"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:224911"
FT   CDS_pept        102..428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0001"
FT                   /note="ORF_ID:blr0001"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45266"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45266"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YF1"
FT                   /protein_id="BAC45266.1"
FT                   /translation="MSIRTSVMFADRLKDYNLALATVLQSVNSFELVGVGLVLDVPTDI
FT                   ASRRIFSNRTSASWSNEARNLQVVGAGWRCSAVLRKSLRSMQKHHSGGTPDSSLFPSAT
FT                   NSCS"
FT   CDS_pept        484..1023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0002"
FT                   /note="ORF_ID:blr0002"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45267"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45267"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YF0"
FT                   /protein_id="BAC45267.1"
FT                   /translation="MSPLEAITRWLDSQDLGMQLEIAGFATFLVFGDDDTFTLGDSEQL
FT                   ESLYRWLNEPSLASGIAAERALTFRVYFASLAEDRSTGAGWKRTEVLVRRILKDATRDG
FT                   RFAAARKAQRMLELLPARKESWNQVVRSWNELAATYLTHEALSSWSAAEKLRGLRAISS
FT                   TSVPVAGLGSPHRGAA"
FT   CDS_pept        3089..3682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0003"
FT                   /note="ORF_ID:blr0003"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45268"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45268"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YE9"
FT                   /protein_id="BAC45268.1"
FT                   /translation="MVNAGGVVVAPPVGMGRHHATGGTVGGHIGYRWQIANSVFGLETQ
FT                   GNWADFKGSNANLAFAGVRDDSTLDAFGLFTGQVGYAWNNVLLYVRGGAAVVRDKYRVS
FT                   DFATGLTIDNGSETRWGGTVGAGLEFGFAPNWSIGVEYDHLFMGRRDVDFFFSPGLVGV
FT                   PVGTFAGTARIGQDVDIGLVRVNYRWGGVIATTY"
FT   CDS_pept        4239..4391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0004"
FT                   /note="ORF_ID:bsr0004"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45269"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45269"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YE8"
FT                   /protein_id="BAC45269.1"
FT                   /translation="MGHNVDDVMACVIVAADLCARSACRTPAGADQLGAPRRADAKSRE
FT                   VDRQR"
FT   CDS_pept        complement(4427..4750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0005"
FT                   /note="ORF_ID:bll0005"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45270"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45270"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YE7"
FT                   /protein_id="BAC45270.1"
FT                   /translation="MGLVNHLHEVNQRNTATPLSRRMFSMIATAAPLLGLEGITITQSE
FT                   VVKRGNPVKGGHLHCSPVGSGKPICSSSPFAFDFVADPLAVFLGRGFAEVIYYEQTLAM
FT                   RLG"
FT   CDS_pept        complement(4972..6054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /product="ribonucleoside-diphosphate reductase beta
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="ORF_ID:bll0006"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45271"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45271"
FT                   /db_xref="GOA:Q89YE6"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YE6"
FT                   /protein_id="BAC45271.1"
FT                   /translation="MPRMSVIDLSRADPRTLIGKGRVGLLDSTGSYDVDRYAWAYEFWK
FT                   RQQQTHWMGEEVPLGADLNDWASGRVTDSERALLTQIFRFFTQSDIEVGDNYFKRYIPI
FT                   FQPLTVQMMMAAFTNMETVHIDAYALLLKTLGMPKTEFEAFRGYAQMRAKADYMHEFGV
FT                   DSVADVARTLAMFGAFTEGMALFASFAMLLNFPRHNKMNGMGQIVSWSVRDESLHCEGI
FT                   IKLFHEWHRETGAVTRPVRDDIVDVAKTMVKLEENFVELAFGLGKIEGMLPEHIHAYVR
FT                   YVADWRLAQLRIAPVFGFFEAKEGGFTQLKAHPLPWLVEILNGVEHANFFEQRATEYSK
FT                   AASRGSWDGEDGVWATFGRI"
FT   CDS_pept        complement(6036..8207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0007"
FT                   /note="ORF_ID:bll0007"
FT                   /note="probable ribonucleoside-diphosphate reductase (EC
FT                   1.17.4.1)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45272"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45272"
FT                   /db_xref="GOA:Q89YE5"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YE5"
FT                   /protein_id="BAC45272.1"
FT                   /translation="MLGGNPLCRQRLFRGISATALGRPTAAATREPGNLPRQNPCPRAG
FT                   CPVGRLQPGTFARSPRKSSARSQPPNITGLPMSASYDFDQYGHLIELPSVRQPSAQAKP
FT                   TTPELCLVQPPALPAPLPRPPARSPTPSDLSLDRSRDDLLTSFGRLTLTDRYLLAGEGL
FT                   QDMFARVSCAFADNVAHAQRLYDAMSRLWFMPATPVLSNGGTTRGLPISCFLNSVSDSL
FT                   EGIVGTWNENVWLASNGGGIGTYWGNVRSIGEKARGGVTSGIIPFIHVTDGLTLAISQG
FT                   SLRRGSAAVYLDIHHPEIEEFLEIRKASGDFNRKSLNLHHGINVTDEFMCAVGAGTAFA
FT                   LRSPKTNEVVREIDARQLWQRILENRLQTGEPYLLFIDTVNRALPKHQRELGLEVSTSN
FT                   LCSEITLSTGIDHRGEERTAVCCLSSLNLETWDQWNEEPGFIEDVMRFLDNVLTHFITV
FT                   APDGMKRARYAALRERSVGLGVMGFHSFLQAKGIPMEGTLAKSFNLNMFRKLRREADAA
FT                   SVALARERGPCPDALERGVMARFSHKIAIAPTASISIICGGTSACTEPIPANIYTHKTL
FT                   SGAISVRNPHLAKVLAAKGADTSATWESIIAHDGSVAHLDVLSEHEKAIFRTAFEIDQR
FT                   WIVELAADRAALICQSQSINLYLPADVDKWDLHMLHWTAWKRGVKSLYYCRSKSISRAA
FT                   FAGKIAGDATPTQQPARQRTDYEECLACQ"
FT   CDS_pept        complement(8380..8688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0008"
FT                   /note="ORF_ID:bll0008"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45273"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45273"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YE4"
FT                   /protein_id="BAC45273.1"
FT                   /translation="MARRVWLPKPDPAQLNSRTANRSMPTFRMSRVAVPLLENLRRHFQ
FT                   RFEHILADRRRWVVERTFAWLGRCGHLCKDFEGSAATELAWPLVAHLRLLTRRLARP"
FT   CDS_pept        complement(8962..9714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0009"
FT                   /note="ORF_ID:bll0009"
FT                   /note="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45274"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45274"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YE3"
FT                   /protein_id="BAC45274.1"
FT                   /translation="MHPASPRRCIHSAHRQMCRCHAPPWKANAKTEPRNDFMTEESDIR
FT                   SANANIRASTVWTIVLGFAADPLMRWSWPDPRQYLRSMPQFIDACGGRAFAHGTAYVAG
FT                   EIRGAALWLPPNVQQDEEALDAIMALSLRPEITEDMAHLRRRMAEHRPHEPHWYLPLIA
FT                   VDPNWVGKGLGTLLMNYALQRCDEDGIVAYLESSNPENIPFYQRHGFKVVGEIQHGSSP
FT                   PLTPMLRTASFRPSKAAPPDRLVTQTQA"
FT   CDS_pept        complement(10345..10743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0010"
FT                   /note="ORF_ID:bll0010"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45275"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45275"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YE2"
FT                   /protein_id="BAC45275.1"
FT                   /translation="MLPRRLQFSKTERNNMTHHVDLGPGVASIPAPRNLPNRSDQGVSW
FT                   NKSYEAINACGQKPLLRELLTQLRQPAVFPTMARIAADTTDLGVKYDEGTTATFSLDRA
FT                   NAVVRAIDTPDDQSMHESSRAIPSCVVQ"
FT   CDS_pept        complement(10872..11492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0011"
FT                   /note="ORF_ID:bll0011"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45276"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45276"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YE1"
FT                   /protein_id="BAC45276.1"
FT                   /translation="MPFMPAEGDRWDGEDRRRHPHRRSVFQRARRTPGAYANPAVARQP
FT                   RGLTRDHSANLPFANGGEQLLETGTRGAATRATEFVVDCGHLAPAQLPGKVGQAVLAAL
FT                   ALAVVDDLVCRRLANVDDGLKADPPLPVDRLLEARLLAAILDRLLHHRHVLTIRGDSYR
FT                   LRAKSGFIKPPTAGDGRPVGSASLRPVTGGSDHQTSDGGGSSS"
FT   CDS_pept        11482..11955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0012"
FT                   /note="ORF_ID:blr0012"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45277"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45277"
FT                   /db_xref="GOA:Q89YE0"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YE0"
FT                   /protein_id="BAC45277.1"
FT                   /translation="MKGTMSEMELSIVRQRSLEALEQKARRGELFLNVAIGYLKVSNDR
FT                   IDKDPDRRIQEALALVFTKFAEMQTPRQVHLCLRQERITLPGGRPWPRGPPRRMEVTSV
FT                   QYDLPHPDQSRLCWRLCLRALGQSGDDRGRPQEDRAGLPARAQRLGGFDQGPP"
FT   CDS_pept        12282..12815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0013"
FT                   /note="ORF_ID:blr0013"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45278"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45278"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YD9"
FT                   /protein_id="BAC45278.1"
FT                   /translation="MEARGCEHADKLRQLELTLEQARYEATRAPRRYEAVDSDNRLVAG
FT                   ELERRWNERLVAVRELEGKRDTLLATPEMTLSDIDRDRLLALDSELKRAWESPGATAAT
FT                   RNRIIRSFINEIVVRMRDEVLDLIVHWHGGDHTALQVRRNRTGEHRGGCGRSRSCPRAS
FT                   DARQHHRRGSQPRQ"
FT   CDS_pept        complement(13421..13804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0014"
FT                   /note="ORF_ID:bll0014"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45279"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45279"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YD8"
FT                   /protein_id="BAC45279.1"
FT                   /translation="MTRYTGRSRSASLGSPRELARVVGNDCAVEIDTNNYGTLAADQRA
FT                   RGGDGRGWRGAHPPWHARGCGHRQSEDRRLRIVEFAHLDGVACRDGAVCQPATATPTVP
FT                   APSPLPSLLRPLAEYEATIGGSF"
FT   CDS_pept        complement(13680..14069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0015"
FT                   /note="ORF_ID:bll0015"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45280"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45280"
FT                   /db_xref="GOA:Q89YD7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YD7"
FT                   /protein_id="BAC45280.1"
FT                   /translation="MSRSVQFDDKLITFAKHWGFRPRACAPYRARTKGKTENGVRYVKK
FT                   SVIAGHSFASWEAFETHLAEWEGGVANVRIHGTTGVAPITRFACDEVHRSKPLGVARIA
FT                   ARTGPRRRQRLCCRDRYEQLRYPGG"
FT   CDS_pept        complement(14066..14329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0016"
FT                   /note="ORF_ID:bsl0016"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45281"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45281"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YD6"
FT                   /protein_id="BAC45281.1"
FT                   /translation="MQPYRQALKAEALATTRFETPPGRQLQIDFGERLVDIGGAKVKAF
FT                   VFVATRAEKQEHWFAGLESAFTTLPEEVLKDNPRALVVRHDR"
FT   mobile_element  14651..16014
FT                   /mobile_element_type="insertion sequence:RSbeta1"
FT   CDS_pept        14685..15044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0017"
FT                   /note="ORF_ID:blr0017"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45282"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45282"
FT                   /db_xref="GOA:Q79V32"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q79V32"
FT                   /protein_id="BAC45282.1"
FT                   /translation="MDFLPDSGEDSCCESGAKMTKKSRRTHSPAFKAKVALAAVKGDKT
FT                   LAELAQLFDVHPNQITIWKNQLLEGAAGVFGHDKTSAETPVDLKALHAKIGELALENDF
FT                   LSGALTKAGLLSAKR"
FT   CDS_pept        15041..15868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0018"
FT                   /note="ORF_ID:blr0018"
FT                   /note="RSbeta"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45283"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45283"
FT                   /db_xref="GOA:Q79V31"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q79V31"
FT                   /protein_id="BAC45283.1"
FT                   /translation="MIDRGHDLSIVRQAKVLKLARSTVYYEPRPVSAEDLALMRRLDEL
FT                   HLDYPFAGARMLRSLLRREGVYAGRRHIATLMKRMGIEAVYRRPNTSKPAPGHKIYPYL
FT                   LRGLKIERPDHAWAMDITYIPMRRGFVYLAAVVDVFSRRVLAHRVSITMEAAFCVQAVQ
FT                   EALAKHGRPEIFNTDQGSQFTSLEFTDVLLDAKIAISMDGKGAWRDNVFVERLWRTVKY
FT                   EEVYLRAYDSVSEARASIAKYLAFYNQGRPHSSLDGRTPDEAYFGTQAMVMAA"
FT   CDS_pept        16189..16518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0019"
FT                   /note="ORF_ID:blr0019"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45284"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45284"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YD5"
FT                   /protein_id="BAC45284.1"
FT                   /translation="MGELQPSWDVKQHAPCSMRSAFSYDRCRYCRSGWQQPCALHDNIL
FT                   RNAVQRGLADGPNLTRLNANGRSKRLPLLGVKSRNSVEELARTSTTKNQWGRETMQSRG
FT                   LATGI"
FT   CDS_pept        complement(17139..18371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0020"
FT                   /note="ORF_ID:bll0020"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45285"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45285"
FT                   /db_xref="GOA:Q89YD4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YD4"
FT                   /protein_id="BAC45285.1"
FT                   /translation="MAEQKQGPAAKFLKWMIAKHPDALFAFIRRVRPNLALGAAGPVFI
FT                   TRFPDVQEALSRPDIFNVTYAPMMDPSVGPFMLGRDCTEINQRDKGIMRAFMRMEDLPA
FT                   IRQKVRSLANASVEKQIYTQNQIEVVSTLSRLVPIQLTREYFGFPGPDLASMFRWSRAT
FT                   QYDMFHNLDKDPKVHQDNIDAGQEMRAYLTQLLPQRREQLKNGAPLEDVFSRLLNSHFD
FT                   DSIGFADERIITNMMGTLVGGIETTSAAIVQLLDELFKRPRILKEAIDVASSNNDHLMY
FT                   RYCWEALRFNPINPFVVRHCRTDYRIAKGSLRATTIKAGSTVLISTRSAMRDGLQLPAP
FT                   SSFAIDRPESVYMHLGYGMHTCLGDQISRIQVPEIVRRILQIRGVRPAAEIDYAGGPFP
FT                   ERYPITYDTPV"
FT   CDS_pept        complement(18497..20497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0021"
FT                   /note="ORF_ID:bll0021"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45286"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45286"
FT                   /db_xref="GOA:Q89YD3"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YD3"
FT                   /protein_id="BAC45286.1"
FT                   /translation="MSTVTSAIRRLWWRRFLVLLAIIVVIALIAVMTSSQLGATIEALT
FT                   PPGLPEPVSASEQVSLDQGWNAEDADRFHHKAQGTQTLPIPLSWFLALEAPLNSPFAIP
FT                   FFKRERFSDNRYLLRFGFIESAESENNEYGLPIGFAYSPFQSIRGLSRKETAVGLTCAA
FT                   CHTGQLIFKEKRYVIEGGPAVTDLGQLTNALRAALAQTALSAKLPFFDGRFGRFAKRVL
FT                   GTEYSDLTRVQLSKELDGILGALIDQPAGIDVTEGFTRLDALNRIGNQVFALDPKRYGN
FT                   YVNLNAPVSYPHIWTSSWFDWVQYDGSIMQPLVRNAGEAMGVSAELNLTAPPKGGRFAS
FT                   SIPFDNLHWIEQQLAGKDLPLVAKAFTGLNAPAWPDSFPAIDKAKAAVGAQLYDKHCSG
FT                   CHLPALTPDIVHGKAPDAEFWKNFGPIRWRGRDGQEKQTRESVLNVKIIKQSHIGTDPA
FT                   QGDVLRNRTVDTAGSELARAGQSSPGLGLDIDVCQRKADNTLDTIHLSDHAMQLYALAL
FT                   GAVVQSGIDEWLRSTGTVQAEIEGDRPNCLAAGFGYKARPLNGVWATAPFLHNGSVPTI
FT                   YDLLSPVAERPQVFLLGEPSFDPVRVGIVTRTVAPEGRTYDSKGYFIIDTSRPANRNTG
FT                   HEFSNEKHEGVIGPALSPEERNAIIEFLKSI"
FT   CDS_pept        21525..21815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0022"
FT                   /note="ORF_ID:bsr0022"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45287"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45287"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YD2"
FT                   /protein_id="BAC45287.1"
FT                   /translation="MLRLELNDLLEGGFEPLDDLHEAVQALLDHPRRRRRRLRRPAARR
FT                   ADPSDQVCIVAVEMVEVESTSASSPPETSASRHRKLWQYSENGTIPGTDDT"
FT   mobile_element  21909..23091
FT                   /mobile_element_type="insertion sequence:ISBj5_1"
FT   CDS_pept        21972..23081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0023"
FT                   /note="ORF_ID:blr0023"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45288"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45288"
FT                   /db_xref="GOA:Q89YD1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YD1"
FT                   /protein_id="BAC45288.1"
FT                   /translation="MANAGVKGRPIAPLVLSSQERAYLERQVRRHRVARSLSERCRAIL
FT                   RCAVGLPSKSVAAELGIHEHTVGKWRRRFLKDRCDGLLDEARPGRPRTIDDDQVAEVIE
FT                   RTLRTTPPDATHWSIRSMAADTGFSHTTIRRMWTAFGLQPHRSQTFKLSSDPLFVDKVR
FT                   DIVGLYLSPPNRAVVLSVDEKSQIQALDREQPVLPMMPGVPERRTHSYVRHGTTTLFAA
FT                   LDVASGFVIGKCYKRHRALEFLKFLKEIDAQIPEGLAVHIVMDNYATHKTPKIKAWLAR
FT                   RPHYHVHFTPTSASWINQIERWFAELTRKQIRRGVHTSVRQLEADIRTFIELHNNNPKP
FT                   FKWTKSADQILASVKRFCHKAQQTLCGEL"
FT   CDS_pept        23634..24011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0024"
FT                   /note="ORF_ID:blr0024"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45289"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45289"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YD0"
FT                   /protein_id="BAC45289.1"
FT                   /translation="MAITPISHPNAVRRWRGVATSAMSISNVYKEVKARSSSATQPSAV
FT                   APREGKRLEQPRQPLTEHGAVVAAGLVAQGASNPALADAGRADDEQVLMPVDPLAGDEL
FT                   LEQRLVEPARRLHVDSRSSPN"
FT   CDS_pept        complement(24726..26486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0025"
FT                   /note="67 kDa Myosin-crossreactive streptococcal antigen
FT                   homolog"
FT                   /note="ORF_ID:bll0025"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45290"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45290"
FT                   /db_xref="GOA:Q89YC9"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YC9"
FT                   /protein_id="BAC45290.1"
FT                   /translation="MYYTSGNYEAFARPRKPAGVDSKTAWFVGSGLAALSGAAFLIRDG
FT                   QLRGDRITILERQTVPGGALDGCQDPERGFVIRGGREMEDHFECLWDLFRSIPSLELEG
FT                   ASVLDEFYWLNKDDPNYTLRRATVKQGQDAHTDGLFTLSEQAQKELIALFLATRKQMET
FT                   KRIDEVFGRDFFNSNFWLYWRTMFAFEEWHSALEMKLYLHRFIHHIGGLPDFSTLKFTK
FT                   YNQYESLVLPLSKWLLAQGVNFRYGVGVTDIDFDIKRGRKQATAIRWLENGIEGSLIIG
FT                   ADDLVFMTIGSLTENSDMGDHHTAARLNEGPAPAWDLWRRIAAKDAAFGRPNVFCGNIP
FT                   ASKWESATITTLDKRIPAYIRKIAKRDPFSGKVVTGGIVTVKDSSWLLSWTTNRQPHFK
FT                   RQPSDQVVVWVYSLFVDKAGDYVRKPMQDCTGEEITQEWLYHLGVPVASIPELAAGAAK
FT                   TVPVMMPYVTSFFMPRQAGDRPDVVPKDAVNFAFIGQFAESGERDCIFTTEYSVRTAME
FT                   AVYILLKIERGVPEVFNSTYDIRKLLAAMGRLRDGNEIEIPGPAFLRELILKKIEATEL
FT                   GELLNKYHLR"
FT   CDS_pept        complement(26532..27290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0026"
FT                   /note="ORF_ID:bll0026"
FT                   /note="probable dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45291"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45291"
FT                   /db_xref="GOA:Q89YC8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YC8"
FT                   /protein_id="BAC45291.1"
FT                   /translation="MGRVSEKVILVTGGAQGMGAAHARLLVAEGAKVVITDILDNEGAT
FT                   FAAELGPSAIYVRQDVAQPGEWCQAIAAAEGKFGAVHGLVNNAGIASMAPIERFPLEQW
FT                   EKTLAVNLTGVFLGMQTALPAMRRAGGGSIVNISSVEGMRGSPGLHAYVASKFGVRGIT
FT                   KSAALEAAASGVRINSIHPGFINTRMTENIDLSSFPIPLARPAEPQEVSQAVLFLLSDE
FT                   SSYLTGSEIVVDGGLTIGVPQKGQAVENIF"
FT   CDS_pept        27698..27958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0027"
FT                   /note="ORF_ID:bsr0027"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45292"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45292"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YC7"
FT                   /protein_id="BAC45292.1"
FT                   /translation="MLSSLWIEKWGAERMRFSLVLRIGVSIPCNRRAETLMGSQPHVTL
FT                   AQAPEVFRLSTETAMSGPAFSTMRSDNVTLIWFNRGCCENS"
FT   CDS_pept        28473..29315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0028"
FT                   /note="ORF_ID:blr0028"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45293"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45293"
FT                   /db_xref="GOA:Q89YC6"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YC6"
FT                   /protein_id="BAC45293.1"
FT                   /translation="MNSSISNRANCSEIKEDAMPDVKGIPLDAPLYHGGKNRGGAFLGC
FT                   QAINLMFSVGHEANCLLPKELAPAANPAIAIVGVASYRSSTVGPYLECYSGIQVRDPDG
FT                   ETGYYIPYIYVTVNDAALASGREVLGAPKKLAHIRLIREGGLIQGTLERPKGKRLLTLT
FT                   AQPDERMSSDSRQMYSARTNFYSVRQLPPIIESGKGEVTQLVKWCTDRTLRRDERGEEV
FT                   LFTGPTSLTYDSPSIIDPVHNLTVGQALLGTYEEYDARLEAIDILSEESNPVNDDRRA"
FT   CDS_pept        29412..29699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0029"
FT                   /note="ORF_ID:bsr0029"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45294"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45294"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YC5"
FT                   /protein_id="BAC45294.1"
FT                   /translation="MVDKAGFKTHVYNKNSGNKEKKADVAIATAMMDGRSTSSTRTTTI
FT                   SCWLPRQKQTKELRRTCRLRAQKRKPAFLCSSLRPPQRAFKKNDIAVDSF"
FT   CDS_pept        29792..31372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0030"
FT                   /product="recombinase"
FT                   /note="ORF_ID:blr0030"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45295"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45295"
FT                   /db_xref="GOA:Q89YC4"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YC4"
FT                   /protein_id="BAC45295.1"
FT                   /translation="MGNTLVVHAKRLPQSQKARRAAQYVRMSTDYQQYSIENQAVVIAT
FT                   YAELHKLTIVHTYRDEGESGLRIENRGGLTELVEDVQSGRADFAHLLVFDVSRWGRFQD
FT                   VDESAHYEFICRRAGVEVAYCAEQFDNDGSLLASIMKNIKRVMAAEFSRELSAKVFAGS
FT                   VRLTHRGFKMGGPTAYAFQRRLVDDQCRPKGILTIGQRKSLLTDHVKLIPGAPDQVEIV
FT                   NWILHEYLRHKSQATIARELNQRGILNSQGRPWLGKAVGDLLRNEAYIGVLTYNRKSRK
FT                   LGAKVTRNPRELWIRKENAIEPIVHRDAFRRAQKIMGEGRVSIPEEEMLLRLRKVLMKK
FT                   GKLSKTIINSSPGLPSMSSYVLHFGALRNIYRLIGYNGNQEWFDKYASHQRWAALQLSN
FT                   AARLRDAFERLGRSATLNASTECLRIDNVVNVVFRVARCRNYENRPLRWTLQYRVRWPK
FT                   GWVVAVRLDEKNEAIFDYVLMPSAWLTFSRRMFWFSKEVYKGRTINRFDTFEALSRFLI
FT                   ECVGKEKPS"
FT   CDS_pept        complement(31338..31715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0031"
FT                   /note="ORF_ID:bll0031"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45296"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45296"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YC3"
FT                   /protein_id="BAC45296.1"
FT                   /translation="MASIASSGTVRRLSQKPVSFMRVQIVCLSSHPLLARVFAADALAG
FT                   LRDLYEPLAVPDDPPGVLKDAVQALAATVNGRGVPGAATWPGYAFLVQGSCDVAWRVAA
FT                   FNGFFICGVRLTKAFPCRRIR"
FT   CDS_pept        complement(31759..31944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0032"
FT                   /note="ORF_ID:bsl0032"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45297"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45297"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YC2"
FT                   /protein_id="BAC45297.1"
FT                   /translation="MRDLIIEAFDSVIRCEIAEADDVRKEIAQRGAYWAGDEIWKLGRQ
FT                   VAALRKRIAELEETDA"
FT   CDS_pept        32239..32472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0033"
FT                   /note="ORF_ID:bsr0033"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45298"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45298"
FT                   /db_xref="GOA:Q89YC1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YC1"
FT                   /protein_id="BAC45298.1"
FT                   /translation="MKRRIKPNSQMADYEVVLTFDDGPRPPNTDKVLAALAQECARATF
FT                   FLVGRSSAEFPELVRRMAAQGHTVAHHSCRST"
FT   CDS_pept        32885..33310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0034"
FT                   /note="ORF_ID:blr0034"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45299"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45299"
FT                   /db_xref="GOA:Q89YC0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YC0"
FT                   /protein_id="BAC45299.1"
FT                   /translation="MTDHMPMPKVSRLEVVSTGARRRWTLEEKQRIVTESYGGPRLVSV
FT                   TARRNGLSTSQLFTWRRLAREGKLSGDAAPVLVPVEMTPAAAPISSGAPQPVSSPPAQR
FT                   ARAGIIEIELGGGCRVRVDRDVDAEALQRVLELLRRR"
FT   CDS_pept        33307..33663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0035"
FT                   /note="ORF_ID:blr0035"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45300"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45300"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YB9"
FT                   /protein_id="BAC45300.1"
FT                   /translation="MIPIPSGVRVWIATGHTDMRRGMQSLALAVQESLKRDPHAGDLYI
FT                   FRGRRGDLVKILWHDGLGMSLYAKRLDRGKFIWPSASDGAVSISAAQMGPETKGPKREN
FT                   PKHLEFFRRTLGCR"
FT   CDS_pept        33782..33952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0036"
FT                   /note="ORF_ID:bsr0036"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45301"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45301"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YB8"
FT                   /protein_id="BAC45301.1"
FT                   /translation="MMRRDDSAFRLAVNKTLAELFRSGEITSLYHKWFDQFGIPLSEKL
FT                   ETVLQAQAVPQ"
FT   CDS_pept        33965..34321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0037"
FT                   /note="ORF_ID:blr0037"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45302"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45302"
FT                   /db_xref="GOA:Q89YB7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030202"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YB7"
FT                   /protein_id="BAC45302.1"
FT                   /translation="MLSYNWNWSILFQQPQLGWLLEGLRLTIVMAVVSFLLALAIGTLV
FT                   GTARTARSRAVRGIGFVYTALFRNVPLLIQMFLWFYVFPELLPSNLGRWVKRDWACLSS
FT                   LMAIDTYGWSSTLE"
FT   CDS_pept        34579..34860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0038"
FT                   /note="ORF_ID:bsr0038"
FT                   /note="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45303"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45303"
FT                   /db_xref="GOA:Q89YB6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YB6"
FT                   /protein_id="BAC45303.1"
FT                   /translation="MKTRAIVAWNVRRIRVNRGISQEQLAWKAGIDRSYMSSLERQSKN
FT                   PTIDLLDRIAETLDVQLSEFFVLPPKGARSPKTLPKSRKPAGPRRKKK"
FT   CDS_pept        35259..35498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0039"
FT                   /note="ORF_ID:bsr0039"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45304"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45304"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YB5"
FT                   /protein_id="BAC45304.1"
FT                   /translation="MISGCPGCGKSTLLTELGRRGYATIDEPGRPVVRKELESGVPALP
FT                   GTGIEARLHSAFDLSLENLTRASAFDGWVYSIAA"
FT   CDS_pept        complement(35827..36150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0040"
FT                   /note="ORF_ID:bll0040"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45305"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45305"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YB4"
FT                   /protein_id="BAC45305.1"
FT                   /translation="MRVCDCSICSKRGALIYRVAEGDFRLLTPLQELSVYRWGLFTAAD
FT                   YFCPVCGILPFRKPSQPTAAEREAGIRPFDGWAVNVRCLKDFDPFSVPVRQIHGSRLTI
FT                   DSP"
FT   CDS_pept        complement(36259..36432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0041"
FT                   /note="ORF_ID:bsl0041"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45306"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45306"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YB3"
FT                   /protein_id="BAC45306.1"
FT                   /translation="MCLKATTGISSTRVLLDSNRASKPGANQRAAPVTCWRSCGYYVFA
FT                   NRINEILSGPIR"
FT   CDS_pept        complement(36857..37297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0042"
FT                   /note="ORF_ID:bll0042"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45307"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45307"
FT                   /db_xref="GOA:Q89YB2"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YB2"
FT                   /protein_id="BAC45307.1"
FT                   /translation="MIGTKKKAQLSVYLDPDVMKALSAYAARREQSLSLIAEAAIASFL
FT                   SPDADERREAATAKRLDQIDRRIARLERDVGISVETIALFIRFWLTTTPSLPEPAAKAA
FT                   RAQAGARYDNFLAALGRRLNQGPKLRQEIPEDAQQTDSSPGE"
FT   CDS_pept        complement(37305..39332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /product="conjugal transfer protein"
FT                   /note="ORF_ID:bll0043"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45308"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45308"
FT                   /db_xref="GOA:Q89YB1"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YB1"
FT                   /protein_id="BAC45308.1"
FT                   /translation="MSDPSNHRRQERAAAMSATKILWGQVIMVFGIVLLTIWAATEWTA
FT                   WRLGFQPQLGQPWFELLHFPFYLPPAFFWWWYAYDAYAPSIFTEGAFIAASGGIIAAAV
FT                   AIGMSVWRAREAKNAETYGSARWAKAKEIEQAGLLGPDGVVLGRFERTYLRHDGPEHVL
FT                   CFAPTRSGKGVGLVIPSLLTWPGSAIVHDLKGENWQLTAGFRARHGRVLLFDPTNAKSS
FT                   AYNPLLEVRRGEWEVRDVQNIADILVDPEGSLEKRNHWEKTSHALLVGAILHVLYAEED
FT                   KTLAGVAAFLSDPKRPIETTLAAMMRTAHLGEAGVHPVVASAARELLNKSGNERSGVLS
FT                   TAMSFLGLYRDPVVAEVTRCCDWRITDIVGGERATTLYLVVPPSDINRTKPLIRLILNQ
FT                   IGRRLTEDLQAKAGRRRLLLMLDEFPALGRLDFFESALAFMAGYGIKSFLIAQSLNQIE
FT                   KAYGPNNSILDNCHVRVSFATNDERTAKRVSDALGTATEMKAMKNYAGSRLAPWLGHLM
FT                   VSRSETARPLLTPGEMMQLPPSDEIVMMSGLHPIRAKKARYYEDRRFQERIMAPPMLTK
FT                   SNGGRLDDWSSRPLPPRPRALETLNDDQTDDEDPKAADRRQQPELDRDTVENKEPLENE
FT                   FASDLVDELDEDVPRIRRMNDMMQGVARQASLDPGDDLGL"
FT   CDS_pept        complement(39329..41203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0044"
FT                   /note="ORF_ID:bll0044"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45309"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45309"
FT                   /db_xref="InterPro:IPR021795"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YB0"
FT                   /protein_id="BAC45309.1"
FT                   /translation="MRLGRLVVCAAIFPRVRNVRLRRAMCARLSTRCRDSAFRTLSRLA
FT                   MAEDSDFQPRPGRIRSSRSQRAKPFIAQALAAAQRAGGGISRAGQLVSHRHSRFGRGRA
FT                   ASVRANRLLTGRSRLVTIKTRVVRHRARSAPLATHLGYLRREGVTRDGEKAHLFGPGTE
FT                   DADPKAFAERCQNDRHHFRFIVSPEDAPDMADLKGFARELVGQMEVDLGTKLDWVGVDH
FT                   WNTQHPHVHIIVRGVAEDGQDLVISRDYIKEGMRARAQDLVTQELGLRSDLDIRRSLES
FT                   QIGAERWTQLDRQLVRDANQHGVIDLAPRPEQQPDQFHALKVGRLRHLESLGLAHQLGP
FT                   GQWSMDEAAETTLRELGERGDIIKRIHRSLTERGIERGSASYVLSGENLDVPVIGRLVD
FT                   RGLDDELKATAYAVVDGVDGRTHHIRLPDLDAAGDSAPGSIVELRKFDDARGQRRVALA
FT                   VRSDLSIEAQVTASGATWLDRQAVARDPVALGQGGFGAEVRDAMERRPEQLIGQGLAER
FT                   QARGLVFAKNLIGTLRRRELEDLGKQLAAETGQPFNPSASGEYVAGTYRQRFALASGRF
FT                   AMIDDGLGFQLVPWTPSLDKQLGRHVSGVARADGGIDWGFGRNRGLGL"
FT   CDS_pept        complement(41537..42445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0045"
FT                   /note="ORF_ID:bll0045"
FT                   /note="probable transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45310"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45310"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YA9"
FT                   /protein_id="BAC45310.1"
FT                   /translation="MQDPVARAANQAHQRSTPLFGEKPSHNSGPRNRRAAATHSGGQTG
FT                   GPCAPPVGSKTPRHDGGDRASLAVLLLTGLLVIGGPTAAVSGQRAPARSQPASDHYASH
FT                   VAEAAQRFGIPAAWIRAVMRVESNGDRRAVSPKGALGLMQLMPKTWADMRARYGLGRDP
FT                   FDPRDNILAGAAFLRELHDRYGSPGFLAAYNAGPGRYEEFRDRHRPLPAETTAYVAAIV
FT                   PFVDAEGAPGPLLLAASSRSSWTRAPLFFDHADGPSPGARAALDQPAHGGSVGTTVHDI
FT                   SAIAPQSEGLFVALSAMGRSQ"
FT   CDS_pept        complement(42450..42785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0046"
FT                   /note="ORF_ID:bll0046"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45311"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45311"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YA8"
FT                   /protein_id="BAC45311.1"
FT                   /translation="MAQIGQFTRDKSGFTGRVETLFFERILTLVPAESSDAENAPDYRI
FT                   RLGDADGPEIGAGWKRTGEKAGDYVSLVIDDPALPRPIRANLFQSGNDKAAWTLNWNRQ
FT                   PQRAERD"
FT   CDS_pept        complement(42820..43365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /product="conjugal transfer protein precursor"
FT                   /note="ORF_ID:bll0047"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45312"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45312"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YA7"
FT                   /protein_id="BAC45312.1"
FT                   /translation="MTRFGYLMLTYLAALVAGALALVHPAPRLIWNATASTPIGLYALH
FT                   PLGELRDLELVAVRLPEPIASFLADGGFLPKGLPLLKRVMALPGQTVCRSGDAITVDAV
FT                   DVGAAHEHDHRGRPLPRWSGCHTLEPGEVFLMNPTVPDSLDGRYFGALPVSSIVARAVP
FT                   LWTDEAADGRFVWRAATH"
FT   CDS_pept        complement(43362..43880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0048"
FT                   /note="ORF_ID:bll0048"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45313"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45313"
FT                   /db_xref="InterPro:IPR021263"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YA6"
FT                   /protein_id="BAC45313.1"
FT                   /translation="MNDNEALPPRAVPPSHRRDVALTHVELTWIEKRIEHWLRFGRRAE
FT                   EKILDRRRSISSFEPGSIFGFVRWASNDYGTVVSRMDIVRAVEAGQRYQTLPFVRPGGE
FT                   ILLRVDSWPKVERVLQAIDAIEALSIDPADAAPEYWRHLHNRLAADHVPRAYTREQHIA
FT                   WLKRRSVTP"
FT   CDS_pept        complement(43867..44133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0049"
FT                   /note="ORF_ID:bsl0049"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45314"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45314"
FT                   /db_xref="GOA:Q89YA5"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YA5"
FT                   /protein_id="BAC45314.1"
FT                   /translation="MSDRSIKRGFASRPGDAESWIKASDTPPRSVNDAAAFTARLTIDV
FT                   TPTLRGRIKVAAFQRGVTVADMLRELLAREFPADAPENRHERQ"
FT   CDS_pept        complement(44130..44768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0050"
FT                   /note="ORF_ID:bll0050"
FT                   /note="putative partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45315"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45315"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YA4"
FT                   /protein_id="BAC45315.1"
FT                   /translation="MIVAVLNQKGGVGKTTLALHLAGVWALRGKRVTLIDADPQGSALD
FT                   WSQQRARENVARLFGVVGLARDTLHREAPEIARTADHVVIDGPPRVAGLMRSALLAADL
FT                   VLIPVQPSPFDGWASAEMLALLREARIYRPQLPARFVLNRCGARTIIARETAETLADHD
FT                   PPVLASTIGQRVVFADAAQSGRLVFEFVEQSAAAREIAALAAEVARFAP"
FT   CDS_pept        complement(44765..46042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /product="replication protein A"
FT                   /note="ORF_ID:bll0051"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45316"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45316"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YA3"
FT                   /protein_id="BAC45316.1"
FT                   /translation="MAMARLFASSAAALSTPSAISKPGPIRPPAAQRRIRATSKRAPPA
FT                   TRIAKATLVMSSRRLITPSERSKLDPFVVATGDASPRDQRDLMERPFFSLAKAKRTRPI
FT                   LYQTGDVCVEVYAVPEHGMATIWDADVLIWAASQIVEAENLGLKTSRFLRFTPYQLLTA
FT                   VGRQTGARDYKLLKGALARLQATVIRTSIRQGEHWRRHQFSWINEWEECATRDGRVQGM
FT                   EFVLPDWLYRGVIDRSLVLTIDPAYFSLTGGIERWLYRVARKHAGRQPRGWLFEVAHLH
FT                   EKSGSLAKPADFAFDLRRIAARQPLPGYCLSIERRERRELLRILPSKSFTAPVDGAVNQ
FT                   LGTSGVHTIGTPGVPVSGFRECKPQLTLWPGNTIACPNLESNLESNCCSGAARLADNTD
FT                   IRAQPPTEHPSQPSLPLSGRKTGGMR"
FT   CDS_pept        complement(45894..46265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0052"
FT                   /note="ORF_ID:bll0052"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45317"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45317"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YA2"
FT                   /protein_id="BAC45317.1"
FT                   /translation="MGGHKRTSIFVHPQRLNSPPLWPGHAATWPRHFEARRRSPMLDRP
FT                   AQLATRYVRTPEAARLLGISPRTLEKYRCHGNGPTFRKLGGRVVYAIGDLEAWADQAAC
FT                   SSTSDPRYLEARAAGNAHR"
FT   CDS_pept        complement(46349..47044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0053"
FT                   /note="ORF_ID:bll0053"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45318"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45318"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YA1"
FT                   /protein_id="BAC45318.1"
FT                   /translation="MPTTAATSPALSDRSRAANPIPTPSEPVSHVDGGCGVAHDPASPV
FT                   WPEPAIWLPEASPGTLILTPAPPDFETVHSIDRNAFGLSIVGRTDADGRELVVADGSGE
FT                   LHVSLRDEQAARRPAVLVPLDGMGELRADVALHFVRRLSGQRTGLLPAALRLTSFQKRR
FT                   LIQLLHAFDVHDLGGGPRDVAAKVLASDHAQRRSVEWKDSHARRKANRLIHDSIALVER
FT                   GYLKLLRGL"
FT   CDS_pept        complement(47255..47518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0054"
FT                   /note="ORF_ID:bsl0054"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45319"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45319"
FT                   /db_xref="UniProtKB/TrEMBL:Q89YA0"
FT                   /protein_id="BAC45319.1"
FT                   /translation="MNGAPFQDRPPITDRVNAYDEKHLAIYVRLLMAEEEGADWREVVS
FT                   VIFGLDPTREPDRAKNVHDSHLARARWMVEAGYQGLLEPRMQ"
FT   CDS_pept        47732..47983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0055"
FT                   /note="ORF_ID:bsr0055"
FT                   /note="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45320"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45320"
FT                   /db_xref="GOA:Q89Y99"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y99"
FT                   /protein_id="BAC45320.1"
FT                   /translation="MSSLVAMDLKEVMAVNLRRIRHVKKMTQEELADGAGLSVRYVGAI
FT                   ERADVSASVTVLGRIAEALGVEATDLVKRTTVHSHRAR"
FT   CDS_pept        48147..48557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0056"
FT                   /note="ORF_ID:blr0056"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45321"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45321"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y98"
FT                   /protein_id="BAC45321.1"
FT                   /translation="MTLYEHLPADIRETVDALVTELRPQPWPTRFFALIGLLGEKLEAR
FT                   REAEPWHLIQQWTGIVTATMEHLLPDSSVVECLGLMSISFNDQWRAQALGQIERDPTVL
FT                   DRLVAICPDWEDIVESVIEANQRRPIKSARGR"
FT   CDS_pept        complement(48674..49036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0057"
FT                   /note="ORF_ID:bll0057"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45322"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45322"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y97"
FT                   /protein_id="BAC45322.1"
FT                   /translation="MRARKQRSRRTTMATIGTFKKTGNNEFNGEIVTLSLQARNVRIVP
FT                   ETSRSGDNAPSHRIYVGRVEIGAAWSKRSNEGRDYLGLKLDDPSFTAPIFANLFADEEG
FT                   EGFSLIWSRPNRRNGD"
FT   CDS_pept        49708..50049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0058"
FT                   /note="ORF_ID:blr0058"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45323"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45323"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y96"
FT                   /protein_id="BAC45323.1"
FT                   /translation="MSDKSDLENRAIEAIWNYREAFAVVGRLERKERSAHRAVTRILPE
FT                   LGRALRSQDTRCLKNSIKIGSAAVSRQNEAWANLTEATARLDSAHSTLAALERQLGYLP
FT                   KVSKPRDSG"
FT   CDS_pept        complement(50081..50314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspA"
FT                   /product="cold shock protein"
FT                   /note="ORF_ID:bsl0059"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45324"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45324"
FT                   /db_xref="GOA:Q89Y95"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y95"
FT                   /protein_id="BAC45324.1"
FT                   /translation="MFFLFGANDVALGTVKWFNPTKGYGFIAPDDGGNDVFVHISAVEK
FT                   AGYTSLVEGAKVSYELVMNRSGKQAAENLRLG"
FT   CDS_pept        50722..51495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0060"
FT                   /note="ORF_ID:blr0060"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45325"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45325"
FT                   /db_xref="GOA:Q89Y94"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y94"
FT                   /protein_id="BAC45325.1"
FT                   /translation="MAQNIYDNPDFFAGYSQLPRQVHGLDGAPEWPAIRAMLPDLVGKR
FT                   VVDLGCGFGWASRWMREQGAASVLGLDLSQNMIERARADTADTAIEYRIADLDTLDLPE
FT                   AAFDLAYSALTFHYVQDFGRLVHVIRKTLVPDGHFVFTIEHPIFMAAAHPHWISDEEGR
FT                   KTWPVNRYSVEGERRTDWFAKGVLKYHRTLGTTLNTLIGAGLQIRRIEEFAPTREQIQQ
FT                   MPQLAEELERPMMLIVSASTSIGGKLRSLRDIRPD"
FT   CDS_pept        complement(51544..52068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0061"
FT                   /note="ORF_ID:bll0061"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45326"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45326"
FT                   /db_xref="GOA:Q89Y93"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y93"
FT                   /protein_id="BAC45326.1"
FT                   /translation="MTIPVAGICCYTAFAPWWWWKARPSDPYLTEPTTMIALGPLLIFL
FT                   AIGFFAWLLFTLAVFAVPVFAGVTIGLRAFHTGAGALGGIAVAFAAGAVTFGIGQLALA
FT                   LVTWAWLRLLIIILYVAPATVAGYSATHGIAQMAMSSPTWQTVFAIAGAVAVSITALAR
FT                   FTGMAADGPAR"
FT   CDS_pept        52262..52930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atc1"
FT                   /product="Atc1 protein"
FT                   /note="ORF_ID:blr0062"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45327"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45327"
FT                   /db_xref="UniProtKB/TrEMBL:H7C7S3"
FT                   /protein_id="BAC45327.1"
FT                   /translation="MSTIQKKCADFLRMTFNDLAGGKLGSGHAHEIVAAYFGYGTAAAL
FT                   RAEPKYQLAALDKAAILMPDLRLMDQRVQHLNGLPAGLPNVDELASLLSSFLNANGYFS
FT                   GEVWYTRDLEEYIDVSFIQEDPMMIEDALSGEMAMTNAFFDELYIDKVSLDVGDDVLVA
FT                   NVSGSLNGENDPDKPFHGDSIAFTTMITFERVAGRTGYMRPELETSGAIDDSHYYDQDA
FT                   "
FT   CDS_pept        complement(53006..53935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0063"
FT                   /note="ORF_ID:bll0063"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45328"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45328"
FT                   /db_xref="InterPro:IPR019627"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y92"
FT                   /protein_id="BAC45328.1"
FT                   /translation="MTADHDNDFEPHHSSSPTDQVLQELQLHGYRPFHDDPDPRGLPEA
FT                   RILAGSVADIFDALVVALSDTRLEPDLDDLLWSMVNVFHRAIDRIERELDDNELAQQRS
FT                   QREQDGSEIKSVELERLTAEGQTLIERRNAFELMRDQAADEFERHAHSAWRPRNGSKVN
FT                   HRNLTSAMIDSRDFLAAKKRAENQVLMPRGPKVALTGGLDFNDYRLIWAKLDQVHAKHP
FT                   DMVLLHGGSPKGAELIAAKWADNRKVPQIAFKPDWTKHAKAAPFKRNDAMLETLPIGVM
FT                   HFPGTGIQDNLADKAKKLGIPVWRYGGS"
FT   CDS_pept        complement(54262..55320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0064"
FT                   /note="ORF_ID:bll0064"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45329"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45329"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y91"
FT                   /protein_id="BAC45329.1"
FT                   /translation="MTMADNAHDLARRLGRQAESVCRHYLSAGRREGSYWLVGDVRNTP
FT                   GRSMFVRLKQSAKGAAGKWTDAATGEHGDLLDVIRESCRLVDFKNVLDEARLFLSLPHP
FT                   EPEPNQPRLRNSSAARGSPEAARRLFAMSQPIERTLIEAYLRNRGITSLHETGSLRFHP
FT                   RCYYRPDDHSPTETWPAMIAAVTDLSGELAGVHRTWLDPHGFSEATLGKAPIDTPKRAM
FT                   GDLLGHAVRFGVAGEVMAAGEGIETMLSLRCALPTMPMVAALSAAHLSAVLLPDTLRRL
FT                   YIARDDDPAGDGAMATLMDRAQEAGIEAIVISPQLGDFNEDLRLLGFDALRAASRVQIA
FT                   AQDVARFMELAA"
FT   CDS_pept        complement(55377..57515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0065"
FT                   /note="ORF_ID:bll0065"
FT                   /note="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45330"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45330"
FT                   /db_xref="GOA:Q89Y90"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y90"
FT                   /protein_id="BAC45330.1"
FT                   /translation="MSRERLSAPVAEYHPMATTVRKITLSPSRDIPFNRLVLSQSNVRR
FT                   VKAGVSIEELAEDIARRGLLQGLSVRPVVDQVGAETGVFEIPAGGRRYRALELLVKQKR
FT                   LAKTAPVPCVVRDSGIAEEDSLAENVQRAPLHPLDQFRAFLALREKGQSEEEIAAAFFV
FT                   SVNVVKQRLKLASVSPTLLDVYAEDGMTLDQLMAFAVSGDHERQEVVFERLKASHDKQP
FT                   YVIRRMLTEGAVRASDKRALFIGVDAYTAAGGTVLRDLFQGDDGGWMQDVALVDQMVAD
FT                   KLKAESETIAAEGWKWTEVAPDFAYGHAFGLRQLRGEIVTLTAEEEAARNALQAEFDQL
FT                   SEKHADADELPDEVDERLSELETALEGLESRPVVFDPAEIVRAGVFVSIGAEGELRVER
FT                   GYVRPEDEPSAEPEPGLAEEDGEAERAKAASYEGGERNVSVEPGAEQEEDEGLSPISDR
FT                   LMTELTTHRTLGLRHALGEQPQVAFHAALHALTLKTFYHYGSDSCLELDLKSVSFGAQA
FT                   LGLNDSALAEAIRARHERWAKALPKESADLWDALQAWDGDSQAMLFAHVVSLSVNAVHE
FT                   PWNRRPRALAHADRLARAVDLDMAAAGWKPTVDNFFGRVTKTRILQAVVEAKGQRAADR
FT                   IEHLKKGDMAAEAQTLLTDTAWLPEPLRTLGRAIGDEPAVESIVEETPEQPSENKLEDE
FT                   EERTAHNQRAGEQIMAAE"
FT   CDS_pept        complement(57643..58884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0066"
FT                   /note="ORF_ID:bll0066"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45331"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45331"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y89"
FT                   /protein_id="BAC45331.1"
FT                   /translation="MIGGEASGARHGDCPMTQAEVLIAAHDCAGGYKVDVSRGERIGRV
FT                   SSEWFSRPADERYLSLSDLYSAVRSRSERSRTRTVESTAIRVEANRDDAERLTLMLPGC
FT                   DAPIAPTHWSFGQLASLVGAPAAYLRQLPAPLAGINLQFGLSFHRAEQIKTLEVQGSRL
FT                   ELRAATGPEYGRIFDHELVAAVQRIAGNGTGDTRWKVPGVLDWSTGVYNPRVDITQDTT
FT                   TLYASDRDVFLFLVDDLNPIEAGRLPDGLPDLYFRGFYCWNSEVGAKTLGIASFYLRAV
FT                   CQNRNLWGVQDFEEITIRHSKYAATRFAHEAAPALTRFANSSPMPFVNGIKSARERIVA
FT                   RTDEDRSEFLRKGGFSKTETAKIIDTVLSEEGRKPESVFDFVQGITAVARDKTHQDARL
FT                   DMEARAKKLLDRAA"
FT   CDS_pept        59742..59957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0067"
FT                   /note="ORF_ID:bsr0067"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45332"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45332"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y88"
FT                   /protein_id="BAC45332.1"
FT                   /translation="MTESKFLTPEEVSARYRGEVSVGTLRNWRAMRTGPAYIKIGKAVL
FT                   YPVDELDAWDRGNLVICSASKELNVS"
FT   CDS_pept        complement(60225..61631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0068"
FT                   /product="exonuclease I"
FT                   /note="ORF_ID:bll0068"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45333"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45333"
FT                   /db_xref="GOA:Q89Y87"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR013620"
FT                   /db_xref="InterPro:IPR023607"
FT                   /db_xref="InterPro:IPR034747"
FT                   /db_xref="InterPro:IPR034748"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y87"
FT                   /protein_id="BAC45333.1"
FT                   /translation="MSFVFFDTETTGLKRGFDQILHFAAVRTDENLNEVARFETRSRLQ
FT                   PHVLPHPSALRTNGLPIESLTDSSLPSHYTMVGDIRRTLISWSPAVFVGFNSIRFDEEM
FT                   LRHALFQCLYPAYLTSNHRNCRADALSLVMAADAVSPAQLVVPVSEEGRRTFRLQQLAA
FT                   ANGVAHARAHDAMSDVLATLELSRLVYRRSPELWQRFVRFSNKATVADFIEVEDGFVLT
FT                   EFFGGQAYHTSVVCIGRDPDQANGRLCLSLNEDMGRLAAMSDLELQVHLTQKPSPIRRF
FT                   RINAAPTLTAFYDAPEHMLDGGSMGATGDRACLMKADTGLCARLVAAYMAAREPYALSP
FT                   HLEERIYSGFPGPADEARIAAFHDARWEDRLAIVQGMEDERLRWFGLRLIYFEARSVLP
FT                   EPTRLEVERYLTDQMTGDGSGCLTIDQAMAETERVLGEFASPDDLLIQYRTYLQDRLAR
FT                   LEAYRTRLIA"
FT   CDS_pept        complement(61639..62160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0069"
FT                   /note="ORF_ID:bll0069"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45334"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45334"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y86"
FT                   /protein_id="BAC45334.1"
FT                   /translation="MRDADPGRAREAARSILREFGVSAPPVPVERIIKSRKIVLQYAPL
FT                   EEDLSGMAYIKDGIGIIGVNALHHPNRQRFSAAHELAHHVLHDEDIRQAVHVDKGIRVL
FT                   FRDDISALGTEPIEIEANAFASELLIPGDLLAAVLEGGGVDLEDEAAIEGLARRFRVSP
FT                   AAMRFRLTRW"
FT   CDS_pept        complement(62157..62552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0070"
FT                   /note="ORF_ID:bll0070"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45335"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45335"
FT                   /db_xref="GOA:Q89Y85"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y85"
FT                   /protein_id="BAC45335.1"
FT                   /translation="MPEAAQTSAMAGNPVYIAFGNAVSTRRKALSLTQAQLASKVKMSR
FT                   ASIANIESGRQNILLHHVYALATALDFAKVADLLPPMPHKSIGEELKMTLVNEKLSKES
FT                   LSENAGAQVADLISSALAPRRGSKVGS"
FT   CDS_pept        62687..62908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0071"
FT                   /note="ORF_ID:bsr0071"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45336"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45336"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y84"
FT                   /protein_id="BAC45336.1"
FT                   /translation="MSKRIHVVPHESGWATRREGALRVGSTHHTQAEATEAARSTALRE
FT                   HGEVVIHRPDGRIRDANSYGNDPFPPKG"
FT   CDS_pept        62984..64234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0072"
FT                   /note="ORF_ID:blr0072"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45337"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45337"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y83"
FT                   /protein_id="BAC45337.1"
FT                   /translation="MSNFPSLRRDDRPDDPFADPLDAVLAELAINIQLPPGLHAKAVER
FT                   YEAVRRYIERPGSPLEGRVACFYPQGSMAIDATTSTRGTDDEYDLDIVAEIEGPDLGPE
FT                   ALLDDLEAALESYPVSKVVRQTRCITLYYADGMHLDITPSRRRAPKEKEGEIPHAKKGT
FT                   RSDPARYVPMNSYAFGKWYCARTPTEERFALALNRQLYEQAGIAFAAADVEDVPPQTPL
FT                   IIKSVTTVALQLIKRHRNIAYATETGRIPPSVMLSCHAGHAARPGMRLAEMLIRQARWT
FT                   ARAIDDAAKRGQLLVVPNPEFPVERFTDRWPESQLQQTTYSRHLHTLANGLEAARTGDV
FT                   QLEDLQEWLRGQFGDRVVTRSVKAFNQRLGRQVQSRQHGYTRSGGLFVPAAPAIIGAAT
FT                   SLAPVAARAHTNMGERR"
FT   CDS_pept        64235..64690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0073"
FT                   /note="ORF_ID:blr0073"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45338"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45338"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y82"
FT                   /protein_id="BAC45338.1"
FT                   /translation="MVMTVDAQITDMASLWPNLKLIGRHGAIAAWQGPLRPLLQTFQVE
FT                   ITYRAPLVIERLDVRILQPRVKVLSPPLRHRPGDPEGRLPHVYYGSDGEVTLCMLDPDS
FT                   DDWSPFDSLSQTTVPWVIEWLAAYEGWRATGQWTASGRHVVAGGVGV"
FT   CDS_pept        64674..65810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0074"
FT                   /note="ORF_ID:blr0074"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45339"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45339"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y81"
FT                   /protein_id="BAC45339.1"
FT                   /translation="MASVSKSSIPQKVQSALWARAAGRCQYRGCNTDLVGDLVAGRQDG
FT                   IFGFIAHIVADVEGGPRGDPIRSTQLARSLENLMLMCARHHKLIDLDAVADHPESVLLT
FT                   MKAEHEGRIAIVAGIDEDRASHVIRFGASICDNEALVSTQAIFSAMPPDRHPASGQRLD
FT                   LEMVGCAFRDNEPAYWTVQRENLRRQFEAKVRGRVERQEIRHLSVFALAPQPLLIELGR
FT                   LLCDIVPAVVHQRHREPASWRWASDGPPITFQVTEPDIGLSGSVALKLGVSATVTDARL
FT                   QAVLGDEAAIWSLCADQPHNDVLRRADDQAAFRRELRRLYDRIKARHGEGTLLHVFPAL
FT                   PASLAVEVGRVWMPKSDLSLRLYDNNRSHGFIRTFDIP"
FT   CDS_pept        complement(66173..66727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0075"
FT                   /note="ORF_ID:bll0075"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45340"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45340"
FT                   /db_xref="GOA:Q89Y80"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y80"
FT                   /protein_id="BAC45340.1"
FT                   /translation="MLTLQQMEEVRVRLAQQLIFYMPVKLFPIAQKLAFPILLEFTRLV
FT                   DFRNLEIPPEKIKITDLIYEDRLPSVFESFIARRFSEGNKQAELRVAGIITPDHKIVLA
FT                   DRKTAEGFLIKANSAVWYEIVASLQSDWSQAYSLSATRWEEIVAGAFDKAGFDEVTLTP
FT                   RSGDHGRDVIAVRRGLVASRS"
FT   CDS_pept        complement(66843..68654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0076"
FT                   /note="ORF_ID:bll0076"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45341"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45341"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y79"
FT                   /protein_id="BAC45341.1"
FT                   /translation="MIDSLRVAKTANFHILKRQMSNAALDDLFRQVRASQPSASQNIFY
FT                   HRRVQAGRARWSAISFLYDRSPSFLTEDAGIRERICGFILLIEYRDHLAILKSKLDLPA
FT                   GFFTRYLGRVSAERVDRAVARQGAVFEKIRLRNMSVSKHVMRSKTFEADDLQNVVGPAG
FT                   ANRYVPQAYAVRSGTDHYSTTPSTGRIGQRSDRVDHLALVEYAKSVIDELVGGRAAPAS
FT                   FLRTLARAIDLASIGGTARPTSFAVDVAGFVDAIHVDREIRLVHEDSGRLTQLSKHEID
FT                   AALNELDRAFRVSGDGKRMDIFDGADSVGAIAINQARVALRDLQLPITAGIEVESTEYA
FT                   LGHDPNRISLRRYIDREDKFILLFDALSLAYIDGTLFRDEGFVDGGAALLRHLRSDPLL
FT                   DGVTDEKGNFSTRKATFDADSTFGVIEASVADGDDVLVCDDLGDEWADYIGLNNSSSPP
FT                   RITFYHAKHGPLSLGAGPFHISVSQAIKNLQRMSLPPESMEAKIRGWNNKYVSGSGVKT
FT                   RIKRIVRGDADELMNEFAQVRLAPDAIRRVFIVTSSLSRGAVEEALKEVAAGQAPDPYF
FT                   VQLYWLLMSFFSACTEMNAHGYVICQT"
FT   CDS_pept        68941..70365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0077"
FT                   /note="ORF_ID:blr0077"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45342"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45342"
FT                   /db_xref="GOA:Q89Y78"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y78"
FT                   /protein_id="BAC45342.1"
FT                   /translation="MRRQPSDRSIKILFASSGGLCAFPGCTTQLVQPQSRALLGELCHI
FT                   RAASPGGPRFDPAQSEESRNDADNLIILCPTHHRLVDQDPTTYTADSLLLMKRRHESRV
FT                   AAFLSSVAVELTDKQATDLSRQVEDESVDFAVVVALRKELAALKHYFPELVPISSTSDS
FT                   TRTYLRGTIPTRRGGSYRVVATLLHSMGNLDAAHATSDLIHKWKPRFVLVNGIAGGISR
FT                   KDQGFGDIVASNSIFYYELSKVRPNHQEHRARQFQADPILVDGILNLTDSTWRAHLPSR
FT                   PDGKSASAIEPRIHVGPIASGEKVIASSEAAQELRSLQRDLIAIEMESAGVASAAFSAV
FT                   KKVGFLTIRAICDFADGKKNDMWQEYAAYSAASCLRSFIESRPVSLSEGAWPKSVASVA
FT                   ATKSRISIAQRKKLFDELCTAFDMEEFKNLCFLLGVDIDEIPGDRKSARVRELILLFER
FT                   RDTLHVLEEAVDERTR"
FT   CDS_pept        70615..70776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0078"
FT                   /note="ORF_ID:bsr0078"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45343"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45343"
FT                   /protein_id="BAC45343.1"
FT                   /translation="MHNHPSGDPSPSQADIQMTKAIIDIARPLGIAVHDHIIVGKNGHS
FT                   SLKGMKLI"
FT   CDS_pept        complement(70897..71925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0079"
FT                   /note="ORF_ID:bll0079"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45344"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45344"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y76"
FT                   /protein_id="BAC45344.1"
FT                   /translation="MAAFQEVFRRSGIDERRSPPGMVVPFGGSNIVALIDPGRKLKVDP
FT                   NPHALGIKEIDGADTLRRVMQARDTFSEPDIDPQLRAASLPTTFNGDARFFEINGRIKP
FT                   IGFPGLEVVARSAGRKIEAKLHVVVLPEIKIKVAFRNVMVPGSGGAPAFHAKKPCNEQD
FT                   ELLTMNNIWRPQANIRFERVPSDWLVIDDSQAAVKQDLATATGMKDASLATFPDVIDVE
FT                   KLKGFFVKHKVQGAHLTIFCVDKVWSNGGPANGSFARSLDLAFISSQRGPNTSAHESGH
FT                   FLGYYSKSASKPWDSQGHTLETDPKTGKENRAEDIKMLMRGGGAGWKIPFNLVKEFRDF
FT                   PG"
FT   CDS_pept        72470..74734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0080"
FT                   /note="ORF_ID:blr0080"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45345"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45345"
FT                   /db_xref="GOA:Q89Y75"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y75"
FT                   /protein_id="BAC45345.1"
FT                   /translation="MRGSTMKQRLIMWLAVVAGVALVLAVAWAAILWTRPEPIRIAFAN
FT                   SLSGPSAPAGTESLVATQLAIDEVNAKGGVNGRLIELVLFDDASDPAVARANAQAIADS
FT                   PCVAVLGHYLSSASLAAAPVYKDARIPALTGSAAADDLTSTNDYYFRALAPVSAQARSI
FT                   AEHLRAVMKEPKVRLVHTRDSYGKNFEHGFAAAYPAEQLHVFGLDVAAGQIGSMDGTLA
FT                   AAAQEPGPGVIVVGAAPDFSPDIVKALRRHGIKGTIIASQGAARESYLQNFANEPEEKS
FT                   HPGFFSENLYAASSLMFDSAGVAAQAFAVDYKAKAATSPSWVAGGAYDAARLMIDALKR
FT                   AAVHHRFMGQGIQKRSDSKVADRDRVRAALAAIDSPKSAVVGLTGRLYFNANRDIPRPI
FT                   RMGFFHYGRFVTAPQQLVRIDQPDGIDLAAEQEKGHVIAFEDRRYWIQRVVYTGIDIIR
FT                   VSRIDVKQNSFNVDFYLWMRFAGDDEAQTHVEFPALLDRGAFDPARPIQAGHEDGLSYR
FT                   LYRINGDFKAHFDLHDYPFDTQQLHLLFQNTEQRRELITYVIDRFGLRLADDGSSRAED
FT                   GAYSGLPLWRFLGLNYFVESLSSGSTLGKAPLFGAEARTEFAGFDAAIMLRRSSAIYML
FT                   KNLLPLFLLVLVVFATLFFPETMFRERVTIPVTSILASAVLLVAVNSQIGDVGYTVVVE
FT                   EMFYIFFVLCLMAMLAGYRHEKLRDAGRKRVAVVSDHVAQIIYAGTVLAIIVVLYRRYA
FT                   V"
FT   CDS_pept        complement(74948..75823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0081"
FT                   /note="ORF_ID:bll0081"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45346"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45346"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y74"
FT                   /protein_id="BAC45346.1"
FT                   /translation="MVDRMTIRSRMCRLLIAVIAAGDLVGAGSARAQQIPADEPAFTAF
FT                   VAERIRAEIRDTPVVIKGPLTLSIGPLQANLDRIYAFCKTNTGACSKEIGTYVSGVVAT
FT                   TSNRNDPPTRAALRVVVRSADYMRQALREVDARGPALTRPLAEGLVIVPVLDSPRTIRV
FT                   FNDKDRAALGLKPDQVFDIAIANLRSSMKPLATAAKAVPSGQFGTLKGDYYQTSRLALI
FT                   DSWAPLAQAQGGVLIVAAPSADLVLYASEDSGAALDALRTLARNVMARAPKPLSAALLR
FT                   WTPKGWQLVR"
FT   CDS_pept        complement(75915..76235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0082"
FT                   /note="ORF_ID:bll0082"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45347"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45347"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y73"
FT                   /protein_id="BAC45347.1"
FT                   /translation="MLRGLRIGSFGIAACLTVAMAMPVHEAAAQDAVGGAIIGGVGGAI
FT                   LGGAIGGGRGAAIGAVVGAGTGAAIASEGERRRSGYYAYQRGCYMQRPDGRYVPVDPRY
FT                   CY"
FT   CDS_pept        complement(76401..76964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0083"
FT                   /note="ORF_ID:bll0083"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45348"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45348"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y72"
FT                   /protein_id="BAC45348.1"
FT                   /translation="MTGRRPGVCEMGYSLSGKSAAALRSEVASRMWLANAGHRDPGTCW
FT                   GVRPLAAHTVRRLAQEACMAKRVLAIGIEPGVADYSTFPQLTPELVRNYIETQLLRLRG
FT                   LGYEVTSCLIDLDAAAEAAVTAALRDESFDCIVIGAGLREPKQRLLLFEKVLNLVHRLA
FT                   PNAAICFNTTPADTAEAVQRWIEP"
FT   CDS_pept        77065..78453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0084"
FT                   /note="ORF_ID:blr0084"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45349"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45349"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y71"
FT                   /protein_id="BAC45349.1"
FT                   /translation="MLSFESLKDEYERNWASLEVRPSRLAEANAVARKALNGKATYQQI
FT                   ERLTGVPWHFAALCHYRESNFDFDTYLGNGETIHRATTIVPKGRGPFATFVDGAVDAFR
FT                   IENFVGAHDWGIARILYRLEAFNGFGYHAKGCNSPYLYGGSTLYGPPEARAGKFVRDHV
FT                   FDSNHVDSQLGTAVILHAMMSLDSSIAIDGSTQFVGRTEPEDDIASTVVLMQQALNKLG
FT                   ANPPLAEDGISGPKTKAAVSQFQQQNGLRDTGLLDGATVAAVTRATQSGTAGQTGDLSQ
FT                   ALKRLEDLAQLLRPSAGGVTPGTTTPGNTLPATNDPISLFERLFSLINKTAPMPGPVTP
FT                   TNPAPVDQLKQVVDLLSTLLNKDGKPVLGQVNGALGETIGKLLDGKKTALGIGGSVLTA
FT                   LLSSVTASPNAGGIAGLLGTIVSAVPGLGQFAMPISLALTAWGVLGKLEKWAQGTAPPP
FT                   KATT"
FT   CDS_pept        complement(78511..79803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0085"
FT                   /note="ORF_ID:bll0085"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45350"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45350"
FT                   /db_xref="GOA:Q89Y70"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y70"
FT                   /protein_id="BAC45350.1"
FT                   /translation="MAMTAADIDHAIRAAIHAAWRVVQPRLIATLSRMLRDVTLAEELT
FT                   QDALVAALEAWPLSGVPDNPGAWLVATAKRRALDHLRRAKMLTRKQDLLTHELMQEQDA
FT                   MPDFDTALDDDIGDEWLRLIFTACHPLLPRQARAALALRMICGLTTDEIARAFLVSEAT
FT                   IAQRIVRAKRTLSRSGLTYETPGGEALSERLASVLEVVYLIFNEGYSASRGEEWLRPQL
FT                   CDEALRMGRVLVGLAPLEPEVHGLMALMDLNAARMHARTDRDGEPILLMDQDRGLWDRL
FT                   QITRGLRALDRARELGGAGRFYTLQAAIVACHATAETAASTDWRRIAELYGQLATLVRS
FT                   PVIELNRAVALGMAEGPQAGLDLVEMIADEPALSTYHHLQAVRGDLLHRLGRFAEARLS
FT                   FETAARLATNARERGLMERRAADIADAGGMA"
FT   CDS_pept        complement(79931..80338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0086"
FT                   /note="ORF_ID:bll0086"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45351"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45351"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y69"
FT                   /protein_id="BAC45351.1"
FT                   /translation="MRFMYIVTSSQPMAGPTPALMEAMQKISEREIKAGRMLDTGGLMP
FT                   LATGARVKIVDGELSVIDGPFVEAKEVIGGYAIFELRDKAEALAMAKEFMQLHLDHMPG
FT                   WDGTCELRAFATPGVDVACEIDAHSRVAAHA"
FT   CDS_pept        complement(80457..81149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0087"
FT                   /note="ORF_ID:bll0087"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45352"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45352"
FT                   /db_xref="GOA:Q89Y68"
FT                   /db_xref="InterPro:IPR016085"
FT                   /db_xref="InterPro:IPR021140"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y68"
FT                   /protein_id="BAC45352.1"
FT                   /translation="MTILRVAALAIAACVAAVGPALAQDATSLKKTMPGQWELSTTERS
FT                   KTCVVTMKSDAAGQGFKLELEPACKTALPFTKDIVAWSVRGLDIVRLQDATGEAVIDFT
FT                   EVEAGIFEGLRQGEGVYILQDLAAARSMAKSMDQMIGDWSMVRGNGQPVCGLTLTNTEA
FT                   GPDNFQVFLKPKCDAGIAQFNPTQWRLERGQIILMSKSGDVWQFEADDNAQWRRVPDTA
FT                   DPLIMLRQ"
FT   CDS_pept        complement(81149..82138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0088"
FT                   /product="oxidoreductase"
FT                   /note="ORF_ID:bll0088"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45353"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45353"
FT                   /db_xref="GOA:Q89Y67"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y67"
FT                   /protein_id="BAC45353.1"
FT                   /translation="MTAGSISSEKIDLLIYGPVRPILENGFSDHFVVHKAETRGDLERL
FT                   TPAIREKIRGVAVTYHTVRADRDSLSQLPKIEMVASFGVGYDHVDAKYAAEHNIIVTNT
FT                   PDVLTEEVADVAMGLLISTVREFIKADRYVRSGLWQTQNYPLSVGSLRDRKVGIVGMGR
FT                   IGQAIARRLDASLVPVVYHSRNPSKDVSYKHYPDLIEMAKAVDTLMVIVPGGASTNKMI
FT                   NAEVLKALGPRGVLINVARGSVVDEPALVQALKSGTILAAGLDVFAAEPSVPDELKSMQ
FT                   NVVLLPHIGSASVVTRNAMDQLVVDNLKAWFAGKAPLTPVAETPFKGR"
FT   CDS_pept        complement(82138..82956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0089"
FT                   /product="ABC transporter permease protein"
FT                   /note="ORF_ID:bll0089"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45354"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45354"
FT                   /db_xref="GOA:Q89Y66"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y66"
FT                   /protein_id="BAC45354.1"
FT                   /translation="MSAQPSVTASPSGAHRAVRFVLPVIVLAAGLLAWELVVRIREIPP
FT                   YVLPAPSVIFLTLIKDWAVLSQSLATTLLTTLEGFVAASVGGIALALLFNQSKWVEYSL
FT                   FPYAVVLQVTPVIAIAPLLLIYLEQQTAVVVCAFIVAFFPVLSNTTLGLNSVDRNLAGL
FT                   FQLYGASPPQTLRFLKLPAALPYILGGLRIAGGLSLIGAVVAEIAAGTAGAGSGLAYRI
FT                   AESGYRLNIPRMFAALLLLSLAGIVIYGVLALVSHLVLRRWHESALGKEN"
FT   CDS_pept        complement(82953..83768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0090"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:bll0090"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45355"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45355"
FT                   /db_xref="GOA:Q89Y65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y65"
FT                   /protein_id="BAC45355.1"
FT                   /translation="MSPVKTSSGVEASLTALAVSLRGVTKVYDNGVMALGPLDLAVRKG
FT                   EFISLLGPSGCGKSTALRLIAQLSAPSSGIVRLARHEGPAQPGHGIGFVFQEPTLMPWT
FT                   SVRENVRLPLKLAGVAKAEARARADEALASVGLADFADAYPRELSGGMKMRVSLARALV
FT                   TDPDILLMDEPFAALDEITRFRLNNDLLALWRSLRKTVIFVTHSVFESVYLSQRVVVMT
FT                   ARPGRIQADIRIETVEPRGEEFRTSAAYSDYCRKVSAALAPSYSGQPVL"
FT   CDS_pept        complement(83779..84801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0091"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="ORF_ID:bll0091"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45356"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45356"
FT                   /db_xref="GOA:Q89Y64"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y64"
FT                   /protein_id="BAC45356.1"
FT                   /translation="MTLSHLRRALTAGLMAALVSVVPARAETLDKVTFGTNWVAEAEHG
FT                   GFFQAVADGTYKKYGLDVTIVPGGPNENNRMLLIAGKIDFFMAANTLMSFDAVANNVPV
FT                   VTIAAVFQKDPQVMLTQPDAKVAKIEDLKPLTLFVSKEGMSSYFQWLKSEYGFNEKNVR
FT                   PYNFNPQPFIANPKSAMQGYVTSEPFAVEKAAGFKPNVLLLADYGFNTYSTLIETRRDI
FT                   AEKKPDLVQRFVDASMIGWYNYIYGDNSAGNAMIKKLNPEMTDDLLAYSVARMKEYGIV
FT                   DSGESLKNGIGAMSDERYTSFFNKMVKAGVVKPDLDFRKSYTLRFVNKGVGVELRPSKP
FT                   "
FT   CDS_pept        84955..85761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0092"
FT                   /note="ORF_ID:blr0092"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45357"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45357"
FT                   /db_xref="GOA:Q89Y63"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y63"
FT                   /protein_id="BAC45357.1"
FT                   /translation="MMPSRDWTEIRWADAVPAEVSRWIAVLPLAATEQHGPHLPLATDV
FT                   LIADAYLARVRELLPATIPASFLPVEPVGISTEHIDYPGTQTLPTDVALKRWTAIGEEV
FT                   ARRGVKKLVIITSHGGNSAAMMLVAQDLRAHHKLFVVTTSWSRLSGADKLFPAEEVRHG
FT                   IHGGAIETSIMLARYPDQVRKDAIADFPASSVAMETQYRWLSTQRPAPFAWQAQDLNAS
FT                   GAIGNATLAVPEKGAQLLDQGARAFCELLTEVDNFDVNRLAKGPLG"
FT   CDS_pept        85889..86164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0093"
FT                   /note="ORF_ID:bsr0093"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45358"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45358"
FT                   /db_xref="GOA:Q89Y62"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y62"
FT                   /protein_id="BAC45358.1"
FT                   /translation="MEFHMSIKTKIAAAALAALAVTGSIVSTTSSAEAKQPGWVWGVGA
FT                   GIATAAVVGSAIAASNDPYYYGYHRCGWVAQYNAFGQYVGRVRSCY"
FT   CDS_pept        86228..87328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0094"
FT                   /note="ORF_ID:blr0094"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45359"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45359"
FT                   /db_xref="InterPro:IPR010607"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y61"
FT                   /protein_id="BAC45359.1"
FT                   /translation="MSCPDPARLSPRAGSTICGQKSPATAWLRQSFRLHVSRVRIRIGG
FT                   WRASVNWRVSIGSILIAILTSTQAFPEPALQPQTAPQGDSRPAVDLELVIAVDISYSVQ
FT                   PDDLAAQREGYAKAIVSEEFLRALRTGPVGKIALTYFEWSSTRDQDVIVPWRQIDGPEA
FT                   AEAVAAEIMKAPIRRGSRTSISGAIKFAMPLFEQNPYRGARRIIDVAGDGPNNNGDPVA
FT                   TARDTAVQQGIVITGLPVMINATPPGQVDISHIDHIDWYYEDCVIGGPGSFVVPITDRE
FT                   NFKEAIRTKLALEVAGRTPDQSPPPSVDKKPRVLCTIGEKLWQQRWDTIAPATNSPAMS
FT                   KPAANSSSSKEDALLDKKIKGICRGC"
FT   CDS_pept        87667..89694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0095"
FT                   /note="ORF_ID:blr0095"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45360"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45360"
FT                   /db_xref="GOA:Q89Y60"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y60"
FT                   /protein_id="BAC45360.1"
FT                   /translation="MGHIRVLGACVLTLRGHRYRYLRTAAAIASGVMVLPAASRAADLP
FT                   LKAPALKTVYDWTGLYIGAHVGVTRGTSSATLIDPTLATDDHVFTGATGGVQAGYNWRL
FT                   NSGLLLGVEGDISFPNYLPSNHVVSSAATVLSSAEERWDYVASLRARLGYTTGNWLFYA
FT                   TGGAAFTGERFLSTPTGGTEEKVLHTRFGWTAGGGVEYAFAPHWSARLEYLYSKFDNAN
FT                   VTFPSGAQYSSSMDFQSLRIGLNRKIDWPGVPTYNPKSDVTDTESSRWEIHGQSTVLGQ
FT                   GYPAFHAPYTGTNSLLPSPDFQQTWSNSLYLNARLWDGGEVYFNPELLQGFGFNNTTGA
FT                   AGFPNGEAQKSGFPYPHFNASRLFVRHTFGFGGEQEELASGQLQLASKVDVSRLTLQVG
FT                   KFSVVDVFDGNSYAHDPRKDFMNWSIWASGAFDYAADKLGLGYGATAELNQKQWALRAG
FT                   YFLIDAVSNSNNFDMNVGRRGEYVMELETRYSLFGLPGKLRTLGFVNSAFSGSYRETLD
FT                   NPAFGVDISQTRRGRLKYGYAFNVEQAITDDIGVFGRWSWNDGRNEIMAFTDIDRSLSG
FT                   GVSVKGTKWGRPDDVVAIAGAINGLSQDHRDFIAAGGLGPLIGDGQLNYRRERVLETYY
FT                   AYALNKALTFTADYQLIVNPAYNADRGPVSVFSGRLHGEF"
FT   CDS_pept        complement(89896..91971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0096"
FT                   /note="ORF_ID:bll0096"
FT                   /note="putative methyl accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45361"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45361"
FT                   /db_xref="GOA:Q89Y59"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y59"
FT                   /protein_id="BAC45361.1"
FT                   /translation="MRIGKLFALSMLTVTVFAVILGAEVLIPQARIFTNRSDAIKTVDA
FT                   FGATLMVSQQVAGLRAPYIGPIFQEAAATQAQIDAAAKAAKAAETAFESARRAIMVLDD
FT                   GGAIAEHLDRAARRLKEINAAADRAMSVPLAARDSAAIKGFLPGVAEVLGNIEPVMNRL
FT                   EAKVVNADSSLAALLSLARTAQDLRVSAGSRAATLSPALSVRRPLTAAEFSLMDRMQGR
FT                   VEADRERIEAGIDQLGSPPRIATALKAATDSYFGKAALVVDKEMPAARSDGKYGVNAEE
FT                   LAGVIVPAIQMFYGVRDAALAEAAERAAAARDGALAMLALAGVAVLALLGTLGGVTMML
FT                   RSRVVTPLSRLADVIGTLAAGQHEVEIPATGRNDEIGQVAGSLRHFKDSLAAKKAADEA
FT                   AAVEAEAKLRRSQRMDQIARDFEAMIGDVINTVASASSELEASAGTLTSTADQSEKVTA
FT                   TVAAASEQASTNVQTVAAAAEEMASSVDEISRQVQDSARVAGEAVQQAGRTNDHVGELA
FT                   KAAGRIGDVVELISQIAGQTNLLALNATIEAARAGEAGRGFAVVASEVKALAEQTAKAT
FT                   GEISQQIAGIQTATEDSVGAIKSIGDTITRMSEIASAIASAVEEQGAATREISRNVQQA
FT                   ARGTQQVSASIVDVQRGASQTGSASSNVLAAARSLSGESSRLKVEVGKFLDAIRAA"
FT   CDS_pept        92215..93513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0097"
FT                   /note="ORF_ID:blr0097"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45362"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45362"
FT                   /db_xref="GOA:Q89Y58"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y58"
FT                   /protein_id="BAC45362.1"
FT                   /translation="MLSVELVIVVVLIVINGLLSMSELAVVSSRPARLSLLAAKGVRGA
FT                   DRALTLAADPGKFLSTVQIGITLVGVLSGAFSGATLGQRLAQWLVELGLSAGIADIVGV
FT                   GIVVTLITYATLIVGELVPKQVALRDPESIAVKVAPAMHVLARISLPLVFLLDLSGKLI
FT                   LTLLGRGGKAEEKVSEDEIHHLVSEAENAGVLEPGEKEMIAGVMRLGDRPVGAVMTPRT
FT                   EVDEIDLNDTPEAIQQIIAKSPHSRFPASDGERDKPIGVLQAKDLLVAFMSERTPDLRA
FT                   LVREAPSIPASADARDVLAILRAAPVHVGFVYDEYGAFEGVVTAADILESIVGAFHSEE
FT                   GPPEPAYVKRADDSLLVAGWMPVDEFCELLGIELPPHHRFYTVAGLVLQHFNVLPNVGD
FT                   AFDLGGWHIEVVDLDGRRIDKILASRRGEQAAA"
FT   CDS_pept        complement(93761..94000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0098"
FT                   /note="ORF_ID:bsl0098"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45363"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45363"
FT                   /db_xref="GOA:Q89Y57"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y57"
FT                   /protein_id="BAC45363.1"
FT                   /translation="MDERRNKARHRVLKAGTIEFGGGAIDCTVRNFSDTGAALDVTSPV
FT                   GIPEHFTLLIQADGKHLACTVVWRKEKRIGVRFG"
FT   CDS_pept        complement(94103..95728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glt"
FT                   /note="ORF_ID:bll0099"
FT                   /note="putative glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45364"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45364"
FT                   /db_xref="GOA:Q89Y56"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y56"
FT                   /protein_id="BAC45364.1"
FT                   /translation="METLLMPFSPRFIVLTICAVVTALLIGFGIADRKIFDILLIPILI
FT                   FGALTLLGVRDLLQKSHAVLRNYPISAHIRFLLEEIRPEMRQYFFESEKDGMPFSRDTR
FT                   AVVYQRAKMQLDKRPFGTQEDVYREGYEWMHHSVSPKAHAEEKFRVVVGGPDCKKPYSA
FT                   SVFNISAMSFGALSPNAVRALNAGAKKGGFAHDTGEGGFSPYHAEMGGDIIWEIGSGYF
FT                   GCRHLDGSFDPEAFARVAGQDQIKMVELKISQGAKPGHGGVLPAAKVSEEISKIRGVSM
FT                   GEDCISPASHRAFSTPVGMMQFIAEMRRLSGGKPAGFKLCIGHPWEFLAICKAMLETGI
FT                   YPDFIVVDGNEGGTGAAPLEFMDHLGMPMREGVNFVHNALIGINARDRIKLGASGKIAT
FT                   AFDMARAMAIGADWCNSARGFMFSLGCIQSLSCHTDRCPTGVATQDPTRARALYVPLKI
FT                   DRVHNYHHATLHSLTELIAAAGLEHPQQLRPIHFSQRRSTTQVQSFAQLYPALRPGELL
FT                   EGTEDPRFRDAWRMARAETFQPAL"
FT   CDS_pept        complement(96219..97073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0100"
FT                   /product="ferredoxin NADP+ reductase"
FT                   /note="ORF_ID:bll0100"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45365"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45365"
FT                   /db_xref="GOA:Q89Y55"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y55"
FT                   /protein_id="BAC45365.1"
FT                   /translation="MAMVSALLSGPGSAFALKPQLFGISKIMSAFYREKVLSVQHWTDT
FT                   LFSFRATRDTGFRFQNGQFAMIGLEVDGRPLLRAYSMASANHEEELEFFSIKVQDGPLT
FT                   SRLQKIKEGDTILVGRKATGTLITDNLIPGKRLMLLSTGTGLAPFASLIKDPDVYEQFE
FT                   TIVLVHGCRQVSELAYGEKLVANLREDELFGELLADKLVYYPTVTREPFRNRGRITDLI
FT                   SSEQIFNDIGQGPLDIATDRIMMCGSPAMLEELKVMFEGRDFIEGSGNKPGHFVIEKAF
FT                   VER"
FT   CDS_pept        97367..98296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0101"
FT                   /note="ORF_ID:blr0101"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45366"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45366"
FT                   /db_xref="GOA:Q89Y54"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y54"
FT                   /protein_id="BAC45366.1"
FT                   /translation="MASSERIFVQAIRRYCARHGIAVDIRAGGWLIAMRRGEARHFAFG
FT                   YDIGLNSAIAHRLANDKSATAEALSLEAVPCVPHHLFLNPSMGAHVAGPGWREAMLALL
FT                   AQHPQGVVVKPNEGTSGRAVFKVTSAAELDRAVCEVFSSGLGLVIAPYVEIEEEVRVIL
FT                   LDRKPMIVYRKDRPSVVGDGEHTLRELAIAAGHDGQLRELEAREVNAVVPNGKRRILNW
FT                   RHNLDAGARPVLMENGEVRAACVRLAVDAANAIGIAFASIDVVRVDGAWRVLEINSGVM
FT                   MEALAKLHPELVQATYDAALDRVFGKTS"
FT   CDS_pept        complement(98503..99429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltI"
FT                   /product="glutamate/aspartate periplasmic binding protein
FT                   precursor"
FT                   /note="ORF_ID:bll0102"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45367"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45367"
FT                   /db_xref="GOA:Q89Y53"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y53"
FT                   /protein_id="BAC45367.1"
FT                   /translation="MGQTLTRSVIGGCLWLAASLLATTALAQTGSEGLSPTLSAIKKAH
FT                   VVRLGYRESSPPFSFLDQSGRPIGYSLELCEAIVEEIGVEVDDPNLKIDYVKVTSDDRI
FT                   DAVLQNKIDLECGSTTANAERAKRVAFSPLMFVAGTKLMVPKASSVQSLTDLKGKTIVV
FT                   TKGTTNEQAIQAADKKSSLGLTIAVGADHEQSFQMLADGKADAFATDDILLSGLIARHK
FT                   AQDKYRVTGDYLSYDPYGIMFRKGEPQLSAVVERTFRKLGSNRDLVPLYNKWFTARLPT
FT                   GERLNVPISLQLEEAFKAMDDSASANN"
FT   CDS_pept        complement(99439..100737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /product="proton glutamate symport protein"
FT                   /note="ORF_ID:bll0104"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45368"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45368"
FT                   /db_xref="GOA:Q89Y52"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y52"
FT                   /protein_id="BAC45368.1"
FT                   /translation="MSNRFTQYILGAMVLGIIMGSAIYNFLPDTRADWASSINLIAMMF
FT                   LRLIKMIIAPLVFATLVGGIAHMGSGAKLGRIFAKTMGWFISASFVSLMLGLIMVNLLQ
FT                   PGANFPGTLPAAGQSTGLPVSAFSIEKFLTHLIPTSIADAMAQNEILQIVIFAVFFSVA
FT                   MGAMPERSKPILALIDDIGHIMLKVTSYVMLFAPLAVWAAITATVAKNGLLVLWKLVVF
FT                   MGGFYLSLALLWTILVIVGFIVIGPRYSHLLKLIREPLMIAFSTASSEAAYPKTLEGLN
FT                   RFGASSRISSFVLPLGYSFNLDGTMMYCTFASIFIAQSYHIDMPLGTQLAMLATLMITS
FT                   KGVAGVPRASLVVIASTLAQFNIPEAGLLMIMGIDTFLDMGRSATNVIGNTLATSVVAK
FT                   WEGELGPEHAMGPGDAVPDDMVPGEVPAMAGHG"
FT   CDS_pept        100948..101949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0103"
FT                   /note="ORF_ID:blr0103"
FT                   /note="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45369"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45369"
FT                   /db_xref="GOA:Q89Y51"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y51"
FT                   /protein_id="BAC45369.1"
FT                   /translation="MSGSINRQILLVEKPSGKLGPEHFKMVDGAMPEPKDGEALLRVRY
FT                   ISLDAANRAWMHGATYRSAVEANSVMAGGGIAEVVSSKAPGLAAGDIVFGDTGWQEFAA
FT                   VPAKHLTKMPKLEPMTHLLSVFGIAGLTAYFGLLEVGKPKEGETVVVSAAAGSVGSIVG
FT                   QIAKIKGCRVIGIAGGADKCNWLTSELGFDAAVDYKDGAVFKALRAAAPTGIDVYFDNV
FT                   GGDILEACLPQMNNYGRIACCGAISQYDGAPAAHGPRGVPGLIVVKRLVMQGFIVMDYM
FT                   KDSQRALAELQGWVKSGKLKVQEDIIDGLENTPKALIGLLAGENRGKRMVKL"
FT   CDS_pept        102210..103061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0105"
FT                   /note="ORF_ID:blr0105"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45370"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45370"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y50"
FT                   /protein_id="BAC45370.1"
FT                   /translation="MFNTLKHASTRTALLAAVLFATATGAFAQAPTDAQKSAIRSACRS
FT                   DFMAHCSSVTPGGVEAYQCLAKNMSSLSPGCQTAVRAVEPAAPPKTEAAPAAPKTEAAP
FT                   KTESKTETAPAAPKAESAPAEKPAAAPAPKAAAAKQPSSAQVAAVKSACRADYPKVCAS
FT                   VPPGGAPALECLEKNKAKVSPACEKALSAAAGGGAAATAAPAGAAPAAAAAPAAAPAVI
FT                   VLRPLRPREELFIVRSACGADIRTLCAGVAPGGGRIVQCIASNAASLSPACKDVLAPFA
FT                   AR"
FT   CDS_pept        103609..104751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0106"
FT                   /note="ORF_ID:blr0106"
FT                   /note="probable monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45371"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45371"
FT                   /db_xref="GOA:Q89Y49"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y49"
FT                   /protein_id="BAC45371.1"
FT                   /translation="MIGGGPGGLYFAYLWKKRHPEDQVDLFEQNPADATWGFGVVFSDQ
FT                   ALEFLRADDPETVDAIAPHMESWENITLNLQGGSVAIDGVGFSSIGRLELLQFLQQRAL
FT                   DVGVTPRFDTQIHGIDQLNGHDLIVAADGLNSLVRRAYEGDFGTSLSYSSNKFVWYGTS
FT                   KRFDTLSQTFVKTDRGAFNAHHYRYSPTMSTFLVECDHATWQAYGFAYKDVEQSKGVCE
FT                   EVFADTLGGHCLVSNKSVWRNFPWVWNEHWSFKNMVLIGDALHSAHFSIGSGTRLAIED
FT                   AIALVKALESDAHLNTALLRYQAARKPVVQKLVDAARTSASWYENFAQHMQLDLMDFAY
FT                   SYITRSGRIDDSRLRAMSPAFMARYEAAKNGGDAASEATA"
FT   CDS_pept        104748..106361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0107"
FT                   /note="ORF_ID:blr0107"
FT                   /note="probable coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45372"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45372"
FT                   /db_xref="GOA:Q89Y48"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011957"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y48"
FT                   /protein_id="BAC45372.1"
FT                   /translation="MSNEICDQVPADSAGAREIGFAVPEIYNASRVLFDNLGKGYGDKL
FT                   ALIGPAGTRTYAELCAEACRWGNGFISLGLKRGDRVLLFLDDTPAYPAAFFGAVRAGFV
FT                   PLLINTLTPPDLLQFYLADSGATVAVAESEFCARFNAEARKDTSLRTLIVVNGEMGERA
FT                   APAAVAAASWLAQFPAELAEANTHRNEMAFWMYSSGSTGRPKGIVHLQHDMTYSEVAFA
FT                   QNVLKLTPDDICFSVPKIFFAYGFGNSVTFPFSVGAATLLLPGQPKPATIFAAIEQYRP
FT                   TVFFGLPTLYTSLTKAEGAQQTNFSSLRMALSAAEVLSAEVFNGWKTLTGLEIVEGLGS
FT                   TEVLHIYLSNRPERKKLGAAGLRVPGYEVALRNKDGSEVGDGEEGILWVRGDSNTPLYW
FT                   NRPDKSAETIREGGWIYTGDRFVRDADGFHFFRGRADDLIKISGQWVYPLEVELCLADH
FT                   PDIRECAVFAAELPDRRMTLKAVVVMNSRTTDQGEATRRLQDYVKGKLLPYKYPREVIF
FT                   IDELPKTGTGKIDRQALLRM"
FT   CDS_pept        complement(106542..107078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0108"
FT                   /product="transcriptional regulatory protein"
FT                   /note="MarR family"
FT                   /note="ORF_ID:bll0108"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45373"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45373"
FT                   /db_xref="GOA:Q89Y47"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y47"
FT                   /protein_id="BAC45373.1"
FT                   /translation="MPHRRSSPMPSKPPPPITMDAIYAAPGYLFRRMQQIAVSIFMEEC
FT                   KAFDLTPVQYGALIAIHTHPGIDATRLSAVIAFDRSTLGSVIERLQAKDYIERKPAPED
FT                   KRIKLLYLTKSGAAILREIIPAVERAQARMLEPLKPTERKALMGLLVQLVDLNNEVSRV
FT                   PLRAEDALEHLGKGG"
FT   CDS_pept        complement(107044..107676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0109"
FT                   /product="maleylacetoacetate isomerase"
FT                   /EC_number="5.2.1.2"
FT                   /note="ORF_ID:bll0109"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45374"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45374"
FT                   /db_xref="GOA:Q89Y46"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y46"
FT                   /protein_id="BAC45374.1"
FT                   /translation="MKLHGYFRSSAAYRVRIALNLKGLGAEHLPHHLRKGEQCAPAYLA
FT                   INPQGLVPALENDGGAVLTQSVAIIEWLDETHPNPPLLPKDPLRRAKVRAFALAIACDT
FT                   HPVQNLKVLARLRELGLAEEKVQDWAAWVNREGLSACETLIRDEPGPFCFGDAPTLADL
FT                   CLVPQLANARRFGVDVSAYPRLLKAEAAAKALPAFADAAPEKQPDAE"
FT   CDS_pept        107881..108921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0110"
FT                   /product="gentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.4"
FT                   /note="ORF_ID:blr0110"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45375"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45375"
FT                   /db_xref="GOA:Q89Y45"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR011960"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y45"
FT                   /protein_id="BAC45375.1"
FT                   /translation="MEAVTKTPEREAFYKKIDGENLTALWTVMGDLITPEPKSACRPHL
FT                   WKFDVIRDYMREAGKLITAKEAERRVLVLENPGLRGQSKITTSLYAGVQMVVPGDVAPA
FT                   HRHSQSALRFVLEGKGAHTAVDGERTAMEPGDFIITPSMTWHDHSNETDEPMFWLDGLD
FT                   IPLVQFFDCSFAEGSKEDQQRITKPAGDSFARYGHNLLPVDVKRSSKTSPIFSYPYAYT
FT                   REALEKARASQEWDACHGLKLKFSNPETGDFAMPTIGTFIQLLPKGFKTARYRSTDATV
FT                   FCPIEGRGRSRIGDAVFEWGPRDLFVVPSWHWVTHEADDDAVLFSFSDRPVQQKLDLFR
FT                   EDRGNA"
FT   CDS_pept        complement(109150..109998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0111"
FT                   /product="ABC transporter permease protein"
FT                   /note="ORF_ID:bll0111"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45376"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45376"
FT                   /db_xref="GOA:Q89Y44"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y44"
FT                   /protein_id="BAC45376.1"
FT                   /translation="MPSARSSMLDRASVAETPVKSEATRRVRFRGAGFVPASSRFGGWI
FT                   ALALVIAIWQAAGSAGLVNPLFLPAPLAIVRAIYELAMSGALWQHLSASLLRIGVGWLL
FT                   GTAAGVAVGFAIGLSRLARSVGITFISALFPIPKIALLPLLILWLGIGEEPKIATIALG
FT                   VFFSTAISVYSGVDAVPRNLIRMAQSFNVPFATIVRKVIWPGALPAILAGFRITASVAL
FT                   LLVVSAEMIGAQYGIGAFVLQAGNLMQTDQLLAGVVILSVFGLAVGKVINLLETRLLHW
FT                   R"
FT   CDS_pept        complement(109970..110743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0112"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:bll0112"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45377"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45377"
FT                   /db_xref="GOA:Q89Y43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y43"
FT                   /protein_id="BAC45377.1"
FT                   /translation="MDLIANHITHRFGDLAVLDDVSFTVSAGEVVAIVGPSGCGKSTLL
FT                   SILGGLLQPTSGAPELRGAPPADSLNPLTFVFQDFALLPWATVEENVEFPLLHAQLSAA
FT                   QRRALVEDALRRTGLTDFRKTYPKQLSGGMRQRVGISRALAVRPAILLMDEPLSALDSQ
FT                   TRELLMEDFVRLLADGGMGAVYVTHNLEEAARLADRIVVLSRRPGRIREVVTVPMTRAE
FT                   RGETAAREKLLLLQNQIWSLIRHEAIDAEREVQHA"
FT   CDS_pept        complement(110855..111859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0113"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="ORF_ID:bll0113"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45378"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45378"
FT                   /db_xref="GOA:Q89Y42"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y42"
FT                   /protein_id="BAC45378.1"
FT                   /translation="MIGIARLALAGLVAIMAMGAAQAEDALKARIGVLRLSSSAPVFIA
FT                   QDKGYFREAGLDVELKFFDAAQPIAVATTSGDVDFGVTAFTAGLYNLAGKGVLKVIGGM
FT                   SREKAGYPLIGYFASNNAYAAGLKTPKDLAGKRVAVTQVGSSFHYSLGLLADKYGFKLA
FT                   DVKIIPLQSLSNAAAALKGETVDAALLPISTARKLMDEGGAKFLGWVGDETPWQLGAVF
FT                   ASPKTLTNKALVTKLLGALAKADREYHDVILAAMKDGVAPVNEQTKPLLEIIAKYTNLP
FT                   VEQVVGNCAYIDPDGKLDVKNVDNQIKWLQEQGFADKGFDANTIIAKDYVKAD"
FT   CDS_pept        complement(111903..113267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0114"
FT                   /note="ORF_ID:bll0114"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45379"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45379"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039649"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y41"
FT                   /protein_id="BAC45379.1"
FT                   /translation="MRATTIEEPARQVPLYGEYEVVVLGGGPAGIIAAASAARAGRKTL
FT                   LIERYGFLGGMGTAAGVTNFCGLHGNVYGQAHRLVQGLASELLARIDLLNGLNTPHLIL
FT                   GKVFAQAYDTAAYKIAADELLASHKVNILFHALGAGVVMGDNSRIDALMVETKAGRQAV
FT                   RSEIFIDCSGDGDLAVWAGAPFEVGDEHGHPLYPSMMLRLNNIDPEKAGEAWRTIPQLM
FT                   EKALAAGTHKFPRKSAIVRPQKSGIEWRVNFTQVAREDGHAINGIEPDDLTRGEIEGRR
FT                   QALAAFEFLRTVPGFEKSYIVDLPPQLGIRETRRIKGGYQLSGEDVLGCASFEDSIGVN
FT                   GWPIEAHVPGDVIFTFPPIPESRGYNELPYRMLVPEGVDNLLVAGRCASMTHEGQSAAR
FT                   VSGACFVMGEAAGSAAALALSGNRIPRDIPIEKLQETLKQQGAFIGRDQPVPEGL"
FT   CDS_pept        113381..114265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0115"
FT                   /product="transcriptional regulatory protein"
FT                   /note="LysR family"
FT                   /note="ORF_ID:blr0115"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45380"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45380"
FT                   /db_xref="GOA:Q89Y40"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y40"
FT                   /protein_id="BAC45380.1"
FT                   /translation="MDILVNLQAFLATADAAGFSAAARKLNVSTSVVAKRVTQLETRIG
FT                   TPLFHRSTRQLRLTDAGQRYVHRARGVVTDATDLLSRMGEKGHDLVDHLRIKAPTSLTV
FT                   ARLADAFSAFQTQNPRLKLEIVLIDRPVDPVTEGFDIAIGAFPHSFGGVVDEPLCALKR
FT                   LLCASPAYLKKHGTPKHPRDLVEHRCLSFLPTGPEWIFDGPRGRISIQVSPLLSSNEGH
FT                   VLARSAIAGNGIALISHYLVADALRDGTLKPVLRDFPIPELWVKAAIPERRRNAAAVQA
FT                   LLTLLKTSLASSL"
FT   CDS_pept        complement(114617..115468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0116"
FT                   /note="ORF_ID:bll0116"
FT                   /note="putative enoyl-CoA hydratase (EC 4.2.1.17)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45381"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45381"
FT                   /db_xref="GOA:Q89Y39"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y39"
FT                   /protein_id="BAC45381.1"
FT                   /translation="MASAIVQGKQTTGGSPMTANPVLWTLDERGVATVTLNRPEVNNAY
FT                   DGALIAGVLAAIDDLGKRPNLRVVVLRGNGKHFQAGADLKWINGVRPQSAEANEAASRA
FT                   TFEAVQRLNTLPIPTVALVQGGCFGGGTGVIAACDVVIAADNALFSITEVRWGLTAAII
FT                   IPQLCDAIGVRQVRRYALTGERFGAEDARRIGLVHEVVPLAELEAAGAKVVEQLLANGP
FT                   EAMAETKRLALESSFGGMAVDDAAYTRLVHLHSVKRQSSEAAEGLASFAEKRAGNWGGG
FT                   KG"
FT   CDS_pept        115578..116552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0117"
FT                   /note="ORF_ID:blr0117"
FT                   /note="putative 2-dehydropantoate 2-reductase (EC
FT                   1.1.1.169)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45382"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45382"
FT                   /db_xref="GOA:Q89Y38"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y38"
FT                   /protein_id="BAC45382.1"
FT                   /translation="MRICIFGAGAVGSHIAVRLARAGHEVSCVMRGAHLEAARAGGLKL
FT                   RVGDSEVTAKVNASGDPAQLGPQDVVISTLKATALTGLVSSIKPLLQDDTAIVFAQNGI
FT                   PWWYGIGLPPRHPTPPDISFLDPGGRLRACIPKERIIGGVIFSSNEVVSPGVVQNLTPD
FT                   RNRLLIGECDDRNCERITKLRGVLNDARLESPPVAEIREAIWSKLLTNMSLSVLCLLTG
FT                   QTARGVRDDPAFAEVIPRMLNEANDIAQHFIPEVKRVTRSGPAPNHKPSLLQDYEIGRA
FT                   MEIDVLVKAPAAFARTSGLPTPTLDLIAALAIQKARDKGLYSA"
FT   CDS_pept        complement(116555..117280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0118"
FT                   /note="ORF_ID:bll0118"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45383"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45383"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y37"
FT                   /protein_id="BAC45383.1"
FT                   /translation="MTLPRRPEQRLSGWLIVATKTQELKLDIERIGTVSAILTQPENAR
FT                   ACYVLAHGAGADMRHAFMDKVAEGLAERGIATLRFNFPYMEKKQGRPDQPAVAHAAIHA
FT                   AVAEAARLCPGVTLVAGGKSFGGRMTSQAQSKAPLPGVKGLAFLGFPLHADGKPSAERA
FT                   EHLAGIAIPMLFLQGTRDKLADLGILKPVVEGLGPKATLHEVEGGDHSFAVLKKSGRSN
FT                   EEALTEVLDALTTWIGGLA"
FT   CDS_pept        117359..117913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0119"
FT                   /note="ORF_ID:blr0119"
FT                   /note="similar to acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45384"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45384"
FT                   /db_xref="GOA:Q89Y36"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y36"
FT                   /protein_id="BAC45384.1"
FT                   /translation="MSYRSSWMTEELDVFRDQFRKYLAKDLAPHAEKWREQKMVDRFAW
FT                   RGLGEMGALLASVPEEYGGLGATFAYDAAVLDDLESTVPELTTGVSVHSAIVAHYILNY
FT                   GSEEQKKRWLPKMASGEMVGAIAMTEPGTGSDLQAVKTTAKKQGNSYVINGRRLSSPTA
FT                   RPPISSSWSRARAKPVRKAFR"
FT   CDS_pept        117868..118503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0120"
FT                   /note="ORF_ID:blr0120"
FT                   /note="similar to acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45385"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45385"
FT                   /db_xref="GOA:Q89Y35"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y35"
FT                   /protein_id="BAC45385.1"
FT                   /translation="MVARTGEAGAKGISLIVVETAGADGYERGRNLDKIGLHASDTSEL
FT                   FFDNVTVPPENLLGKEEGQGFVQLMQQLPQERLALAVGAVASMERAVKLTTEYTKERKA
FT                   FGKPLMDFQNTAFTLAERKTEAMIARVFVDWCIERLVAGDLDTVTASMAKYWCSDKQVQ
FT                   TADECLQLFGGYGYMQEYPISRIFIDSRIQKIYGGTNEIMKLLIARSL"
FT   CDS_pept        complement(118513..119397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0121"
FT                   /product="transcriptional regulatory protein"
FT                   /note="LysR family"
FT                   /note="ORF_ID:bll0121"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45386"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45386"
FT                   /db_xref="GOA:Q89Y34"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y34"
FT                   /protein_id="BAC45386.1"
FT                   /translation="MDSLVSMRVFCLVAELKSFATAAQRLRISPAMASKHVMQLEKRLG
FT                   TRLLNRTSRRVSLSESGALYFEQARQMLDSLDEVEAAVSKATVVPRGTLRLTAPVWMAN
FT                   AIFAGVLADYQARYPEVCLDVDLSGRLVNLVEEGFDLALRATGTPDEALIARPITKVPF
FT                   LLVAAPAFLKRAGRPTKFADLAGQALLHYALYPGESFSLNRNGTVETIKLNPVLRSGNE
FT                   TLLHMAALEGMGFAFLPKWLVADDIAAGRLVHMLPDDIIFEGRLFAVYPSRKYLSAKVR
FT                   TFIDFIAADKRMR"
FT   CDS_pept        119378..119929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0122"
FT                   /note="ORF_ID:blr0122"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45387"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45387"
FT                   /db_xref="GOA:Q89Y33"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y33"
FT                   /protein_id="BAC45387.1"
FT                   /translation="MLTSESMKSSTSRKGINHGTHNDQMRRNHQMVATHRPWRPTMTAT
FT                   TFETATPGRALRIGLWAAQGLIFFVFASAGLVKLLTPIPQLAAMMPWAGQYSETFVRII
FT                   GLIDLAGGIGILLPALTRILPRLTVLAALGCTVLQVFALVFHLSRGETDVTPLNVVLLA
FT                   LSLFVLWGRGRKAPITPRQL"
FT   CDS_pept        119884..120408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0123"
FT                   /note="ORF_ID:blr0123"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45388"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45388"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y32"
FT                   /protein_id="BAC45388.1"
FT                   /translation="MGTRPQGADYAASALTGRNAAAMISANGWSRRGLLAGTAILTAGG
FT                   AAAREDRLADGVVILIDSNEPYVMGHAISYSANLAKHFADKGARLLIEVVANGKGIDVF
FT                   RADKTPLVEPLATLRQSLPNLTYSMCASSKAIAEAKEQVSIPLISGASLVPFGIGRVVD
FT                   LQLKGWAYIHA"
FT   CDS_pept        120401..121006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0124"
FT                   /note="ORF_ID:blr0124"
FT                   /note="thiol:disulfide interchange protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45389"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45389"
FT                   /db_xref="GOA:Q89Y31"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y31"
FT                   /protein_id="BAC45389.1"
FT                   /translation="MREKPRAPGTTLSRRALLMAAPAALVPPRASRAQGGDPAWPPVLE
FT                   AGRSQFTVVRPRATMPQLRLQDLHGKDVVLTARPGRITLVNFWATWCAACRLDLPVLAS
FT                   LVGSRPDRLDVVAICTDTKDLRKIRAFLGGLAVQNLACYVDAYDTTAEASASAFTLVGM
FT                   PVTYLVGASNHVEGYITGAPDWLSPAGARLLQFYREQA"
FT   CDS_pept        complement(121012..122151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0125"
FT                   /note="ORF_ID:bll0125"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45390"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45390"
FT                   /db_xref="GOA:Q89Y30"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR020043"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y30"
FT                   /protein_id="BAC45390.1"
FT                   /translation="MPFDLILRGGRVVDPSQKLDAVTDVGFAGGKVAAVGSGLKADPGT
FT                   EVRDVSRYIVTPGLIDLHTHVYWGGTSLGIDAEEFCRLSGVTTAVDTGSAGPGNFAGFR
FT                   KHVIEPSQVRILAYLHVSHAGIFGFSHRIMVGESEELRLMNPIEAAKVADANRDLIVGI
FT                   KVRVGLHSSGTSGAVPLDIALEVANEVGMPLMAHIDHPPPSYEDVLARLRPGDVLTHAF
FT                   RPFPNTPATAQGTVKKAVLDARERGVLFDIGHGKGSFAFKTARAMLANGFYPDTISSDI
FT                   HQLCIDGPAFDQVTTMSKFLCMGMELSDVVAASTVNAAMALRRPELGSLKPGCVGDATL
FT                   ISVRQGQFDYEDVVGEHLIGDRKIVSEGVVIGGRWWHPN"
FT   tRNA            complement(122281..122357)
FT                   /product="trnR-CCU"
FT   CDS_pept        122437..122871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0126"
FT                   /note="ORF_ID:blr0126"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45391"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45391"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y29"
FT                   /protein_id="BAC45391.1"
FT                   /translation="MRCADGRQTALGVYHGPSPKPGPGAGTMIEGISAITLGTHDMARA
FT                   VHFYRSLGFELLYGGEAAAFTSFRAGTGYLNLTAQPDDKHWSWWGRVIFYVADVDGTYE
FT                   RARAAGWQPSSTPRDAEWGERYFHLTDPDGHELSFARPLS"
FT   CDS_pept        122996..123289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0127"
FT                   /note="ORF_ID:bsr0127"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45392"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45392"
FT                   /db_xref="InterPro:IPR014845"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y28"
FT                   /protein_id="BAC45392.1"
FT                   /translation="MVTYVVLGNFTDQGVRNVKDSPKRADAFKEMAKTFGVTVKEIVWT
FT                   QGRYDVVTVLEAPDEAAAMSLSLSLSALGNVRTETLRAFSAADMTKIVGKML"
FT   CDS_pept        complement(123347..124303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0128"
FT                   /note="ORF_ID:bll0128"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45393"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45393"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y27"
FT                   /protein_id="BAC45393.1"
FT                   /translation="MTITRRALLAAPAILAMAPAAAQAGKITLVVPFPPGGSTDAMARL
FT                   LQSNLQTKLGRIVVVENKSGAAGALGAAQVAKSPADGTTFLVTFDSHAVIPSILDKPPV
FT                   DVERELMPVLLVGTAPYVIAAGAGRPYKSFADVVAACKATPGAVKYASVGIGTLGHLAM
FT                   TVLGNKAGVEIVHVPYRGGGPAMNDVLGGHVDLIAGSAALVAAQLGSNMLRPILQLGRE
FT                   RLPALPDTQTAIEAGFPDFETLAWWGIFAPAGTPPEIVAAMAAASREILSEPATAAQLK
FT                   ETQHMTLLLEDGAAFKTFFDKQVAYWGKVVRENNIRA"
FT   CDS_pept        complement(124350..124721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0129"
FT                   /note="ORF_ID:bll0129"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45394"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45394"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y26"
FT                   /protein_id="BAC45394.1"
FT                   /translation="MSQKEEFHNLDDASDGLFRELAAGVTTRIFSGEQAMLSVVTLAPH
FT                   AHGTLHHHPEEQWGVLLDGSAIRVQGDEEIPVKKGDFWRTPGNVPHTMRAGPEGARVLD
FT                   IFSPPRPEYRKPGSGFGTT"
FT   CDS_pept        complement(124750..125478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0130"
FT                   /note="ORF_ID:bll0130"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45395"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45395"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y25"
FT                   /protein_id="BAC45395.1"
FT                   /translation="MDEGGACLPDLAGEGAGARRIRKFTKGLFDMTITIVANSVPKPPA
FT                   DIIEGFRGAPTSVISDNLARLPGAVGLKPYHRGGKLVGTAFTVRTRPGDNLAIHRALDL
FT                   VGPGDVIVVDGGGDETRALVGEIMKNIAQWRKAEGYVIDGAIRDVAAFAADDFPCYARA
FT                   VIHRGPYKNGPGEINVPVTVGGSVISPGDIVVGDEDGVVSFPAAGAAALLEAVRAQVAR
FT                   EEETLKAIREGRYQGSYGKS"
FT   CDS_pept        complement(125415..126932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0131"
FT                   /note="ORF_ID:bll0131"
FT                   /note="probable acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45396"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45396"
FT                   /db_xref="GOA:Q89Y24"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y24"
FT                   /protein_id="BAC45396.1"
FT                   /translation="MLLPLSDVPRWYAERKPQGTIAVRHGQDTLTWDELERGANRRARA
FT                   FAAKGVKPGDFVAIGLPNGNAFFETSFAIWKCGATPTSLSWRLPRGEAAAVLDILKPAL
FT                   VVGGEADWNAPNRLPADFVPEGFSDEPLTPPVARYWKAMTSGGSTGRPKVILDHHPAVT
FT                   DTVAAPALNIPFGVSLLNPGPLYHNAPFIVSHTALFAGGQLTGLVKFDAEETLRLIERE
FT                   RVQWVNFVPTMMHRIWALPENVRNAYDVSSLQTVFHMAAPMPPWLKENWIAWLGPERVW
FT                   ELYGGTERQGSCIISGTEWLTHKGSVGKIGEMARLCIIGEDGNDVAPGETGEIYFLNND
FT                   GKDATYHYLGAEPKRRADGWESLGDIGRLDAEGYLYLGDRLADMVLRGGANIYPAEVEA
FT                   AVSACPVVRSCVVVGLPDPELGQRVHAIIEPELDADGQVIADGMAEFLKDRLSRYKHPE
FT                   SFEIVSAPPRDDSGKVRRTLLRDERAAWMKEGRAFRIWPAKARAHAE"
FT   CDS_pept        complement(127029..128066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0132"
FT                   /note="ORF_ID:bll0132"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45397"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45397"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y23"
FT                   /protein_id="BAC45397.1"
FT                   /translation="MFVMRALACLAALVLVLICGHAFAADEDAPNRKPVKAIGDARLSV
FT                   GGRGTLRLYLSRDWSMPQPAISRAVIVLHGRLRNADEYYISANNAQAAAGDDGKAALMI
FT                   VPQFLAEIDIEAHKLTEDTLRWSLEGWEGGDAALAPNPVSSFEALDAILARLADRRVFP
FT                   NLKQVVVAGHSGGGQVVQRYAIAGKGETALSRQHIDVRYVVANPSSYAYFSADRPVPAI
FT                   AASCPGYNNWKYGMGDRPPYLADATPAALEQRYVEREVIYLLGTLDTNPKHSALDKSCM
FT                   AEAQGPYRYARGHAYVDAMAKRDHGTPNHRVWDVPGVGHDGDKMLTSKCGLAALFDIPG
FT                   CGAER"
FT   CDS_pept        complement(128227..128973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0133"
FT                   /note="ORF_ID:bll0133"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45398"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45398"
FT                   /db_xref="GOA:Q89Y22"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y22"
FT                   /protein_id="BAC45398.1"
FT                   /translation="MPTIFLLAGMVGTGREARALAHPTVSARSSPLLRRLARRRAEQLL
FT                   QIVQAFRQPRPFAGERALGAGCALRSRAHGLLHLRPFDRDGHALDVGPQRDLLELLHLL
FT                   FLLLALLTRGGLGRFIAAALIGEIGGVGFVDLLLLFRRRVGTCDIEGAVLEEVVIGVAA
FT                   ARLAASGELGVAIRKRRRFLRLGRGLLGGISAFLEVDRRALPPLRLGMRVRQQKKSCCS
FT                   NEKRRTTRCKHGPHSTRAFLAKLNPN"
FT   CDS_pept        complement(129248..130249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0134"
FT                   /note="ORF_ID:bll0134"
FT                   /note="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45399"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45399"
FT                   /db_xref="GOA:Q89Y21"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y21"
FT                   /protein_id="BAC45399.1"
FT                   /translation="MVADRPIVVAGAGAIGCFVGGMLAAAGRRVALLVRPRVKTEIERF
FT                   GLRLTDFDGSEKKLGAGQLALSEDPAIFHSAGIVLVTVKSADTADVADQIAQHAPQDAV
FT                   IVSLQNGVGNVAVLRERLGGRRVLAGMVPFNVIAMGEGRFHRSTSGDIHVGEDAENTAA
FT                   ALSVPGLSMRASRDITGVQWGKLIINLNNALSALSDMPLAAQLASRNWRKLFAEQMAEG
FT                   LAAMKAAGINPVSATPIPLNWTPTLLRLPDMIFNAILGRTMKIDPEARSSMWQDLKQGR
FT                   KTEIDYLQGAVIALAEQSNVNVPLMRRIVALIKEAEVAGNGPPGLTPQQIRG"
FT   CDS_pept        130346..131029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0135"
FT                   /note="ORF_ID:blr0135"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45400"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45400"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y20"
FT                   /protein_id="BAC45400.1"
FT                   /translation="MFSPRGACQRRALAEREQQTRRTRTPKESTMGLLDVLNGMQNGPH
FT                   GSRTGEQPSSGGMSPMTMALLGLLAWKAFKHLTAGQPGDAPAPQQRSPLPPPTPVNTGD
FT                   ATLPGGSGGGLGDLLKGGLGGLLAGGAAGTVLSGGLGDLLNQLQQGGHGETANSWVGKG
FT                   QNKPIAPGDLASALGADQIESLSAQSGLSREELLSGLSQYLPQVIDHLTPDGRLPTENE
FT                   LSGRI"
FT   CDS_pept        131077..131343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0136"
FT                   /note="ORF_ID:bsr0136"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45401"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45401"
FT                   /db_xref="GOA:Q89Y19"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y19"
FT                   /protein_id="BAC45401.1"
FT                   /translation="MGGLLWIIVVGFIAGLIARWLAPGPNNPSGFILTTILGIAGAFLA
FT                   TFVGQAIGHYGADQGAGFIMATIGAVVVLFIWHRLVASGVIKG"
FT   CDS_pept        complement(131439..132224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0137"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="ORF_ID:bll0137"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45402"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45402"
FT                   /db_xref="GOA:Q89Y18"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y18"
FT                   /protein_id="BAC45402.1"
FT                   /translation="MAKDSLCAIVTGSASGLGAATAEILARSGARLVINYSSSQKEAEA
FT                   TAELCRNAGAAEVLVAQGDVSKDEDCRKIVAAASGWGRLDVLVNNAGTTKHVAHADLDG
FT                   LSAEDFQRLYGVNTIGPFQMVRAARSLLEAGAKASGRPSAVVNVSSVAGISGVGSSIAY
FT                   AASKGALNTMTLSLSRALAPLIRVNTVCPGYIDTPWFTKGRGEAGAKQVRDSVVAKVPL
FT                   KVASTADDIAQLVCFLAMPASSNMTGEVVRMDAGMHLIA"
FT   CDS_pept        132485..133549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0138"
FT                   /note="ORF_ID:blr0138"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45403"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45403"
FT                   /db_xref="GOA:Q89Y17"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y17"
FT                   /protein_id="BAC45403.1"
FT                   /translation="MAESDNIVVETAEKIFADLADPQTINNDKKDSWQAPLWQALSEAG
FT                   LPLSWVPDDLGGSGASLADGFALLNAAGRFAVAVPLAETMLAGWLLAQARIASPEGEMT
FT                   VAPASPKDRITLDADGALSGRARGVPFAKAAKHFAVLAHGKDGVSIALVDASKGRIESG
FT                   LNVGYDHSDTVTLDKAQPITIKPAPKGFDQTALMLMGGVARSLQIAGALEAMLDISVRY
FT                   SNERVAFEKKISKFQAVQHNLARLAGESAAALAAATSAADAIANATSFNDEVYLEAASA
FT                   KIRCAEAAEKGGAIAHQVHGAIGFTMEHILHRYSLRALAWRDDFGSESHWAVELGKLVA
FT                   RRGADELWPLVASR"
FT   CDS_pept        133566..134726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0139"
FT                   /note="ORF_ID:blr0139"
FT                   /note="putative acyl-CoA dehydrogenase (EC 1.3.99.-)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45404"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45404"
FT                   /db_xref="GOA:Q89Y16"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y16"
FT                   /protein_id="BAC45404.1"
FT                   /translation="MTAALRFDPIRLPEKCEQLRKEVRAFLAEEIAAGTFDPHKPNRED
FT                   TDAPEFSRRVGAKGWLGMTWPKKYGGQERSFLERYVVTEEMRVANAPTRRFFVADRQSG
FT                   PVLLKYAPEHIKMEILPRICRGEICFAIGMSEPNSGSDLFAAKTRATKTDGGYLINGTK
FT                   IWTSSAHIADYMIAIFRTSPPTKENRRHGLTQFLVKMKQPGIEVNPIGQITGQYEFNEV
FT                   VFTDFFVPDDHVLGEVDGAWKQATSELAYERSGPERFLETYYVLTELVRAVGPNPDTRS
FT                   AEGIGRLVAQLHTMRRMSVSVAGMLQAGKEPVVEASIVKDIGTVWEQQLPHRVRDLAAF
FT                   VEETATNRETLERQLDFAIKTAPKLTIQGGTTEVLRGIIARGLGLR"
FT   CDS_pept        134744..135556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0140"
FT                   /note="ORF_ID:blr0140"
FT                   /note="putative enoyl-CoA hydratase (EC 4.2.1.17)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45405"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45405"
FT                   /db_xref="GOA:Q89Y15"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y15"
FT                   /protein_id="BAC45405.1"
FT                   /translation="MSTYTDIGVEKVGHVGTIEIRRPPLNFFDISLINQIADALDEFDR
FT                   DIEIRASVLSAQGKAFCAGANFGDPARQAQEARAAEKKGDPADNLGPISHLYIQAVRIF
FT                   RAKKPIVAAVQGAAIGGGLGLAVSADFRVTCPEARFSANFTKLGFHPGFGLTVTLPELI
FT                   GKNNAELMFYTSRRVTGEEAVKWGLANELVPQDQVKSAAMKLAGEIAECSPLGLLSTRA
FT                   TMRASLADRVMAATNHELAEQTRLRATEDFKEGVKATEERRAANFRGR"
FT   CDS_pept        complement(135717..137831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0141"
FT                   /note="ORF_ID:bll0141"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45406"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45406"
FT                   /db_xref="GOA:Q89Y14"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y14"
FT                   /protein_id="BAC45406.1"
FT                   /translation="MPHPLDSFFSPASIALIGASRDHEKIPGRLLAMLRKNEYPGKIYP
FT                   VNPNYAEIDGLACYKSIAEIGAPIDLAVVIIPARAVLPALEQCAVAGVRNAVIISSGFA
FT                   EEGGDSAAMQDAIAALAKRTGMRISGPNAEGFFSQMQRVAATFSPAVDVKPGVVPLVAT
FT                   QRRIGIVAQSGGIGFAYYHRARALGVAVSYVVSAGNESDLGAGEFLDYLVQDSSTDVIL
FT                   LFIEGIRDVGKFLAAARRAAEVKKPVIVTKVGRSGAGQRAAASHTASMAGWSAAYDAVF
FT                   AKYGFIVSNDLDEALTIAAVLASNPLPKGDRVAVVTVSGGAGIWGADAVALRGLQVPEL
FT                   SEPVQAEIKTLMPSYGTARNPIDVTAQGVTSGGLQKSVDLLTASDEVDAILVVLSLSSE
FT                   MRKPFREEELTPVLAAQHKPVLFYSYTVPSDFARRELAKSGVVVLSGLSHAGVAMRQLV
FT                   DYARFELPKPADEARLPSRDLSAHLTSPVLSEADSKALLRAAGIALPDEVLVKDKAGLD
FT                   EAVARIGFPLVMKIQSPDIAHKSEIGGVRVNIVAKGEVFLAFEALLGNARKHRPEAVIQ
FT                   GVLVGPMAKQGVEIIVGTMTDKTFGPMVMVGLGGITTELFRDVAYRPAPVSAEEAGAML
FT                   KGLKAAPLLNGFRGAAKADVVALSQLIADVSVLAARHARDIAEIELNPVLVHAEGQGVT
FT                   IVDALVVGRG"
FT   CDS_pept        complement(138071..138826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0142"
FT                   /note="ORF_ID:bll0142"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45407"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45407"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y13"
FT                   /protein_id="BAC45407.1"
FT                   /translation="MIMAPYVRLRQICLVAPQLAPVISDIADIMGLAVCYRDGNVAKYG
FT                   LENALLPVDTILLEVVAPFKDGTTAGRFIEKTGGRGGYMAIFCCNDPDERGRNANALGV
FT                   RTANVIDHAPYHGVQLHPRDCRAAFIEFNHTKGSDDILGPYPPAGPDWQKFIRKDVTQA
FT                   LTAVEMQSPDPAGLAEHWGGIIGVAPSDAELRLPNATFRFVKGPSEIMSALEFRVADVA
FT                   GVLHAARAKGLAVAGNEFLLGGVTFRLNA"
FT   CDS_pept        complement(138823..139614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0143"
FT                   /note="ORF_ID:bll0143"
FT                   /note="putative enoyl-CoA hydratase (EC 4.2.1.17)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45408"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45408"
FT                   /db_xref="GOA:Q89Y12"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y12"
FT                   /protein_id="BAC45408.1"
FT                   /translation="MSNDMVLQKLEGGLLTITMNRPERKNALNPDMVRGLVEAARRAAD
FT                   DPEVRAVLFKGAGGSFCVGGDVKSMAEGRAPLPFEQKLANLRRGMEVSRILHQMPKPVV
FT                   AQLDGAAAGAGLSMALSCDLRIASESCKITTAFAKVGFSGDYGGTYFLTQLLGSARARE
FT                   LYLMSPVLTAKEAQAIGMVTKVVPDAEIDTAAHELALSLAQGPSIALGFIKRNINNAEH
FT                   LALEDCFDGEAIHHTRCGDTEDHKEAAKAFVEKRKPTFKGA"
FT   CDS_pept        complement(139769..140974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0144"
FT                   /product="substrate-binding protein"
FT                   /note="ORF_ID:bll0144"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45409"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45409"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y11"
FT                   /protein_id="BAC45409.1"
FT                   /translation="MTRILPGIFAAALALSASAVQAEDKPPLKIGGILDMSSLYADITG
FT                   PGSETAAKMAAEDFGGEVLGRKIQVLAADHLNKADLSANIARDMLDNQGVEMIYDVAAS
FT                   ATALAAGEIAKARNKIIMFNGPGSIRLTNEACGPYTVHYVFDTYGQANVTGLAAVKSGL
FT                   DTWFFLTADYAFGQDLEKDTSAVVTKTGGKVLGGVRHPLNTSDFSSFLLQAQASKAKVI
FT                   GLANAGGDTVNAIKQAAEFGITKGGQKVSPLLAFVTDIDSIGLETAQGLLLAEAFYWDL
FT                   NDDTRAFSKRFTERMKRPPTSAQAGVYSSVTHYLKAVKAAGTTDAAAVIKVMKETPIND
FT                   FFAKGGKIREDGRMIHDMYLFEVKKPSESKGRWDDYKLLATVPGSEAFQSLEQSRCPLV
FT                   KK"
FT   CDS_pept        141060..142121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0145"
FT                   /note="ORF_ID:blr0145"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45410"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45410"
FT                   /db_xref="GOA:Q89Y10"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y10"
FT                   /protein_id="BAC45410.1"
FT                   /translation="MRERAASARGVQLARSSRVFRKAEWWNDARRFRTVIASAAKQSDR
FT                   HRGDSPGLLRCARNDACEAMAERHTATGSDRSTSSLASFELRVERNATFPGNVTRLLHL
FT                   IVVLLLVAGRTAFAAPCQFESQGDGRVAAIVDARSVRLDDGREIRLTGIEPTATTKQAL
FT                   ASLLVGRDVTLRSADDTPDRYGRQGGLIFIGDSDTPVQAMLLAQGDAIVSAEIADKDCA
FT                   AALMSSEAEARRQKKGNWADPSAIKNAESPDDILAGIGRFVVVEGKVLSVRQAGAMTYL
FT                   NFGRNWTRGFAVTISRRASPAFETAGIALKSLENRRIRVRGWVEGNTGPRIDVRLVGQV
FT                   ELLGANEPAGVRP"
FT   CDS_pept        142147..143739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0146"
FT                   /note="ORF_ID:blr0146"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45411"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45411"
FT                   /db_xref="GOA:Q89Y09"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y09"
FT                   /protein_id="BAC45411.1"
FT                   /translation="MNGVLEQHWTGEGRRLRAAPAVLCLLLGTALAGCGDMNRFQTAAA
FT                   PPTVAMPKPKPAVAQTPATEKEHERILASYGGTYDDPRLESLVTKTVDRLVAASDRPDQ
FT                   GYRITILNSGAVNAFALPNGQLYVTRGLLALASDTSELSSVLSHEMAHVLSKHAAMRED
FT                   QARQAAIVTRVVTDMSNDPDLTALALAKTKLTMASFSRNQEFEADGIGVGISARAHFDP
FT                   YGAARFLSAMERNAELKAGKTSLDPRAQDFTSSHPATPERVQNAQTIARQYVAPEGGER
FT                   DRESYLAAIDNLVYGEDPERGFCPRPAFPASEARLHLPGAGQFHARQHRAGGDRRARRR
FT                   LAGDALRRGAGAGRAVARRLPQFGLDGRRREGVHGRHHHQRLPGRVRHRQGRPVAVQGL
FT                   CAAFRQRRLPLHLRGTAEVDRERAQCARDRQLVPSPDPRRDPGRPPAAHQGDHRAARRH
FT                   RGIALPPHGRRRSPRRALPRAQRPRSQRAGEGEGSREGRGGLTLREARVIPGRLARTRD
FT                   LEPRRHCRRVGKA"
FT   CDS_pept        142817..143647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0147"
FT                   /note="ORF_ID:blr0147"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45412"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45412"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y08"
FT                   /protein_id="BAC45412.1"
FT                   /translation="MPRASFPRWSAMPSSRPARPRSIRARRTSPRRIRQPRSVCRTRRP
FT                   SRGNTSLRKEASATARAISPRSTTSSMAKTPSEGFVRGRRFLHPKLGFTFQAPDNFTLD
FT                   NTAQAVIGVRDGGSQAMRFDVVRVPAEQSLGDYLNSGWMEGVEKASTEDITINGFPAAS
FT                   ATAKGDQWQFKVYALRFGSDVYRFIFAARQKSTESERNARETVNSFRRLTLDEIQAARP
FT                   LRIKVITVQPGDTVESLSHRMAGVDHPAERFRVLNGLDRNAQVKVRDRVKVVAD"
FT   CDS_pept        complement(143826..145250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0148"
FT                   /product="MFS permease"
FT                   /note="ORF_ID:bll0148"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45413"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45413"
FT                   /db_xref="GOA:Q89Y07"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y07"
FT                   /protein_id="BAC45413.1"
FT                   /translation="MLQCGMLGQTGPDCLAPRRAVGFGFQDVKGARMATAQTPAMADLH
FT                   SGEHGHDQASPGEIAIGVIIGRTSEFFDFFVYAIASVIVFPRLVFPFTSELTGTLYSFM
FT                   IFALAFMARPIGTVIFMTVDREYGKTAKLVSALFLLGTATVALAFLPGYSEIGVAAIWL
FT                   LALARIAQGLAWGGAWDGMASLLALNAPPSKRGWYAMVPQLGAPLGLIVASALFAYFAG
FT                   NLSADDFFDWGWRYPFFVAFAINVVALFARLRMVTTEEYATLFETRELQPARISETVAR
FT                   EGQNIMLGAFAPLASFALFHMVTVFPLSWVFLFTRESPVRFLIIEIVAAVFGVAAIVAS
FT                   GIIADRVGRKSLLMGSAIAIAIYSGFAPQLLDAGAFGETIYMVIGFILLGLSFGQSSGA
FT                   IASNFKQAYRYTASALTSDMAWLFGAGFAPLVALLLATNLGVIASGAYLLSGAFWTLLA
FT                   LWLSGQREAGDMDAGA"
FT   CDS_pept        145336..146496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /product="cytochrome O ubiquinol oxidase subunit II"
FT                   /note="ORF_ID:blr0149"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45414"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45414"
FT                   /db_xref="GOA:Q89Y06"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y06"
FT                   /protein_id="BAC45414.1"
FT                   /translation="MSRLKILALLPLAAALSGCNYVVLAPAGDIAAQQRDLVIISTVLM
FT                   LLIVVPVMALTVLFAWRYRQSNTSARYEPDWDHSTKLELVIWSAPLLIIICLGALTWMG
FT                   THLLDPYRTLGRIHADRAVDQSKAPLEVDVVALDWKWLFIYPDYGIATVNDLAAPVDRP
FT                   INFRITASSVMNSFYIPALAGQIYAMPGMETKLHAVVNHTGTYKGFSANYSGAGFSGMH
FT                   FDFQGLDDKGFDAWIASAKSAGGSLGRAEYLQLEKPSQNEPVRRYGTIDTDLYRLILNM
FT                   CVETGKMCQSEMMAIDAKGGRGHEGLNNTLPLAYDKYARRGTALGPEPTFVAGTCTPDA
FT                   PQGQTTASIKAPADTAPLLGAGLKRPTFTPLKSSSFFLGQRPKSDS"
FT   CDS_pept        146508..148505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /product="cytochrome O ubiquinol oxidase subunit I"
FT                   /note="ORF_ID:blr0150"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45415"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45415"
FT                   /db_xref="GOA:Q89Y05"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y05"
FT                   /protein_id="BAC45415.1"
FT                   /translation="MSPDLLKLIFGRLGLESLPLHEPIVVGTFVVVALGGATLLGGLTY
FT                   FRLWGYLWREWFTTVDHKRIGIMYMILGIVMLLRGFADALMMRGQQMLAFGGSEGYLNA
FT                   HHYDQVFTAHGVIMIFFVAMPLVTGLMNYVVPLQIGARDVSFPFLNNFSFWMTVGGAVL
FT                   VMASLFIGEFARTGWLAYPPLSNIGYSPDVGVDYYIWALQVAGVGTTLSGINLICTIVK
FT                   LRCPGMTMMKMPVFTWTSLCTNILIVASFPVLTVVLALLSLDRYVGTNFFTNDFGGSPM
FT                   MYVNLIWIWGHPEVYILVLPAFGIFSEVTSTFSGKRLFGYTSMVYATVVITILSYLVWL
FT                   HHFFTMGSGASVNSFFGITTMIISIPTGAKMFNWLFTMYRGRIRYELPMMWTIAFMLTF
FT                   VLGGMTGVLLAVPPADFVLHNSLFLIAHFHNVIIGGVVFGAFAGINYWFPKAFGFKLDV
FT                   FWGKLSFWFWVVGFYLAFMPLYVLGLMGVTRRLRVFDDPSLQIWFVIAAIGAGLVFLGI
FT                   LSMLMQFAVSFLKREQLKDVSGDPWDARTLEWATSSPPPDYNFAFTPVVHDNDAWWDMK
FT                   KRGYQRPLIGFKPIHMPSSTGTGIILAGLATAMGFGLIWYIWWLAAASFIAMLAVGIGH
FT                   TFNYHRDFDIPADDVIRTEDARTKLLAGAK"
FT   CDS_pept        148506..149135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /product="cytochrome O ubiquinol oxidase subunit III"
FT                   /note="ORF_ID:blr0151"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45416"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45416"
FT                   /db_xref="GOA:Q89Y04"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y04"
FT                   /protein_id="BAC45416.1"
FT                   /translation="MTVAVNPSQTGEPVFYLADEHPHPEGYSTSLGFWIYLMSDCLIFA
FT                   MLFAAFGVLGANYAAGPAPKDLFDLDLVAVNTSMLLLSSITYGFAMLTMQQNKIAQTQM
FT                   WLAITGLFGAAFIGIELTEFAHMIHEGATPQRSAFLSAFFTLVGTHGLHVSCGLIWLVT
FT                   LMVQVWKFGLIEANRRRLMCLSMFWHFLDVVWIGVFTFVYLLGVLR"
FT   CDS_pept        149132..149512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /product="cytochrome O ubiquinol oxidase subunit IV"
FT                   /note="ORF_ID:blr0152"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45417"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45417"
FT                   /db_xref="GOA:Q89Y03"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y03"
FT                   /protein_id="BAC45417.1"
FT                   /translation="MNTDTHAAHAGDHHHDDGHAHSTFSGYMLGFVLSVVLTAIPFWLV
FT                   MSGTLPSKQITALVIMAFAVVQIVVHMIYFLHMNTKSENGWSMMALIFTIVMVVIALSG
FT                   SLWVMNHLNSNMMPIHQMSGMK"
FT   CDS_pept        149509..150369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0153"
FT                   /note="ORF_ID:blr0153"
FT                   /note="probable surfeit locus protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45418"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45418"
FT                   /db_xref="GOA:Q89Y02"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y02"
FT                   /protein_id="BAC45418.1"
FT                   /translation="MSELGTVTSKAGRARRKAARPSFWLTVLSLTAFAALIALGVWQIE
FT                   RRAWKLALIDRVEQRVHAPAQPIPSPASWPAVSAASDEYRHVTVAGRFLHDRETLVQAV
FT                   TEEGPGYWVLTPLKRDDGTQVLINRGFVPPERREASMRRNGNPDGEVEITGLLRMTEPK
FT                   GGFLRNNVPQHNRWYSRDVAAIAAARGLHDVAPFFVDADAGSQTAQGPIEGPIGGLTVI
FT                   RFPNNHLIYALTWFALAFMLAGKLFVTFGGGLFRRGRFVHEPAGGSDAAARRTGSDAGT
FT                   IVEQT"
FT   CDS_pept        150314..151738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0154"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="ORF_ID:blr0154"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45419"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45419"
FT                   /db_xref="GOA:Q89Y01"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y01"
FT                   /protein_id="BAC45419.1"
FT                   /translation="MLPPAGRDQMLERSSNRPDDGRTPPQAFGELAVTLQSQADARSEL
FT                   IGAAPTDDETNRKNMALLIQLRWTAVVGQIVTIGGVHFWLGIPLPLERMGAVIGALVLL
FT                   NVSSLVWVRHRAAISSNELLVALMLDVAALTAQLYLSGGATNPFTSLFLLQVTLGAVLL
FT                   DARSTWSLVALTCASFVWLTLAYRPLDLPPNPISEAYSLTVAGMLLGFVLNAVLLVVFV
FT                   TRINRNLRERDAHLAALRQHAAEQDHIVRMGLLASGAAHELGTPLASLSVILSDWRRMP
FT                   DLAADQELAEDLAEMETSLQRCKSIVTGILVSAGEARGEGSSPTTVTAFVTALVDEWRN
FT                   ARSARTLYFVNTFGEDVAIASDVALKQVIFNVLDNAYEVSRDWVELLAEREGDNLVLSI
FT                   SDRGPGFAPEMLAQLGKPYHSSKGRAGGGLGLFLVVNVVRKLGGSVTAENHRKRGATVR
FT                   LTLPLATLAIGGSFDA"
FT   CDS_pept        151728..152261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0155"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:blr0155"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45420"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45420"
FT                   /db_xref="GOA:Q89Y00"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q89Y00"
FT                   /protein_id="BAC45420.1"
FT                   /translation="MTPDRSLIVVEDDEGFARTLKRSFERRGYDVVLAGSIEEVRKVLE
FT                   ERSFGHAVVDLKLGGASGLACVELLHTHDEEMLIVVLTGFASISTAVEAIKLGACHYLA
FT                   KPSNTDDIEAAFNKAEGNAEVALDARPTSIKTLEWERIHQTLIETDFNISEAARRLGMH
FT                   RRTLARKLEKRPVK"
FT   CDS_pept        complement(152504..153490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0156"
FT                   /note="ORF_ID:bll0156"
FT                   /note="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45421"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45421"
FT                   /db_xref="GOA:Q89XZ9"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XZ9"
FT                   /protein_id="BAC45421.1"
FT                   /translation="MKPNVEQGRGSFRAQAVSQKTRKKSTSARASHKEAKKVAAASRSA
FT                   SKGRTATKAPAAKSSKNKRSAMPNKTAKPAAKATVAKPAAAKVPAAKPAAPKASVAAPA
FT                   KAPVAAKPAVKPAAAAPKVEEKKVVTQRQGFKANEFVVYPAHGVGQILAIEEQEIAGAK
FT                   LELFVINFIKDKMTLRVPTAKVANVGMRKLSEPALVKKALETLKGRARVKRTMWSRRAQ
FT                   EYEAKINSGDIVAIAEVVRDLYRSESQPEQSYSERQLYEAALDRLSREIAVVQHSTETE
FT                   AVKEIEAQLAKSPRRNAKAEATEGEADAEGDADDTDGDDTTVADEAA"
FT   CDS_pept        complement(153637..153975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0157"
FT                   /product="ferredoxin"
FT                   /note="ORF_ID:bll0157"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45422"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45422"
FT                   /db_xref="GOA:Q89XZ8"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XZ8"
FT                   /protein_id="BAC45422.1"
FT                   /translation="MTYVVTENCIKCKYTDCVEVCPVDCFYEGDNMLVIHPDECIDCGV
FT                   CEPECPADAIKPDTEPGLEKWLSVNADYAKSWPNITQKKESPADAKEFDGMEGKFEKYF
FT                   SPNPGSGD"
FT   CDS_pept        complement(154108..154338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0158"
FT                   /note="ORF_ID:bsl0158"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45423"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45423"
FT                   /db_xref="GOA:Q89XZ7"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XZ7"
FT                   /protein_id="BAC45423.1"
FT                   /translation="MVKARTSAAELVESGHVRVNGTRETSPGHAIKVGDVLTIALDRTV
FT                   RVLKVIAFNERRGDAASARVLYEELGEGKRN"
FT   CDS_pept        complement(154387..157758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgpS"
FT                   /product="ATP-dependent helicase"
FT                   /note="ORF_ID:bll0159"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45424"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45424"
FT                   /db_xref="GOA:Q89XZ6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XZ6"
FT                   /protein_id="BAC45424.1"
FT                   /translation="MAFPPSPFASERAPGAGVTAVLGPTNTGKTHLAIERMLAHPSGMI
FT                   GLPLRLLAREVYNKIADRKGVESVALITGEEKIKPKNPRYWVSTVEAMPRDLDVSFLAV
FT                   DEVQIASDLERGHVFTDRILNRRGRDETLLLGAATMRPIIERLLPGVSMITRPRLSQLE
FT                   FAGDRKITRQPRRTAIVAFSADEVYAIAELIRRQHGGAAVVLGSLSPRTRNAQVSMFQN
FT                   GDVDYLVATDAVGMGLNLDVDHVAFASDRKFDGYQFRRLTPSEFAQIAGRAGRATRNGT
FT                   FGTTGRCAPFEPELVNALQNHTFDSVKMLQWRNSKLDFSSLGALQVSLNLSPGHEALTR
FT                   APIAEDMRVLDHVARDADVRDTAHGKLAVERLWEACQVPDYRKLSPAAHGELVTTLYGF
FT                   LMQKGRIPDAWFAAQVDQADRIDGDIDTLSGRIAQIRTWTFVANRPDWLADPEHWQGIT
FT                   REVENKLSDALHERLTERFVDRRTSVLMRRLRENTSLNTEIGKTGEVIVEGHVIGRLDG
FT                   FTFAPDAAEAGSDAKALQAAAQAVLAGEINARAEKLGNAPDEQFVLTSEGTIRWTGDAV
FT                   ARLSAAEDALHPRIRIISDERLTGSPREKVQARLDLWLKTHIEKLLGPMFELSKAEDVT
FT                   GIARGIAYQLVEALGVLERPRIANELKDLDQPSRATLRKYGVRFGAYHLYFPGLLKPAA
FT                   RALAALLWALKQDNVDLSSLSGAQHLASSGRTSFPVDKALPRDAYRVLGYKQAGERAVR
FT                   VDILERLADLIRPALAWRENSPGEKPAGAFDGRSFIVTQAMTSLTGSAGEDFASVLRAL
FT                   GYRMEKRPPLPPKPVAVVAEASSAEAPAETSATETPVEDAVATDTPIEVAAEAVTVEDA
FT                   PGMEQHDEPAPEEPALAASLEAPVTPEDAPGIAPPAEEAAAPTEAAGLEAAPAEAAAVE
FT                   AAASPDAAAPVEAAAAPAEPELVEVWRPGGRHEDRKPRHERHRHQRHHQPRPQAGAEAG
FT                   AAPAEGEAAQAADGEKRGERHRHGGHRKDFRKGREGGADGAPRPEGRDDKNRSFQGKDR
FT                   DKDRDRNKGKFGGDRDKGRDNRGRDRDKGRDRQGGPSLRPYASSANPRERDRPVDPNSP
FT                   FAKLAALKEQLAGRKE"
FT   CDS_pept        complement(158129..158317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0160"
FT                   /note="ORF_ID:bsl0160"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45425"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45425"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XZ5"
FT                   /protein_id="BAC45425.1"
FT                   /translation="MGLFSQFLFWRPRSVNPFDSSPILIRLRAVPNFKEPAIETSLVRQ
FT                   PKTPSSAIKHRVPRHVA"
FT   CDS_pept        complement(158536..159414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0161"
FT                   /note="ORF_ID:bll0161"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45426"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45426"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XZ4"
FT                   /protein_id="BAC45426.1"
FT                   /translation="MPISSRFAPKPRIASPRSAARLAMAALCGLVFAWEAKPAAAQGKL
FT                   EAQYEATLAGIPVGRGAWNIDIQDDVFAAAASGGTTGLLKSFAGGSGTGASQGRVVNGA
FT                   LVATGYQASTTTSKKTEEIHITLDKGNVKEFGIVPEPPVDPDRIVVTEAHRRGVWDPMT
FT                   ASLLRVPGTGDPVTPDACHNAAPVFDGRMRYDLKLDFKRMETVKAEKGYRGPVVVCALY
FT                   FVPVAGYIPDRPVIKYLAAQRNIEIAFAPVAGTRILVPFWLKVPTPLGPAMLEATSFIT
FT                   SAQPPRVAKTQ"
FT   CDS_pept        159877..160185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /product="50S ribosomal protein L28"
FT                   /note="ORF_ID:blr0162"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45427"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45427"
FT                   /db_xref="GOA:Q89XZ3"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XZ3"
FT                   /protein_id="BAC45427.1"
FT                   /translation="MSRRCELTAKGPLVGHKVSHSNIKTKRRFLPNLVNVTFISEALER
FT                   NVRLRVSTNAVKSVDHNGGLDAFLLKASADALSPRALELKRAIQKKVGVTAPVKKAS"
FT   CDS_pept        complement(160425..161147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0163"
FT                   /note="ORF_ID:bll0163"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45428"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45428"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XZ2"
FT                   /protein_id="BAC45428.1"
FT                   /translation="MTIGVLPGANIVRQYAQDSIDDHAIENISLLMEIRDNAIHFHNVG
FT                   RDLHKRVQEVGAAALRNFAFAARKWFDCDLSQYQFALMPVAFETPAGVIQTVFGDDTKG
FT                   AAGKLAKLLADQERKFPFEAAKPFNVGVEVELRFVRNSNAQAMPVIVSPNDPNAIRVTL
FT                   SEEDMLKRYPWDYRTLCKALRKTPDFKENERFHKLRRPLEDDPRFCRVRLLDPRNKKSS
FT                   KQRFYSPAILDEIVKHYV"
FT   CDS_pept        161169..161486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0164"
FT                   /note="ORF_ID:blr0164"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45429"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45429"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XZ1"
FT                   /protein_id="BAC45429.1"
FT                   /translation="MRLVPDYRSEFFEKMLGKGDLLANYSRSVFKKTGRKEVTHAVWQE
FT                   NVGHFQINHWFNLRPHPSFGSPLDGSTTIYEIVANDFDLASQKRVMESWIWGEPGNGDH
FT                   P"
FT   CDS_pept        161639..162289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0165"
FT                   /note="ORF_ID:blr0165"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45430"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45430"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XZ0"
FT                   /protein_id="BAC45430.1"
FT                   /translation="MPSRFAPGEAPMCVALLTYANLSARLKISREAARSLARRRRLPRS
FT                   RSDDGKALVSVDLSALRYTPRPRKGRRADPVDASMTKIEALEPFPFRWSRNGAPDSYSD
FT                   AFSSREPVSTSLENALEIGAFKAEIARLEDVAAAYRAVFERERERADRLAVELTQAAAE
FT                   TTAANAWAARLEDEVTALRNDRRPGEAIAGYAARRLGHLAASIVQADRAARTR"
FT   CDS_pept        162379..163638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /product="cell division protein"
FT                   /note="ORF_ID:blr0166"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45431"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45431"
FT                   /db_xref="GOA:Q89XY9"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XY9"
FT                   /protein_id="BAC45431.1"
FT                   /translation="MASNTDIHEMKARIVVFGVGGAGGNAVNNMITAGLQGVEFVVANT
FT                   DAQALAMSKATRLIQLGTTVTAGLGAGSQPELGRAAAEEVIDTIREHLTGAHMVFVTAG
FT                   MGGGTGTGAAPIIARTARELGILTIGVVTKPFYFEGQRRMRFAEAGVEELLKTVDTLLI
FT                   IPNQNLFRVASEKTTFADAFALADQVLYSGVACISDLIVKEGLINLDFADVLSVMKEKG
FT                   KAMMGRGEASGEKRVLAAAVAAISNPLIENPSIKRASGLIISITGGRDLMLYEVDEAAT
FT                   RIRDEADPDANIIVGASFDESLEGIVRVSVVATGIDNLDPAQQALPVETALTQLAGRLR
FT                   NDGRRIADRIERSAPLPQAASPPLRPQPHHPVGPPARPGLDYAPQAALQPLDPYGRAPA
FT                   RNLPDEAALDIPAFLRRAAN"
FT   CDS_pept        complement(163852..164532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0167"
FT                   /note="ORF_ID:bll0167"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45432"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45432"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XY8"
FT                   /protein_id="BAC45432.1"
FT                   /translation="MSAHVTRPRLMPVSADPAIRSVARLAVRAKAVLQGKAPVPRSKAM
FT                   FGKDDLVDNLSRDLDRARGRRDALASEATTLTAQIAEIEARLSEEKKRRERERVLSEVE
FT                   AIKTRIKQAAGAFAPVVDGLSRAIEQAAAVVPEARELNSFLVSVATEIDSVLDPLLREL
FT                   DQRADAVRTGQAALDLPSSAIEAPPIELPKDTNERLLRFPAWLSRDRETDKKDTAESPR
FT                   STAA"
FT   CDS_pept        complement(164717..164995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0168"
FT                   /note="ORF_ID:bsl0168"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45433"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45433"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XY7"
FT                   /protein_id="BAC45433.1"
FT                   /translation="MTLTSSRFVGYEQDRGIVQFLMQDGSKEIACAISTSAMDYLERGP
FT                   QARPEQREAQFTRLRDRIEARAASKYRATEFEGTPPGIVLRSIDFRG"
FT   CDS_pept        complement(165281..165577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0169"
FT                   /note="ORF_ID:bsl0169"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45434"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45434"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XY6"
FT                   /protein_id="BAC45434.1"
FT                   /translation="MTDVPVDLDRHRGMAAQKATDLRRALAEVENNVRELREREADLEN
FT                   RLMTVPATSWPEAAVKARYLLNLYAASLSTEDSRHRALVTALFDDFARLSGDS"
FT   CDS_pept        complement(165570..165866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0170"
FT                   /note="ORF_ID:bsl0170"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45435"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45435"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XY5"
FT                   /protein_id="BAC45435.1"
FT                   /translation="MTIRSRRETVTFRHPFRINGIDRLLPAGSYDVVTDEEMIEGLSFP
FT                   CWRRIATMITVPAESGGAGMTEMLSIGSVDLADAQAADAQAAPASVAQRVAHD"
FT   CDS_pept        166150..166620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0171"
FT                   /note="ORF_ID:blr0171"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45436"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45436"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XY4"
FT                   /protein_id="BAC45436.1"
FT                   /translation="MVLPCSGRSVRCRGFASRNGSFHRSTSRCSFCSWSARRPSSMART
FT                   MRVPYLVSGTNEYGGSNLGRGSATVALRLARKLLREGYMDVRVCTPRGRVLQSDELDEL
FT                   KPPQETDAMAKGQQRGNRETKKPKKDKTKVIAAAPSRKDAAWQPDFGPAKKK"
FT   CDS_pept        166680..168188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0172"
FT                   /note="ORF_ID:blr0172"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45437"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45437"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XY3"
FT                   /protein_id="BAC45437.1"
FT                   /translation="MRGTLRESSSQLPCGDSPSPRKRGEGAHLRCGNHHRLLAVALFCY
FT                   TRPGSIAGRGRPVEHERRTEPKTEPKHLVICCDGTGNEISENISNVLKLYRCLRKTDKT
FT                   QPRQMVFYDPGVGTVTEPTTWHRLKANVNLVLGLATGYGLDDNVLSAYCFLVEHYAPGD
FT                   KIYLFGFSRGAYTVRVLAGLIHKVGLISPEQANLAGSGLVAYKQYSGSGRGNDIADLKD
FT                   VGSDDDGPLPQDKFDLAAQFARITSSRWPTIHFIGVWDTVASVIVPRPDRLYWPSFEEL
FT                   AFTLRNPSVKIFRQAIAIDERRCMFRLKQWREPQEYWSNRFVPDDKKEPQDIMQVWFAG
FT                   VHSDVGGGYPEAQSGESKYPLIWMIDEAGKAGLNFNPRTVNQLAWGVHRKNSPFQYVPP
FT                   AYTGKTGELHNSMTAAWRLLEYLPKSAKYKEWPERKVFLGFYIPDCEPRLIPEGAHVHE
FT                   SVVKRMAVEPDYRPVNLPKTYETVPMPVPPHVGAAAETDEMVTG"
FT   CDS_pept        168368..168619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0173"
FT                   /note="ORF_ID:bsr0173"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45438"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45438"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XY2"
FT                   /protein_id="BAC45438.1"
FT                   /translation="MPMHPRKFARVKPAGLVSRQAKIITDPRAPVIPCTLIDYSPGGAC
FT                   VDLGGQVSIPDRFELLHVNTKKRCRIAWKRGSRVGVVF"
FT   CDS_pept        complement(168820..169227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0174"
FT                   /note="ORF_ID:bll0174"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45439"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45439"
FT                   /db_xref="GOA:Q89XY1"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XY1"
FT                   /protein_id="BAC45439.1"
FT                   /translation="MRYPVRKAAHIFERVGLAMAGAACGLFVGAYVGSAIPVLTTQGFL
FT                   LLMMALGAVGFYLGIDTPQLPFDEAHSAIDAAEFLSSAGTLCATLTALASVAVIVLRLD
FT                   PHLAWTWLSLFGWVGGVAMQIVAGAKARMRK"
FT   CDS_pept        complement(169397..170509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0175"
FT                   /note="ORF_ID:bll0175"
FT                   /note="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45440"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45440"
FT                   /db_xref="GOA:Q89XY0"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XY0"
FT                   /protein_id="BAC45440.1"
FT                   /translation="MSALFSPIKLRGLTLKNRVVVSPMCQYSAEDGVPTDWHFTHINNL
FT                   SLSGASMFCIEATHVEAIGRITPGCLGLYSDAAEAALKQILASVRKHSTTAVAMQLAHA
FT                   GRKASSARPWDGGQLIPVSEGGWQTVAPSALPHKEGEAAPLALDAAGLTRIREAFVEAA
FT                   KRAERIGIDAIELHGAHGYLLHQFLSPISNRRTDEYGGSLQNRMRFPLEVYDAVRAVFP
FT                   HDKPIGMRVSSTDWVEGGWDLAQTIEFASALKARGIDWIDASSGGVSPLQKIPLGPGYQ
FT                   VHFADAIRRETGLPTIAVGMISDAKHAEEIVASGKADMVALGRGMLYDPRWGWHAAAEL
FT                   GGEVEAPPQYWRSQPSTQKALFGKTTFGAR"
FT   CDS_pept        complement(170660..171361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0176"
FT                   /note="ORF_ID:bll0176"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45441"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45441"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XX9"
FT                   /protein_id="BAC45441.1"
FT                   /translation="MQLRRAIAALLFVVLAGLPQARATAEHTYAKGEYGIISGGWAPNK
FT                   RLAIAVHGEGDGAHDKFHAYLMAEPGHRRLMTLDNVNDDNILDTAPDAFHAAWSADSRY
FT                   VAVTFRSERHIVTLNLYAVDGRRARLVDAPDLFRDATGRSIDRKTDGDMRTSVPALTWQ
FT                   APRRFHLTDYRVFVLDGTALADKLGPLGKATAMKDGRTTIQFSAEADGELLPDGRIRMG
FT                   KPRAGQFEELE"
FT   CDS_pept        complement(171405..172475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0177"
FT                   /note="ORF_ID:bll0177"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45442"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45442"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014567"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XX8"
FT                   /protein_id="BAC45442.1"
FT                   /translation="MSTLRSRRSFLGHAAAGFSTFALSRFAQAQATTEPPPRPLQVERA
FT                   VAEPVSIEVNARPIPNFEPRDRSRTRFGSLEYRSGLVLTSPYRGFGGLSGIRLDAKGER
FT                   FLAVSDQGGWFTGAIRYSGSRMAGLDDVEAAPLLNAEGRPITEKRLWWDSESLTRDGNV
FT                   VYVGLERVNQILRYDFSKGGTRARGEVIQVPPALRKLPHNKGLEGLVFVPKGQPLAGTL
FT                   IAFSERGLDADGNLVAFLIGGPTPGQFSVRRTEKFDISDAVLLPSGELLILERKFSWFT
FT                   GVDIRIRSIPLKSIAPGAVVDGPALFKADLGQEIDNMEGIDAHVTPEGDTVLTLVSDDN
FT                   FSMLQRTLLLQFTLVE"
FT   CDS_pept        complement(172472..174379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /product="cobyrinic acid synthase"
FT                   /note="ORF_ID:bll0178"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45443"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45443"
FT                   /db_xref="GOA:Q89XX7"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XX7"
FT                   /protein_id="BAC45443.1"
FT                   /translation="MSTSSSNSKFRNSKEAPTEPFKRSVASCLKAIAKSPELEVSFAAE
FT                   RPGLAPGKARLPEPARKMTKRDAAIVRGHADSIALKLACHDPKLHRKLMPGNPQARGVF
FT                   EAVEQARVEAIGARRMAGVAKNLTAMLDDHFHRGKFDEITDRADAPLADALAMLVRERL
FT                   TGMAPPTAAKKMVDLWRPILEDKIGKRLDRLDGVVEDQTRFGDAVHDLLSALELGDERN
FT                   ADSEENDDDDENRDGDNDQSGAEGSPDSDAAQEMSADQAQASSEEMSESAMESAQASTS
FT                   DTFDDGELGDDETPGEATRPNAHGKNEPRGPEYHAFAPKFDEVIAAEDLCDHDELERLR
FT                   AYLDKQLAHLQGIVARLANRLQRKLMAQQNRAWEFDLEEGILDPARLSRVVTDPYHPLS
FT                   FMHEKEATFRDTVVTLLLDNSGSMRGRPITVAATCADILARTLERCGVKVEILGFTTRA
FT                   WKGGQSREAWLAAGKPANPGRLNDLRHIIYKSADAPWRRARKNLGLMMREGLLKENIDG
FT                   EALDWAHKRLLGRPEQRKILMMISDGAPVDDSTLSVNAGNYLERHLRHIIEEIETRSPV
FT                   ELIAIGIGHDVTRYYRRAVTIVDAEELGGAITEKLAELFSETATAPQPSASRPRRKLHS
FT                   "
FT   CDS_pept        complement(174376..174786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0179"
FT                   /note="ORF_ID:bll0179"
FT                   /note="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45444"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45444"
FT                   /db_xref="GOA:Q89XX6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XX6"
FT                   /protein_id="BAC45444.1"
FT                   /translation="MATITVERTIGTTKKAVLAGLGAYNDEHFGKQKVRSIAVSLKDRR
FT                   KIVGGIVGHLWATVLFIQYFWIDQKQRGKGFGTKLIAAIEDEARRHGAIQAYVDTMSFQ
FT                   APGFYRSCGYEEFGTLKGYPGGVTRHSFTKSL"
FT   CDS_pept        complement(174790..175923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /product="cobalt insertion protein"
FT                   /note="ORF_ID:bll0180"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45445"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45445"
FT                   /db_xref="GOA:Q89XX5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006537"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR025865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XX5"
FT                   /protein_id="BAC45445.1"
FT                   /translation="MKRQRNFDWRAGFCPHVVSDRFANAPSRSHRAITGLGIARGLGGL
FT                   MTTAAMSKVEEVSGLPDMKVSVRQVFGIDSDLEVPAYSEVDPHVPEVDSDYRFDRATTL
FT                   AILAGFARNRRVMVTGYHGTGKSTHIEQVAARLNWPCVRVNLDSHISRIDLVGKDSIVV
FT                   RDGKQVTEFRDGILPWALQHNVALVFDEYDAGRPDVMFVIQRVLEVSGRLTLLDQNKVI
FT                   KPHPSFRLFATANTVGLGDTSGLYHGTQQINQGQMDRWSIVTTLNYLSHDEEVEIVLAK
FT                   AKHYRTQEGRDIVNKMVRLADLTRNAFANGDLSTVMSPRTVITWAENADIFGDIGFAFR
FT                   VTFLNKCDELERPLVAEFYQRCFNAELPESAVNVALS"
FT   CDS_pept        176085..176744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0181"
FT                   /note="ORF_ID:blr0181"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45446"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45446"
FT                   /db_xref="GOA:Q89XX4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XX4"
FT                   /protein_id="BAC45446.1"
FT                   /translation="MTSFLDPFIAFVSAHAWLAYLTLFLAALLEAVPVVGSVVPGSTII
FT                   LALSALIPGGELKLGWVLLAAALGAVLGDGSAYWIGHRQQREILNTWPLTNYPRVVEES
FT                   ESFFHRFGTWAVFFARFVPPIRAFVPVTAGALGMPPARFYAINIPAILVWAPAHVLPGV
FT                   LAVSALHEYAGLPHHEHVGKHIWMLAVIGGAIMLSVTVWIYRRRSGGGVAAAKPRV"
FT   CDS_pept        complement(176898..178115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cisZ"
FT                   /product="citrate synthase"
FT                   /note="ORF_ID:bll0182"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45447"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45447"
FT                   /db_xref="GOA:Q89XX3"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XX3"
FT                   /protein_id="BAC45447.1"
FT                   /translation="MKNSDELYLSAREAAAELAISPATLYAYVSRGLIRSEPTPDSRKN
FT                   RYRAEDVRALKERRVPSPEPRGLRSFDADLPVMDTEISTITEEGAIYRGVNCVDLAEND
FT                   TLEHTATLLWDVSGVDPFAPDNQPEISEEMRTIAGAARRAAPIDRAIAVLALAASADPR
FT                   AFTRAPDGRAMVGARIVRLLVATMLNAEASAEPLHQQVARVWAADNKHAPDLIRRALVL
FT                   LADHELNASTFTARCAASTGLNLYDAVIAGLAALKGPKHGGAGVLASQLVKTLVDRDVA
FT                   PVVRERVALGERFAGFGHGVYKRGDPRAQSLLNALSRAGAPRKFTREVPERIAEATGEF
FT                   VNIDYALAVLVHALRLPAGSELALFAMARSVGWIAHASEQLQFGKLIRPRARYVGPAPG
FT                   RRTGGS"
FT   CDS_pept        178194..179288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cis"
FT                   /product="citrate synthase"
FT                   /note="ORF_ID:blr0183"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45448"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45448"
FT                   /db_xref="GOA:Q89XX2"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XX2"
FT                   /protein_id="BAC45448.1"
FT                   /translation="MNIHLTKSQIGLDGVPAAETVLSHVDGERGELIIAGEHVGRLAAK
FT                   SSFEGVTARLWNGASKTSLSEANVRASLGAARERAFARLAELLPATHGMGIVDGFRAAV
FT                   AGLRAEHGLEHEATIVGAFPVISGALVRRAKGLDPVAPDPSASHAADTLRMLHGRAPAT
FT                   REVTALDAYLVTVCDHGMNASTFTTRVVASTQADLFAAVTAGYCALTGPLHGGAPEPVL
FT                   EMLDAIGSRERIQPWVDAALARGERMMGFGHRVYRVRDPRADVLKTAIEALASNGADLP
FT                   FAGEVEAYIRAALRKKNPDRPLETNVEFFTAILLDALAIPRQAFTPIFAVARAAGWTAH
FT                   AREQQRTGRLIRPSSSYVGAVPEA"
FT   CDS_pept        complement(179535..180167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /product="molecular chaperone DnaJ family"
FT                   /note="ORF_ID:bll0184"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45449"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45449"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XX1"
FT                   /protein_id="BAC45449.1"
FT                   /translation="MPIDSSKFFDSIRVKPRGKQPEVKPRDTAVACEWAGCQNKGAHRA
FT                   PKGRENQREYWHFCLNHVREYNQNYNFFSGMNADAVARYQKDALTGHRPTWKMGANGGK
FT                   KGAEADIDMASDPFSMFSEINGRANWRKGPDAQPKAETRKVMNAERKALQVMGLGPSAT
FT                   LADVKSKYKALVKQHHPDANGGDRSTEDRLIEIIKAYNYLKTVVREA"
FT   CDS_pept        180275..180544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0185"
FT                   /note="ORF_ID:bsr0185"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45450"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45450"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XX0"
FT                   /protein_id="BAC45450.1"
FT                   /translation="MVMSDIISNKLQEAFTPESLQVVDESHLHEGHAGHRPSGETHFRV
FT                   YIVSQAFKGKSRVDRHRMINAALAAELSGSVHALAIHAQAPGEN"
FT   CDS_pept        complement(180636..181940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0186"
FT                   /note="ORF_ID:bll0186"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45451"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45451"
FT                   /db_xref="GOA:Q89XW9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XW9"
FT                   /protein_id="BAC45451.1"
FT                   /translation="MDWLGFTIVVLCLLVSAFFAASETALTGASRASMLRLSKQGNHDA
FT                   DVVSQLLDMRERLIGALLLGNNIANIGASALATAIFTSWFGDVGVLYATGVMTALVVIF
FT                   AEVLPKTIAINAPDRMALAVARPMRLTMYVLGPLLKIVEVIVRLLMRLFGLAGEHQAIL
FT                   SPTERLRGAVDLLHHEGKFEKQDRDMLGGLLDLRELQVSDVMIHRTEMMMINADLPPEE
FT                   LLREVLATEYTRIPLWREKPENIIGVLHAKDLLRAIRASEGDTSRIDVSTIALPPWFVP
FT                   EMRPVSEQLKAFRRRKTHFALVVDEYGEVEGLVTLEDILEEIVGDISDEHDVVVAGVRA
FT                   QPDGSVVVDGSVPIRDLNRAMDWHLPDGEATTVAGLVIHEARSIPDRGQSFTFHGFRFR
FT                   VLRRERNRITALRISPVPREAEMEEAKPRRAGTSF"
FT   CDS_pept        complement(182033..183181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="ORF_ID:bll0187"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45452"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45452"
FT                   /db_xref="GOA:Q89XW8"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XW8"
FT                   /protein_id="BAC45452.1"
FT                   /translation="MTAPLKHSDPVNVDVALGDRAYDIVIGRGVLASLGERVAALRPGV
FT                   RTAVVTDRTVAKHWLEPTEASLAAAGIPTSRIVVEEGEISKTYAGLEKVSEALIAAKIE
FT                   RNDLVIALGGGVVGDLAGFAAAILRRGVDFVQVPTSLLAQVDSSVGGKTGINSPQGKNL
FT                   LGAFHQPVLVIADTAVLDTLSPRQFHAGYAEVAKYGVLGDEAFFTWLEKNHSDIFKGGS
FT                   AREHAIATSCRAKAGIVSRDERETGERALLNLGHTFGHALEAATGFSDRLFHGEGVAIG
FT                   MTLAAQFSAKLGMIGEADAARVERHLIEAGLPTRLQDIAGFSQEGLADADALMALMAQD
FT                   KKVKRGKLTFILLEAVGRAVIAKDVEPAPVRDFLKEKLAQKA"
FT   CDS_pept        complement(183178..183912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0188"
FT                   /note="ORF_ID:bll0188"
FT                   /note="putative shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45453"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45453"
FT                   /db_xref="GOA:Q89XW7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XW7"
FT                   /protein_id="BAC45453.1"
FT                   /translation="MARVLWRGPLWGRIGGQSRPLLAADRARPRARSRARPMSDAALPI
FT                   QASPEADILSALGARSIVLVGMMGVGKSTIGRRMAARLKLPFVDADTEIEAAAGMTIPE
FT                   IFERHGEGHFRDGEARVIARLLDGGPVVLATGGGAFMREETRARIAAKAVSIWLKADHD
FT                   VIMRRVRRRADRPLLQTADPEGTVTRLLTEREPVYSHADLTIASRDVPHDKIVEECIET
FT                   LRAHLCGEQAAQPPADVASAVR"
FT   CDS_pept        183985..184131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0189"
FT                   /note="ORF_ID:bsr0189"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45454"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45454"
FT                   /db_xref="GOA:Q89XW6"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XW6"
FT                   /protein_id="BAC45454.1"
FT                   /translation="MPSLFRFLTVVAVIAGIVYGVIFALANFVNPKPREMSVTIPPDKF
FT                   LKK"
FT   CDS_pept        184149..185105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /note="ORF_ID:blr0190"
FT                   /note="probable site-specific integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45455"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45455"
FT                   /db_xref="GOA:Q89XW5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XW5"
FT                   /protein_id="BAC45455.1"
FT                   /translation="MRAKPSDAKLTGLFLDMLAAEQGAGPNTLDAYRRDLTDFSEFLGR
FT                   VGHSFADAETQTLRDYLADLDTRGFKSTSVARRLSAMRHLYRFLLNERIRGDDPAAILS
FT                   GPKRGRGLPKVLSIADVDRMLRRARELSEAEDASPSKRLRALRLYCLLEVLYATGLRVS
FT                   ELVALPRTAAKRDARMIVVRGKGNKERLVPLNEASRQAMADYLAATEAAKSDKKTGVAA
FT                   SKWLFPSFGESGHLTRQHFARDLKELAVASGLQARLVSPHVLRHAFASHLLHNGADLRI
FT                   VQTLLGHTDISTTQIYTHVVEERLKSLVRDLHPLAEK"
FT   CDS_pept        185287..186249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /product="carboxyl transferase component of acetyl-CoA
FT                   carboxylaset"
FT                   /note="ORF_ID:blr0191"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45456"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45456"
FT                   /db_xref="GOA:Q89XW4"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XW4"
FT                   /protein_id="BAC45456.1"
FT                   /translation="MQDQMRSYLDFEKPVAELDSKVDELRTLAASGTDITDEIGRIEDK
FT                   AAQALADLYTNLSPWQKTLVARHPQRPHFNDFIKGLITEFTPLAGDRKFGEDEALVAGF
FT                   GRFRGEPICVMGQEKGDSTESRIRHNFGMARPEGYRKCVRLMEMAERFGLPVLSLADSA
FT                   GAYPGIGAEERGQAEAIARSTDACLSLGVPNVAIITGEGMSGGAIAITTANRVLMLEHA
FT                   IYSVISPEAASSILWRDGTKAQEAANNMKITAQDMLRFGVIDSILKEPVGGAHRDPAAM
FT                   IATTGEAIAKAFDELRGLDGDAIRKQRRQKFLDIGRKLG"
FT   CDS_pept        186660..188240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0192"
FT                   /note="ORF_ID:blr0192"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45457"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45457"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XW3"
FT                   /protein_id="BAC45457.1"
FT                   /translation="MGSILISRSLARALLASVALLTASVLLAGCDTDQVSLATNAKANQ
FT                   PVPPKLLAAMVEKDMDLQSPILVRLFKQEAELEVWKQTRNGQFALLKTYPICRWSGDLG
FT                   PKVREGDRQAPEGFYSINPGQMNPQSAYYLSFNTGYPNAFDKALGRTGSQLMVHGDCSS
FT                   RGCYAMTDEQIAEIYSLGRESFFGGQKAFQLQAYPFKMTPVNMAKHRNNPNMPFWKMIK
FT                   EGYDHFEVTRQEPKVDFCEKKYVFDAAKTPDAKRDPVFDASAKCPAYVIPEDIASAVRE
FT                   KDARDQAEYAKLVAKGTPVARMNTGIDGGMNKIFAAKIPEGSTGLSEGAEGTTLQMLAM
FT                   AKAPGTIPGHVNPPKPNFDAAAPSPQEEPVVAVSAPATSTRVAAAAPAEKSQEKSQGGG
FT                   FFSNLGRKMGLGTADTTATASAPPATASVAPATTSTTPPTAASRLKAAVTRFVPGHDKS
FT                   KDAAKDAPKPAVAAAKPAEPVKPDTRLAATRPALKPSVSDGAGDSGQMAGAAPVVSSNS
FT                   FDSRFGAVK"
FT   CDS_pept        complement(188443..189138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0193"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:bll0193"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45458"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45458"
FT                   /db_xref="GOA:Q89XW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XW2"
FT                   /protein_id="BAC45458.1"
FT                   /translation="MPEFLDIKHLDAGYGRSQVLFDVNLGIPWRGGVAVLGRNGAGKTT
FT                   LMKTIVGELPAWKGEVAFDGRDISRRATQERVRAGIGYVPQEHSVFARLSVRDNLAVGS
FT                   LASSKADAVDHVLSIFPKLGQRLDQPAGTLSGGERKMLAIGRAMLGDPKLLLLDEPTEG
FT                   VWIGVIEEITERLIELAKEIAVIIVEQHLDLALRVADYAYVLDRGRVALQGEAGEVRGN
FT                   PELLRYLAP"
FT   CDS_pept        complement(189131..189904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0194"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:bll0194"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45459"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45459"
FT                   /db_xref="GOA:Q89XW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XW1"
FT                   /protein_id="BAC45459.1"
FT                   /translation="MSAASVRTQRRSAMPLLEAAGIKKIFGKLTALDGAALTVGENEFH
FT                   GLIGPNGSGKSTLMKCIAGAEVPTQGKVSFVNTDITAFTPTERARAGMSLKFQITSVLP
FT                   TLTLYDNILLALQAQSSLLDLVFSRTRGALHDQVMTMLTQFRLADRAFDAAAALSHGQQ
FT                   QWLEIAMALAGKPKLLLLDEPTGGMSLEERRVTGELLQPIKKHCSLVIVEHDLDFIRDI
FT                   CDRLTVLDQGKVLASGTVSEIQANKSVQEIYLRRA"
FT   CDS_pept        complement(189852..190937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0195"
FT                   /product="ABC transporter permease protein"
FT                   /note="ORF_ID:bll0195"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45460"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45460"
FT                   /db_xref="GOA:Q89XW0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XW0"
FT                   /protein_id="BAC45460.1"
FT                   /translation="MPKSMSVVREAIAGDEADDAMAEREAAGQVAAGRRVLPIVEGVVL
FT                   VAALLAPLVLQDYLTVFATRVIILALFALSFDLVWGYAGIMSFGQALFFGSAGYGVALL
FT                   ARDLDITNIFLVLPAGTIIGLTFALLLGGFLLLGRHPSSVIFVSLGTLTGSYAADRLAR
FT                   GWYYLGGQNGIPSIAPMTLGGYEFSEGPAFYYLVLGILVVVYLLCRFLVRSQFGLALAG
FT                   LRENEQRIAFFGYKAQHLKAIIFTIGGGVAGLAGSLYAFHEGFVWPNMVGVVVSTQVVL
FT                   YVLFGGSGTLIGAVIGAIIVEGVSFWLSDNYRDIWPIILGLLLLLVILFRPLGLISFVL
FT                   GERERVGSFGANPKEKRNAAP"
FT   CDS_pept        complement(190944..192161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0196"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="ORF_ID:bll0196"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45461"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45461"
FT                   /db_xref="GOA:Q89XV9"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XV9"
FT                   /protein_id="BAC45461.1"
FT                   /translation="MFDRTQLSRRRFLSNFAFASGAVATGVGSWVIPAPWANAAEAPIK
FT                   VGIATDLTGPIAYAGNADANVAKMVIKEINAAGGMLGRPLELYIEDTASNESVAVGNVR
FT                   KLIQRDKVDMVLGGITSSMRNAIKDPIVARGKTLYIYPQLYEGKECTPYLFCTGPTPAQ
FT                   QCDEFIPWLIKNGGKKFALPSANYVWPHTLNVYARKVIESNGGEVVFEEYYPLDQVDFS
FT                   STVNRIISNKVDVVFNTVIPPGVGPFFKQLYEAGFLKNGGRLACVYYDENTLNINQASE
FT                   IEGLASCLDYFKVLTKENPFDAKIQAAYEKDFPGNFLFAAGSAATGTYRGLKLWEAAVK
FT                   EAGKLDRESVAAALDHAKIAEGPGGPAEMVPGKRHCKMKMYTAVAKGGNYEIVGRSDGL
FT                   VDPKEC"
FT   CDS_pept        complement(192166..193023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0197"
FT                   /product="ABC transporter permease protein"
FT                   /note="ORF_ID:bll0197"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45462"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45462"
FT                   /db_xref="GOA:Q89XV8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XV8"
FT                   /protein_id="BAC45462.1"
FT                   /translation="MANAFVAAFEILSFGAIIVLIVLGLGIIASMMGIFNFAQGEFVLL
FT                   GAYITYLAYAGGLPIWAGMVAAPFVVGALGFVLEALIIRRFYAAPIVAMLGTYALGLII
FT                   RESVRGLIGGFYLTVPEPIGGSIDIGAMHISAWRFTIIVITLLVMGGCYLLLSRTSFGL
FT                   RVRATLENPSLARASGISTPLIYGATFAFGAALAGLAGALIVPVFSLFADLGLRFLIQG
FT                   FVAVMVGGVGSFIGPVAGAGVIGTLSAALPWVMAPVVADVLVFVLAIIFIKFRPQGLIA
FT                   GKGV"
FT   CDS_pept        complement(193060..194574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0198"
FT                   /product="amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="ORF_ID:bll0198"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45463"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45463"
FT                   /db_xref="GOA:Q89XV7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XV7"
FT                   /protein_id="BAC45463.1"
FT                   /translation="MTVVLPTPAQLRSVAEQCGLSLTDDDVASFRGLMQGSIEAYNLVA
FT                   AMPDEVPEVKYPRTPGYRPSAEENPRNAWYRKATVKGAAGGKLKGKTVALKDNIMLAGV
FT                   PMTNGSSTLEGYVPDFDATIVTRMLDAGAEIKGKVHCEHFCLSGGSHTGSFGPVHNPHK
FT                   MGYSAGGSSSGSGVVVALGEVDMAIGGDQGGSIRMPSSFCGIYGMKPTWGLVPYTGIMP
FT                   IEIYVDHTGPMTATVADNALLLEVLAGDDGYDPRIKAPKVEEYTKALGQGVKGMKIGIL
FT                   KEGFEQPVAEAAVNESVREAAKRFKDLGATVETVSIPMHLLGGAIWTPIGTEGLTQTMM
FT                   FGDGYGLSRGDLYSTSLMDFHRGWRRQADSLSETTKLFMMLGTYINNNFGPRFYGKALN
FT                   ISRRLTAAYDKAFGDYDLLLLPTTPMKATKLPEPTASREDYVARALEMIGNTAPFDITH
FT                   HPAMSLPCGMVDGLPVGLMLVGRMFEESTIYRAAHAFEQIGDWKKM"
FT   CDS_pept        complement(194739..195959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0199"
FT                   /note="ORF_ID:bll0199"
FT                   /note="probable nitrile hydratase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45464"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45464"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XV6"
FT                   /protein_id="BAC45464.1"
FT                   /translation="MCFQVWCQTGVGVRATVNFPAHGGPALPPSLLFRNLSSSAADFDL
FT                   SPLDAHFMKRRGARNKLRIGNFLTFTGSPGIWGPTSTNSAMLAVAEINKRGGILGRELE
FT                   LSIYDSGGPIDEVVQRAEQAIAFDEVDLIMGSHISAVRVALRKVTGNRIPYIYTPVYEG
FT                   GERTPGVMAIGETPRWQSRPAIHWLADVKKAARWYLIGSDYVWPWQSHRAVKRYIKEAG
FT                   GQVVGEEFVPVGEDNHEAHLARIHAAKPDAVLISLIGTDSITFNRAFAEAGLATSTLRL
FT                   AGAMDETVLLGIGADNTENLFCASGYFNCMASRANDEFLSGYQAMFGPHAPPVGSVGQS
FT                   NYEGLRFLESVANRAGSLAFRPLLKAARNTVYSAGRGPVTIRDGRAEMPMYLAEADGLD
FT                   FKLIKTL"
FT   CDS_pept        196103..196546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0200"
FT                   /product="transcriptional regulatory protein"
FT                   /note="MarR family"
FT                   /note="ORF_ID:blr0200"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45465"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45465"
FT                   /db_xref="GOA:Q89XV5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XV5"
FT                   /protein_id="BAC45465.1"
FT                   /translation="MAKPSKENTPITEHLAYLLAQANREINRQLELRLSKEGVPVEQWR
FT                   ILKVLSDGNGHSMGELADAVLLNHPTLTKMIDRMVSDTLVYRVQDPNDRRKVLMFISDR
FT                   GKVLCKKLNSLAVDQEEHILESYGNKSTSELKRLLESLIDSSN"
FT   CDS_pept        complement(196597..196788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0201"
FT                   /note="ORF_ID:bsl0201"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45466"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45466"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XV4"
FT                   /protein_id="BAC45466.1"
FT                   /translation="MTDLKLNEACIPSSHTLVNRTEIYGVPHTGGLGHANAGGMAKVDR
FT                   VWATLAARFSRMRDQLWR"
FT   CDS_pept        complement(196791..197453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0202"
FT                   /note="ORF_ID:bll0202"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45467"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45467"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XV3"
FT                   /protein_id="BAC45467.1"
FT                   /translation="MFRLSRDFPICISHVVGFLINNQGLCANQEVKTRVHSWIRSILAI
FT                   HLPQGHNFEVAWSLVAAGVLRIKLEASDVPTDSAFPGSIIIALFGLLWERNLIGFSLSR
FT                   WDWRGVLRAQGTFGENWLLLYEAVRRGWTKDRKLISHANGHTLLALALKENVAFLRDDV
FT                   LDARRINLDRRTFRPKAASGDLKGSLPQVTKGAPKRTTPVFLHRGSDSIADLYEGVP"
FT   CDS_pept        complement(197458..198510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0203"
FT                   /note="ORF_ID:bll0203"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45468"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45468"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XV2"
FT                   /protein_id="BAC45468.1"
FT                   /translation="MKASKLRPRDFLQCLLSTAYLPEELPPTVTSREYSEFCRRNYALV
FT                   RAEKDKLIKLATSYDTYSAPRNVPGRRALAVVHPLAQLGVSLLITERRAEIRSLLKKSG
FT                   TSLYDVSEAAAQAKAFAGLDFQKRRTLAAKLHSEKPFILQADISRFFYTAYTHSIPWAV
FT                   LGKEKAKELLRTNRKKLNAHWSNKIDEALQSCQSRETFGIPVGPDTSRVLAELLLSGVE
FT                   TDKSLSKYLQPTNAFRLLDDFSIGFDNEADARQALRAIRQVLWRYNLQLNEEKTKIITS
FT                   PLIFREKWKLDFDKAPLSQIDPQQQLRDIEYLVDLALNACFESRGNSGSMGLPPPKSGD
FT                   SSRRHLSHLA"
FT   CDS_pept        complement(198903..201743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /product="preprotein translocase SecA subunit"
FT                   /note="ORF_ID:bll0204"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45469"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45469"
FT                   /db_xref="GOA:Q89XV1"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XV1"
FT                   /protein_id="BAC45469.1"
FT                   /translation="MIGALARKFFGSANDRRVKGYQSRVNAINALEPELIKLSDEELKA
FT                   RTADFKKQLAEGKTLDDLLVPAFATVREAAKRTLGQRHFDVQLIGGMVLHEGDIAEMKT
FT                   GEGKTLVATLAVYLNALAGKGVHVVTVNDYLARRDSGWMGQIYGFLGMTTGVIVHGLDD
FT                   AERKTAYACDITYGTNNEYGFDYLRDNMKYRLEDMVQRPHFFAIVDEVDSILIDEARTP
FT                   LIISGPLDDRSDFYNTIDGFLPKLDKTDYDVDEKQRTVTLTEAGMEKIETLLRDAGQLK
FT                   GESLYDVENVSVVHHINQALRAHTLFTRDKDYIVRDDEVVIIDEFTGRMMPGRRYSEGL
FT                   HQALEAKEHVQVQPENQTLASITFQNYFRMYEKLAGMTGTAATEADELFDIYKLEVVEI
FT                   PTNLSVARLDEDDEVYRTQKEKYAAILAEIERANARLQPVLVGTASIEKSEVLAEFLKS
FT                   NGYKQIDFGKENALDKLYAAARAGKPSKLFAVLNARFHEQEAYIVAEAGVPGAITIATN
FT                   MAGRGTDIKLGGSLEMRVPKETAGIEDEAEKARKIEQIKADVERFREIVLKAEEIVEIE
FT                   PAKGSKPAKTVTKPGGLYIIGSERHESRRIDNQLRGRSGRQGDPGRSKFFLSLEDDLMR
FT                   IFGSDRLDSMLQRLGLQEGEAIIHPWINKALEKAQQKVEARNFDIRKNLLKFDNVQNDQ
FT                   RKVIFDQRVDLMKDDSVAETVTDMRHAFIDDLVAKHVPEHAYAEQWDVAGLKEELKRVL
FT                   DLDLPVDDWAKEEGIADEELLNRIENRADEHMAAKVAQWGPDVMRYVEKTILLQTLDHL
FT                   WREHLIMLDHLRQVIGLRGYGQRDPLQEYKTEAFNLFQEMSAHLREAVTAQLMRVEIVP
FT                   PEQEAPVLPPMEAHKFDPNTGEDEMALASVTLGAPASDAAQRDPKNPASWGKIGRNEDC
FT                   PCGSGKKYKHCHGRYA"
FT   CDS_pept        202049..203020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0205"
FT                   /note="ORF_ID:blr0205"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45470"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45470"
FT                   /db_xref="GOA:Q89XV0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XV0"
FT                   /protein_id="BAC45470.1"
FT                   /translation="MSAPLEQPPASTKGFSMTTSFPVTKTGLRFGLATALVGCLALALI
FT                   AGPGRAADDPVLAKVNGAEIKKSDVAMAEEELGPSLAQMDPATKDENVLSFLIDMKIVS
FT                   KAAEDKKVADSEEFKKRLAFARNRLLMDSLLANEGKAATTPDAMKKVYEEASKQITGEQ
FT                   EVRARHILVETEDEAKAVKAELDKGADFAELAKKKSKDPGSADGGDLGFFTKEQMVPEF
FT                   SAVAFALEPGKISDPVKSQFGWHIIKVEEKRNRKAPDFEQVKAQIEQYVTRKAQADYVA
FT                   KLRTEAKVERLDQPAADAKPADAAKPSDAKPSDSKMAPPAKK"
FT   CDS_pept        203123..204364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /product="arginine biosynthesis bifunctional protein"
FT                   /note="ORF_ID:blr0206"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45471"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45471"
FT                   /db_xref="GOA:P59610"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59610"
FT                   /protein_id="BAC45471.1"
FT                   /translation="MSSSVSPLAPKTVPDMPVIAGVRLATAEAGIRYKNRTDVLLAVMD
FT                   KGTAVAGVFTKSKCPSAPVEWCRAKLKGGKARALVVNSGNANAFTGKTGRSSTALTAKI
FT                   AAKAVGCSESEIFLASTGVIGEPLDATKFDGVLGRLAETAEPGDYLAAAKAIMTTDTFP
FT                   KVATATVKLGKAKVTINGMAKGAGMIAPDMATMLSFVFTDAPIAPAALQALLKSGVEDT
FT                   FNAVTIDGDTSTSDTLLAFATGAAAEHGAPKISRASDPRLKAFVKAFNQVLANLAEQVA
FT                   RDGEGARKLVEITVEGAKTKASARKIAMSIANSPLVKTAIAGEDANWGRVVMAVGKAGE
FT                   PADRDKLSISFNGIRVARSGARDPDYDEAQVSEAMKAPEIAIKVSLGLGKGRDRVMTCD
FT                   LTKEYVAINGDYRS"
FT   CDS_pept        204370..204780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0207"
FT                   /product="NTP pyrophosphohydrolase"
FT                   /note="MutT family"
FT                   /note="ORF_ID:blr0207"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45472"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45472"
FT                   /db_xref="GOA:Q89XU9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XU9"
FT                   /protein_id="BAC45472.1"
FT                   /translation="MTPLKLTLVVACALVDADKRVLIAQRPEGKALAGLWEFPGGKLEP
FT                   GERPEQSLIRELHEELGITVAEPCLAPLTFASYGYETFHLLMPLYICRRWEGMVAAREG
FT                   QTLAWVRANKLRDYPMPPADIPLIPHLIDLLM"
FT   CDS_pept        complement(205000..205908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0208"
FT                   /product="methyltransferase"
FT                   /note="ORF_ID:bll0208"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45473"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45473"
FT                   /db_xref="GOA:Q89XU8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XU8"
FT                   /protein_id="BAC45473.1"
FT                   /translation="MPHCVRDTVARTTWIGVTSGMAQNVQTPPALFDRALLHARQRRAH
FT                   AQGAVSFLLDRVTEDMSDRLAAVMREFHAPADLWTPGEGLAVLRARLPSLQRIALGETG
FT                   EEKLPFTPESLDLVVSALALQFVNDLPGVLAQVRRALKPDGLLLAAMIGGDSLTELRQA
FT                   FAAAEAECEGGVSPRVAPFADLRDIGALLQRAGFALPVTDVDRVVVRYANAFALMQDIR
FT                   RMGAANVLIERRRTPSRRATLLRMAEIYAERFADSDGRIRATFDIIWLSGWAPHASQQQ
FT                   PLKPGSAKASLAEAVKKAGES"
FT   CDS_pept        205988..206785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comF"
FT                   /product="competence protein F"
FT                   /note="ORF_ID:blr0209"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45474"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45474"
FT                   /db_xref="GOA:Q89XU7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XU7"
FT                   /protein_id="BAC45474.1"
FT                   /translation="MEADAAPSRSIATPLRAAWTAGRHALARAARLALDIALPTLCVSC
FT                   REPVDGEGVCAACWARLSFIERPYCPRLGIPFVYDPGPDMLSMEAIASPPAYQRARAAV
FT                   RYDDVARTLVHALKYQDRTDLAPAMGRWMARAGGELLAGADMLIPVPLHWRRAWRRRYN
FT                   QSGALARSIERQSGVKVRGELLRRVRATEQQIGLSRAQRATNVQGAFQVSPDRQAEVQG
FT                   RRIVLIDDVLTSGATLDACARALLRAKAAQVDVLVFARVVEVR"
FT   CDS_pept        206833..207108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0210"
FT                   /product="glutaredoxin"
FT                   /note="ORF_ID:bsr0210"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45475"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45475"
FT                   /db_xref="GOA:Q89XU6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XU6"
FT                   /protein_id="BAC45475.1"
FT                   /translation="MPAAVEIYTRPGCGYCSAAKSLLTRKKATFTEFDVARNPSWRDEM
FT                   YDRAGEGSTFPQIWIGGSHVGGCDDLYALDREGKLDGMLESVKAES"
FT   CDS_pept        207105..207983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0211"
FT                   /product="amidohydrolase"
FT                   /note="ORF_ID:blr0211"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45476"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45476"
FT                   /db_xref="GOA:Q89XU5"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XU5"
FT                   /protein_id="BAC45476.1"
FT                   /translation="MSDNRTFTAAMVQMRTGLMPEPSLAQATRLIRQAAANGADYVQTP
FT                   EVSNMMQLNRKALFEHLQSEENDASLKAYRALAAELKIHIHVGSLALRFSDEKAVNRSF
FT                   LIGPEGNVLASYDKIHMFDIELPDGESYRESANYQPGETAVISDLPWGRVGLTICYDVR
FT                   FPALYRALAESGAYFITVPSAFTRKTGEAHWHVLLRARAIETGCFVFAAAQAGLHENKR
FT                   ETYGHSLIIDPWGEILAEGDVEPGIIMATIDPAKVETARRAIPSLQHGRRFGVADPKAG
FT                   PDHLHLVRGSA"
FT   CDS_pept        207980..208462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0212"
FT                   /note="ORF_ID:blr0212"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45477"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45477"
FT                   /db_xref="InterPro:IPR009562"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XU4"
FT                   /protein_id="BAC45477.1"
FT                   /translation="MIRYALHCDRNHAFESWFQSSSAYDSQVKRKLVTCPICGSAKVEK
FT                   AIMAPRIVGKKGRGPATPPPEPASTPVPEAAPSGPTPLLMAQERELRAKIKELRDHIVK
FT                   NADNVGERFANEARAMHYGDKEHRPIYGEASPDEAKSLIDEGIEVSPLPTLPEDRN"
FT   CDS_pept        complement(208602..209501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0213"
FT                   /note="ORF_ID:bll0213"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45478"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45478"
FT                   /db_xref="GOA:Q89XU3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XU3"
FT                   /protein_id="BAC45478.1"
FT                   /translation="MLTITSLWIPFTIIAALGQVARNAMQRSLTKPLGTWGATNIRFLF
FT                   GFPFSLLFLGVVLVATGDHLGMPPSVFWPWLLLGALSQIVGTGLMLLAMNDRSFVVTTA
FT                   YLKTEAIQTAIFGFVFLGDHLTLLKVLAIVVATIGVVITALRPGGEKSFAELKPTILGL
FT                   VAAAAFALSAVGFRGAIITVPNVSFVTAASFTLVLGLFVQTLILTIYLLWRAPKILQAI
FT                   LGLWKPSLFAGFMGAFSSQFWFLAFALTAAANVRTLALIEVLFAQGVAYYSFKQPIAPR
FT                   EIFGIALIVVGVAVLVGA"
FT   CDS_pept        complement(209780..210541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /note="ORF_ID:bll0214"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45479"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45479"
FT                   /db_xref="GOA:Q89XU2"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XU2"
FT                   /protein_id="BAC45479.1"
FT                   /translation="MQQNTSATAQPGSTVDAAEIAKFSKLSAEWWDPKGKMAPLHRINP
FT                   LRLGYIRDAACRKFERNVRSLNCLGGLRVLDIGCGAGLLCEPLSRLGAQVIGVDPSQSN
FT                   IAAAKLHADKSHLAIDYRCTTVEEIDPRERFDIVLAMEVVEHVVDVGVFLKRCAAMLKP
FT                   NGLMVVSTLNRNWKSFALAIVGAEYVLRWLPRGTHEWNKFVTPDELTKYLLDNRLVITE
FT                   QTGVVYSPFADKWTLSSDMDVNYMVVAEGMV"
FT   CDS_pept        complement(210562..211029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0215"
FT                   /note="ORF_ID:bll0215"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45480"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45480"
FT                   /db_xref="GOA:Q89XU1"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XU1"
FT                   /protein_id="BAC45480.1"
FT                   /translation="MARYIDEILQPGERVLYSTNAHWIFYFPAIVAWIVALALFALSRQ
FT                   SDIYSVMILSLFGSGLVALAALYWTVKGWFHRFTTETDVTNLRVVHKTGFIKRRTFEMA
FT                   LDKVESVDVDQTILGRILNYGDVTIRGVGEGIETIRTIASPLAFRSSITTR"
FT   CDS_pept        211205..212461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /product="aspartokinase"
FT                   /note="ORF_ID:blr0216"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45481"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45481"
FT                   /db_xref="GOA:H7C6R8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:H7C6R8"
FT                   /protein_id="BAC45481.1"
FT                   /translation="MSRLVMKFGGTSVANIERIRNVARHVKREVDAGHEVAVVVSAMSG
FT                   KTNELVAWCTEASPMHDAREYDAVVASGEQVTSGLLAIVLQSMGIQARSWQGWQIPIKT
FT                   SDAHASARIEDIDGSEIIKRFRDRKEVAVIAGFQGINPETNRITTLGRGGSDTSAVAVA
FT                   AAVKADRCDIYTDVDGVYTTDPRIVPKAKRLGKIAFEDMLELASQGAKVLQVRSVELGM
FT                   VHNMPIFVRSSFDKPEDIDPHANQPPGTLICSEEEIMESHVVTGIAFSKDEAQISVRQI
FT                   EDKPGVAASIFGPLADANINVDMIVQGVSEDGKTTDLTFTVPAADFTRARDTITAAKGK
FT                   IGYARLDTATDVAKISVIGSGMRSHAGVAAQAFSALAGRNINIRAITTSEIKFSVLIDT
FT                   AYTELAVRTLHTLYGLDQA"
FT   CDS_pept        212750..215017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsP"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="ORF_ID:blr0217"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45482"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45482"
FT                   /db_xref="GOA:Q89XU0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XU0"
FT                   /protein_id="BAC45482.1"
FT                   /translation="MRSASGGPRVLLRRLRETMAEQVSAQERLDKIVVLIAANMVAEVC
FT                   SVYVLRIDNTLELYATEGLNREAVHHTVLSAHEGLVGLVASEATPLNLNDAQSHPAFSF
FT                   RPETGEEIYHSFLGVPILRAGNTLGVLVVQNRAKRTYVEEELEALQTTAMVLAELIASG
FT                   ELSALAQPGLEPAARHSMQKVGAILSEGIALGHVVLHEPRVVIKDYIAEDLPKEIKRLD
FT                   TALAKLRADLDRMLERGDVAEGGEHREVLEAYRMFANDQGWSHKLHEAVATGLTAEAAV
FT                   ERVQSDTRARMLRSTDPYLRDRLHDLEDLGYRLMRQLVGQDHAPSREQLPDNAIVIARA
FT                   MGPAALLDYDRKRLRGIVLEEGTANSHVSIVARALGIPAVGEVPNAPGIADPGDAIIVD
FT                   GTSGSIYVRPSQEIEAAFAERVRFRARRQAQYLALRDRPCVTKDGQKVELMINAGLAID
FT                   LPHIEDTGSAGIGLFRTELQFMVGQSLPRTSDQLALYRTVLDAAGTKPVTFRTLDIGGD
FT                   KALPYMEAVIEENPALGWRAIRLGLDRPGLLRGQIRALLRAGGGRALRIMFPMISEVAE
FT                   FDAAKALVERELTYLRQHGHTLPERIDIGTMVEVPALLYQLDELLKKVDFISVGSNDLF
FT                   QFLFAVDRGNAKVSERFDTMSAPILRALRDIARKSHAAQKSLSLCGEMASKPIGALALI
FT                   AMGYRSLSLSATALGPVKAMVIDLDAKKAEAMLGPLLDAPSGSVSIRQKLTEFAEAEGL
FT                   AL"
FT   CDS_pept        215076..216161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /product="peptide chain release factor 1"
FT                   /note="ORF_ID:blr0218"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45483"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45483"
FT                   /db_xref="GOA:Q89XT9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XT9"
FT                   /protein_id="BAC45483.1"
FT                   /translation="MSSLPEAKLDVLLAHHASLEAESLGQLASERYVQITRELAEITPL
FT                   IEAVKTYRSAVKELADTEALIADPATDAEMRGMAEAERDELAPRIEDLVQKIRVALLPK
FT                   DAMDDRNVVLEIRAGTGGDEASLFAGDLFRMYERFASLQGWKVEVISASEGTVGGYKEI
FT                   IAEVQGRGAFSKLKFESGVHRVQRVPDTETQGRIHTSAATVAVLPEVEDVDVDIKNDDL
FT                   RIETMRAQGAGGQHVNKTESAIRITHIPTGIVVMMQDSRSQHKNRASAMNILRSRIYDA
FT                   ERQRVDAARSAERKEKVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLPQVIAGEALGE
FT                   LIDALTTEHQAAQLAAQGAAA"
FT   CDS_pept        216158..217051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /product="protoporphyrinogen oxidase"
FT                   /note="ORF_ID:blr0219"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45484"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45484"
FT                   /db_xref="GOA:Q89XT8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XT8"
FT                   /protein_id="BAC45484.1"
FT                   /translation="MTPRVSDPFTGQSIESARRTLAARLRSAQLEEAELDARILLGAAL
FT                   GLDLTGLIAQAARLLTEAEASRIAQHAQRRIAGEPVARILGTREFWGLPFRLSDATLVP
FT                   RPDTETVVERALELFREQKATQQPRIADIGTGSGAILLALLHDIPGAFGVGTDLSLNAL
FT                   ETARGNAVTLGLADRSAFVACSYLAALRGPFDLIVSNPPYIPSAEIPKLSLEVREHDPH
FT                   LALDGGNDGYDAYRALIPQAAERLAPGGALIVEAGQGQARNIETLLTAAALVVDRPPKA
FT                   DLAGIPRAVSARKMPP"
FT   CDS_pept        217515..218303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0220"
FT                   /note="ORF_ID:blr0220"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45485"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45485"
FT                   /db_xref="InterPro:IPR025430"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XT7"
FT                   /protein_id="BAC45485.1"
FT                   /translation="MRNGQNKQRMRNRNNNNNNNRRGQNPMTRVYESNGPDIKIRGTAS
FT                   HIAEKYLQLARDARSSGDPVAAENYYQHAEHYFRLIAAAQEQFRQNQQPRGDEPISSNS
FT                   DDGEDDGENFSNFGQEPGFVPQPQQQQPFMRDRDGQRDHHQRDHQQRDNQPSYQRDNQQ
FT                   PREHRERDHRPQPQQYQPQPMPPNQPQPVIADAGSVDRLPSFITGAQPQVNVGANGGQA
FT                   GFEGGGGGERFPRRRRRPHGPRPEREAAPAASSDDLAPGE"
FT   CDS_pept        complement(218361..219101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0221"
FT                   /note="ORF_ID:bll0221"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45486"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45486"
FT                   /db_xref="GOA:Q89XT6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XT6"
FT                   /protein_id="BAC45486.1"
FT                   /translation="MSIDVVDLREFYSRRLGIVARQMINRGIRERWPRAEGQRVLGIGY
FT                   PTPYLGLFREDAERCLAFMPAAQGVLKWPTGRPALASLVDEFSLPLPDSAVDRILLVHA
FT                   LEMSDDPAALLREVWRVLSPSGRVIAVIPNRRGVWTRSDNTPFGHGRPYSRSQITDLLR
FT                   QTWFTPTAWGEALFMPPYAGGWVLKSAQMWERAGAALSLPFAGVHIVEATKQVYRAIPA
FT                   KRERARLIPSLKPVLVPSSTVTRS"
FT   CDS_pept        219210..219977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /product="glyoxalase II"
FT                   /note="ORF_ID:blr0222"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45487"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45487"
FT                   /db_xref="GOA:Q89XT5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XT5"
FT                   /protein_id="BAC45487.1"
FT                   /translation="MAAEIRTFSCLNDNFGYLIHDVETKATASIDAPEAGPILKALERE
FT                   GWQLTDILITHHHGDHVGGVAELKHKYNCRVVAPHDKTTAIANVDLRVANADVVKVGNL
FT                   LARVVETPGHTLDHISYVFDTEKTVFAADTLFSIGCGRVFEGTYPMMWDSLLKLRALPD
FT                   DFKLYCGHEYTASNVKFALTVDPDNAALQARAAEVAKLRAENKPTIPSLLGDEKRANVF
FT                   LRADDPSVAARLHMKGADAAAVFGELRERKNKS"
FT   CDS_pept        220001..220423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0223"
FT                   /note="ORF_ID:blr0223"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45488"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45488"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XT4"
FT                   /protein_id="BAC45488.1"
FT                   /translation="MPTAAEIIARLELRPHPEGGHYRETFRDQTTDANGRSRSTLIYFL
FT                   LARGERSHWHRIDAVEIWHYYAGSPLMLRIAHEGCSQHEVRLGTDLVSGERPQAIVPAD
FT                   AWQMAETTGEWTLVGCTVAPAFEFAKFELAPKGWEP"
FT   CDS_pept        complement(220539..221408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0224"
FT                   /note="ORF_ID:bll0224"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45489"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45489"
FT                   /db_xref="GOA:Q89XT3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XT3"
FT                   /protein_id="BAC45489.1"
FT                   /translation="MTPRTATLIGLTAILMWSLLSVMTVATGKIPAFQLAAMTFAIGGL
FT                   VGLLTWIGRGEAAKSLRQPLAVWTVGVGGLFGYHALYFLALRFAPPAEAGLLNYLWPLL
FT                   IVLFSSFLPGERLAVHHIVGAVLGLVGTVLLFAGNTSGFAPGAVPGLIAAFIAAFVWAT
FT                   YSVLSRRLKAVPTDAVAGFCLATALLAALMHGALETTVWPETALQWISVIGLGIGPVGA
FT                   AFYAWDIGMKRGDIRVLGAASYATPLLSTGFLIAAGFAKASANIAIAAVLIAGGGLIAA
FT                   KDMVLRKR"
FT   CDS_pept        complement(221577..222302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbB"
FT                   /product="acetoacetyl CoA reductase"
FT                   /note="ORF_ID:bll0225"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45490"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45490"
FT                   /db_xref="GOA:Q89XT2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XT2"
FT                   /protein_id="BAC45490.1"
FT                   /translation="MARVALVTGGTRGIGAAIGKALKAAGYKVAASYAGNDAAAEKFKA
FT                   ETGIAVYKWDVSNFDACAEGVKKVEAEVGPIDVLVNNAGITKDGAFHKMSLEQWNAVIG
FT                   TNLGSLFNMSRQVIEGMRGRKFGRIINISSINGQKGQFGQVNYSAAKAGEIGFTKALAL
FT                   ENAKGGVTVNAICPGYINTEMVQAVPKDVLEKSILPLIPIGRLGEPEEIARAVVFLAAD
FT                   EAGAITGSTLTVNGGQYMV"
FT   CDS_pept        complement(222553..223737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoB"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="ORF_ID:bll0226"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45491"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45491"
FT                   /db_xref="GOA:Q89XT1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XT1"
FT                   /protein_id="BAC45491.1"
FT                   /translation="MPMSDDVVIVSAARTPVGSFNGAFATLPAHDLGAVAIKAALERGG
FT                   IEPGRVSEVIMGQILTAAQGQNPARQASIAAGIPVESPAWGVNQLCGSGLRTVALGYQA
FT                   LLNGDSEIVVAGGQESMSMAPHAQYLRGGVKMGALEFIDTMIKDGLWDAFNGYHMGNTA
FT                   ENVARQWQITRAQQDEFAVASQQKAEAAQKAGKFNDEIVPVTIKTRKGDVVVSADEYPR
FT                   HGATLDAMAKLRPAFEKDGTVTAGSASGINDGAAAVVLMTAKQAAKEGKKPLARIVSWA
FT                   QAGVDPKIMGSGPIPASRAALKKAGWNVGDLDLIEANEAFAAQACAVNKDLGWDTSKVN
FT                   VNGGAIAIGHPVGASGARVLVTLLHEMQKRDSKKGLATLCIGGGMGIAMCLARD"
FT   CDS_pept        224037..224630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0227"
FT                   /note="ORF_ID:blr0227"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45492"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45492"
FT                   /db_xref="GOA:Q89XT0"
FT                   /db_xref="InterPro:IPR007897"
FT                   /db_xref="InterPro:IPR010134"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XT0"
FT                   /protein_id="BAC45492.1"
FT                   /translation="MAKSDQPTTIKKYANRRLYNTGTSTYVTLEDLAAMVKDGEDFLVY
FT                   DAKTGDDITRSVLAQIIFEQENKAGQNLLPTTFLRQLIRFYGDSMQMVVPKYLEQSIAT
FT                   LTQEQEKFRKQIANTLSGTPFAPLEEQVRRNMELFQQTFSMFKPFAPPARSSTTPEPEP
FT                   DATAEAPKDSNIDDLRQQMKEMQERLERMSKKEE"
FT   CDS_pept        224704..225468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0228"
FT                   /note="ORF_ID:blr0228"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45493"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45493"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XS9"
FT                   /protein_id="BAC45493.1"
FT                   /translation="MSSWRKPGPIPRDLSVEIDSSTERRIIAKLLPGVMGPGFRQDDAG
FT                   EAAMSDPSAHWNNVYATKGETEVSWFQESPAISLDMIRSANVDRGAGIIDIGGGASRLV
FT                   DALLQDGYRNLAVLDLSANALDAAKRRIGPAAASVDWIVADATTWRPARSYEVWHDRAA
FT                   FHFLTDPRDRAAYVERLRSAVAAGGHVIIATFALDGPEKCSGLPVQRHDSKSLSTELGP
FT                   DFELIETRSETHHTPWKSTQAFQFSRFRRRGS"
FT   CDS_pept        complement(225531..226586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /product="branched-chain-amino-acid transaminase"
FT                   /note="ORF_ID:bll0229"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45494"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45494"
FT                   /db_xref="GOA:Q89XS8"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XS8"
FT                   /protein_id="BAC45494.1"
FT                   /translation="MDGIISGLLPNVISPRCSPSVQGALQGRGAFPAGNHLEIAPNSRA
FT                   ILRHHAKGRPVMAEIKKAIEYSPSWTFFEGKWHDGNVPIMGPRTHAAWLGSVVFDGARA
FT                   FEGVAPDLDRHIARANQSAINFGLKPVVDPGTWLTLANEGIARFATNAELYIRPMYWAE
FT                   NGSGGGVLFDPETTNWCLCIYEAPMPKPVGNAITLSPFRRPTAECAPVEAKAACLYPNN
FT                   SRALAEAASRGFQNALMLDMLGNVAEFGNSNVFMARDGVVFTPVPNGTFLNGITRQRVI
FT                   GLLRADGVTVVEKTLRYADFLAADEIFSTGNFAKVAPVIRIDERELKPGPLYTKARKLY
FT                   WDFAHAVKLAA"
FT   CDS_pept        226602..227537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0230"
FT                   /note="ORF_ID:blr0230"
FT                   /note="probable esterase (EC 3.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45495"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45495"
FT                   /db_xref="GOA:Q89XS7"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XS7"
FT                   /protein_id="BAC45495.1"
FT                   /translation="MPLDPLAKRLLTMMAAAGPQVRNRPSVEARRQSLAKLMQFARTDA
FT                   PDVTVSDGTLPGPGGELPYRLYSPATAAERAPGFVFFHGGGLVAGSVATHDRIAAALAH
FT                   ATGCRLVSVDYRLAPEHKFPAAVDDAIAATEWVAREASSLGIDAGRLVVGGDSAGATLA
FT                   AIVCQEALQNAGLSIVAQCLICPVLDFEETSPSREAFAEGHLIDRITIEADLADYLPGG
FT                   IDAADPRISPLRATRFAGLPTAIIHTAEFDPMRDEGNAYARKLLAAGVTVEHVCHDGMV
FT                   HNFHAMGAILPQAQLVLSQIGEQVRRAVEK"
FT   CDS_pept        complement(227547..227795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0231"
FT                   /note="ORF_ID:bsl0231"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45496"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45496"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XS6"
FT                   /protein_id="BAC45496.1"
FT                   /translation="MNTSRRILLTGLAGLAVAPTAVAAAVPPAEPGDVTVAEERFARTI
FT                   AAAHAPDVTCTRQAERYADAHWPEYVAAARAVLDARV"
FT   CDS_pept        227767..228267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0232"
FT                   /note="ORF_ID:blr0232"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45497"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45497"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XS5"
FT                   /protein_id="BAC45497.1"
FT                   /translation="MSRMRRDVFMTVVPPLSGLHSGRRVCQRDHRRVPAHIRAVHRLRT
FT                   ALDHRCDHVPSNNSSVIKSPRVGSSRAPSQPIAKPTVPNIYLDLRTTCATIPAGTLGLG
FT                   FGNTSLSAAFEALAVRQGATLPSGLPAAKNDNRLFGITAQIAWMPKPSYQLTLRTPLYT
FT                   VRN"
FT   CDS_pept        complement(228334..228936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0233"
FT                   /note="ORF_ID:bll0233"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45498"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45498"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XS4"
FT                   /protein_id="BAC45498.1"
FT                   /translation="MRATVSASQRGDPAVRLPILDPKDLTDEQKPLYDDMRAGIKDHFK
FT                   GFVNMRDDGALLGPWNPWVREPRFGKPVWELVKAIASNPLLPASVREVAILVTGSHFRS
FT                   GYELYAHVLVAEQRGLSDEKLATIVAGQRPVDLTKQEAVAYDVASALVSGGVLPELTWR
FT                   AAVKEFGEHGAAELSYLVGVYCMVSVTLNTFDVPVPE"
FT   CDS_pept        complement(229004..229591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0234"
FT                   /note="ORF_ID:bll0234"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45499"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45499"
FT                   /db_xref="GOA:Q89XS3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XS3"
FT                   /protein_id="BAC45499.1"
FT                   /translation="MSEVVHNFTATIPTWSPYVTPVELASATSEQLAAMKVTPSNKGVS
FT                   PYVLTLAHDPESLAVRSPLFNLIMYGKDGLSPAERELGALSASVVNRCIYCAAVHASRF
FT                   ISYSGRNDIVEEIFADERDATLEARQQALFNFATKLSTTPIEATADDARALGEAGLSEL
FT                   EQLDLVLSAAIFGWANRLMHTLGEPLARPEAP"
FT   CDS_pept        complement(229588..230049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0235"
FT                   /note="ORF_ID:bll0235"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45500"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45500"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XS2"
FT                   /protein_id="BAC45500.1"
FT                   /translation="MRAASRLGQALNARAEILHLSEAAHDAVLLPREPGGLSHGLRAAL
FT                   AARMCRHVGDEALTAHYDSYLAHASDLDLAALARPGGLCGDSLHDAMARHADLLTLSPR
FT                   EATRQDIAALKTAGVSEADIVRLSELAAFVNYQLRVLAGLRLLKEVEAR"
FT   CDS_pept        complement(230076..231239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0236"
FT                   /product="cysteine synthase/cystathionine beta-synthase
FT                   family protein"
FT                   /note="ORF_ID:bll0236"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45501"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45501"
FT                   /db_xref="GOA:Q89XS1"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XS1"
FT                   /protein_id="BAC45501.1"
FT                   /translation="MPMEPTPFRHHNPAGPVYRRGWVDEAVAAIEADQCRTADTHLIRL
FT                   IVPALSGIDIYLKDESTHPTGSLKHRLARSLFLYALCNGHIREGTPVVEASSGSTAVSE
FT                   AYFAQMIGVPFYAVMPRTTSAEKIAAIEHYGGNCHLIDDGRALYAEAAALATRLNGHYM
FT                   DQFTFAERATDWRGNNNIAESIFTQLQGEPRPLPDWIAMGAGTGGTSATIGRYLRYRQY
FT                   PTRLCVADVEHSAFFDCFRTQDRSHVCERPSLIEGVGRPRCEPSFVPGVVDRMMKIPDV
FT                   ATIAAMNVLSRRLRRSVGGSTGTNFLALCRIASEMRSAGQAGSLVTLICDSGERYRQTY
FT                   YDPAWLKARGLDPAPFEIALSSFLDTAQPLALAVEDVVNPQSPRSVA"
FT   CDS_pept        231320..232300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0237"
FT                   /product="transcriptional regulatory protein"
FT                   /note="LysR family"
FT                   /note="ORF_ID:blr0237"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45502"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45502"
FT                   /db_xref="GOA:Q89XS0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XS0"
FT                   /protein_id="BAC45502.1"
FT                   /translation="MNQDVIDIRLLEAFAAVMSAGSITGAARLLGRSQPVVTRQIQDLE
FT                   ADVGYLLFTRNGPRISPTPKGVLFHAEVERLLMGLKHIRQRANAIGAGALPVLSLAAIP
FT                   ALAAGFVPAALAALERKLLPSQVHVQALSAENVVQSVLSQSVDFGLASLPIQHPGLDMQ
FT                   WVCEVPCVACLAMDHPLAKKKVIRLRDLAGVRLLTMANPYRLRRRVEEALEREGVVPAE
FT                   VIDTNASLTAIAMAKQSLGIAVVEPVLTSSLPVEGVVTRPLDVSIPFLFAAIAPTGREL
FT                   TPTVAALNDALRAAVALMPGAKLHSGAAALAEAGDETSEFEKAPS"
FT   CDS_pept        232297..233757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0238"
FT                   /product="oxidoreductase"
FT                   /note="ORF_ID:blr0238"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45503"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XR9"
FT                   /protein_id="BAC45503.1"
FT                   /translation="MTTMTPDAAGLAALEARLKQDLAWLELPAKSWVPRRVVDGKSVVD
FT                   VVIVGAGMAGLVASAMLRRLGVDNQLVLDRARAGEEGPWVTFARMRTLRSPKELTGPAM
FT                   GMPALTFRAFYEAQYGRQAWQALDRAPRTMWMDYLIWYRKVLDLPVRNGVSVERIHART
FT                   DELFALDISEGGTSRQILARHVVLATGRDGLGGAYVPSLCDGIDRRFWAHSSAPIDFER
FT                   LRGRRVAVVGAGASAMDNAAMALEAGAARLDLFIRRADIPRVNKFTGIGSQGVVHGFAG
FT                   LSDDWKWRFLDHTLKAQTPPPRQSVLRVSAYPQAHFHLASPIDDLAVAGDHLTVTTPKG
FT                   RYATDFIIFGTGFKVDLALRDELAEFAPHIRFWCDRFPAPDGMDNAELENSPDLGDSFQ
FT                   FLEKEPGACPMLARLHCFNYPATLSHGKLSGDIPAISEGADRLARGIVRRLFVEDREIH
FT                   FANLKAFATPELAGDEWQDADVTHQPAE"
FT   CDS_pept        233726..235087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0239"
FT                   /note="ORF_ID:blr0239"
FT                   /note="probable citrate-proton symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45504"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45504"
FT                   /db_xref="GOA:Q89XR8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XR8"
FT                   /protein_id="BAC45504.1"
FT                   /translation="MPTSPINPPNRRNRTGKREMQTNRKAIAAAIAGNALEWYDFTVFA
FT                   LMTPVIKNLFFPVDPKISGSEINALLLTTALFGTGFFMRPIGGLVLGYFGDRKGRKAAM
FT                   TLGMGIMAVSVALLALTPTYATAGIAAPLIVLLARLLQGFSVGGEFGTSTAYLIEAAPP
FT                   GRTGFYGSWQIAGQLMANVLGAVLGAALTLAFTQEQLAAGAWRIPFFVGLVIVPILLYM
FT                   RASVIEPEASRRSMATLHKDNFIAALKNPGRNFLIGMGMVVASAVSFYVTFGYTVTYAK
FT                   EVLKLPLMQSFLVQMIAAIVMVIVVPIAGAVSDRYPRRPLLLVSLIGYFVSLYPLYAWV
FT                   ISEPSIARLLVAQIVIGFFSAFFLGVYCTTLVELFPIRVRSTALAIVNNVAVLVFGGFA
FT                   QFFVTWLIALTGSPLAPIFYVMIGVGLGLIAVIAMRPEDAEREQVPDGVVEQAS"
FT   CDS_pept        complement(235094..235558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0240"
FT                   /product="transcriptional regulatory protein"
FT                   /note="AsnC family"
FT                   /note="ORF_ID:bll0240"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45505"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45505"
FT                   /db_xref="GOA:Q89XR7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XR7"
FT                   /protein_id="BAC45505.1"
FT                   /translation="MPLRLDRTDLKILRLLQNNGRLSNAELAETVAISPATCHRRTQRL
FT                   FEDGFIAAVRAMIAPKKVAKGTLVMVGVVLDRSTPESFAIFEQAIAKLKFVLDCHLVAG
FT                   DFDYFLKIRVGDMEDFNRIHGEQLIALPGVRQTRTFFVMKEVVDNAPLEF"
FT   CDS_pept        235722..236735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0241"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /EC_number="3.5.99.7"
FT                   /note="ORF_ID:blr0241"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45506"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45506"
FT                   /db_xref="GOA:Q89XR6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005965"
FT                   /db_xref="InterPro:IPR020601"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XR6"
FT                   /protein_id="BAC45506.1"
FT                   /translation="MLEKFARYPLTFGPTPIEKLERLSKHLGGNVEIYAKREDCNSGLA
FT                   YGGNKLRKLEYIIPDAIASNADTLVSIGGVQSNHTRMIAAVAAKIGMKCRLVQEAWVPH
FT                   EDAVYDRVGNIMLSRIMGADVRLVDDGFDIGIRKSWEQAIEEVKAAGGKPYAIPAGASV
FT                   HKYGGLGYVGFAEEVRKQEAELGFKFDYIVVCTVTGSTHAGMLVGFAADGRARKVIGID
FT                   GSFTPAQTKAQVLSIAQNTAKLVELGKDIVADDVVLIEDYAYPAYGVPSEETKEAIRLT
FT                   ARLEAMITDPVYEGKSMQGLIDLTQKGYFEKGAKVLYAHLGGAPALNGYGYAFRNG"
FT   CDS_pept        complement(236940..238952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="ORF_ID:bll0242"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45507"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45507"
FT                   /db_xref="GOA:Q89XR5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XR5"
FT                   /protein_id="BAC45507.1"
FT                   /translation="MERGPSPQLSPRKNGEREKKQRRKRQIVLPRPRSHATGLVTNPTA
FT                   SDTPMNVPSTAPLPAPANGRDALSVLHSVFGLPGFRGAQGEIIRHVTDGGNCLVLMPTG
FT                   GGKSLCYQLPSLLREGCGIVVSPLIALMRDQVAGLLEAGVNAAALNSSLTPQEASDIER
FT                   RLIAGDLDLLYVAPERLVTPRCLLMLAQAKVALFAIDEAHCVSQWGHDFRPEYVGLSII
FT                   AERFPEVPRIALTATADELTRKEIVERLKLGGSPQFVSSFDRPNIRYEIVDKRNAVSQL
FT                   KEFIRERHAGDAGVVYCLSRNRVEEVAAALDDAGIAALPYHAGLDSSVRSRNQDRFLNE
FT                   DGIVIVATIAFGMGIDKPDVRFVAHLDLPKSIEAYYQETGRAGRDGKPSAAWMAYGLSD
FT                   IVQQRRMIDESSGSDDFKRVSIGKLDALVGLAETAQCRRRRLLAYFGEIVHGETCGNCD
FT                   NCLTPPKMRDGKVLAQKLLSCVYRTGQRFGAMHLIDVLIGRLTEKVTQFGHDKLSVFGI
FT                   GRELNEKQWRTVLRQLVAMGHLQSDSEAYGALKLTEAARGVLRGETEVWLREEVPGTRV
FT                   RSSRAKSRRGDLAPAASAPQGDVDPELRARLRSWRSDVARERGVPAYVVLHDATIDGIV
FT                   RAWPTTLDELRNVPGIGDKKLEHYGDELLQIVRTR"
FT   CDS_pept        complement(239041..239907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0243"
FT                   /note="ORF_ID:bll0243"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45508"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45508"
FT                   /db_xref="GOA:Q89XR4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XR4"
FT                   /protein_id="BAC45508.1"
FT                   /translation="MRRSLRARSGRFTLGLTKCEACFRQRTNASLKGAGQTGNAVVWSA
FT                   LQGRVSNRLARHFRAAPHRLPAHAPMVSFTFDDAPDSAAGEGASLLEAHGGRGTYYIAG
FT                   SLIGRPSDHWHGLSNDAIVRLHHAGHEIACHTFSHQSAVNLGEAAMTREIERNRSHLRE
FT                   IDSSIALENFAYPYGLASVWRKPQLARTFRSARGILPGVNRDVIDLQFLRASPLVDCEI
FT                   DRAGVDRYFDEAVASGGWLIFYGHDVVNAPSPYGCTPHLMRHALEAAGKRDMPIVTVAE
FT                   ALRRIGA"
FT   CDS_pept        complement(239885..240886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0244"
FT                   /note="ORF_ID:bll0244"
FT                   /note="probable homoserine O-succinyltransferase (EC
FT                   2.3.1.46)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45509"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45509"
FT                   /db_xref="GOA:Q89XR3"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XR3"
FT                   /protein_id="BAC45509.1"
FT                   /translation="MTILIDRDHGMSSPALVPAEGDLARDHAGAELTIGLINNMPDPAL
FT                   KATERQFMKLLQAAAGPRRIRFHCFSLPSVKRSPEAKWHVESEYSDLADLKRQRFDGLI
FT                   VTGAEPVAPELDQEPYWRDLTDLVDWARTNTRSTIWSCLAAHAAVLHLDGIARRRLPAK
FT                   CHGIFDCEAVTGDPLTHALPAPLKVSHSRLNEIVESDLEQAGYQVLTRSALAGVDVFVR
FT                   QYASRFVFFQGHPEYDALSLQREYLRDVGRYLVRERDNYPHLPVSYFDAATEEKLVRFE
FT                   KQARHQRHPALSNELPALNLRADIAAGSAAAALFRNWLQYLGADADASVLAR"
FT   CDS_pept        complement(240899..242200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /product="O-acetylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.49"
FT                   /note="ORF_ID:bll0245"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45510"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45510"
FT                   /db_xref="GOA:Q89XR2"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XR2"
FT                   /protein_id="BAC45510.1"
FT                   /translation="MRNETIAIHAGYEPEATTHAVAVPIYQTAAYAFDSADHGAALFNL
FT                   EAEGFRYSRIANPTSAVLEKRISQLEGGVGALAVATGQAALHFAFVNVADHGGNIVSVP
FT                   QLYGTTHTLLSHILPRQGITGRFAESDKPDAIEKLIDENTRAVFAETIGNPAGNVCDIE
FT                   ALAKIAHAHGVPLIVDNTVATPILLKPFDYGADIAVHSLTKFLGGHGTTLGGAIVDSGN
FT                   FPWAKYADRFPAYNKPDASYHGLVYAERFGKTAYIERARSVYQRTMGSVLSPFNAFLLL
FT                   QGIETVALRMERHVENARKVAEFLRTDPRVAWVNYTGFPDSPYYPLVQKYLDGNASSLF
FT                   TFGIKGGMEAGKTFYDALKLITRLVNIGDAKSLACHPASTTHRQMSAEQQRLAGVLPET
FT                   IRLSIGIEHAADIIEDIDQALEKACPSSRLQAAE"
FT   CDS_pept        complement(242527..244101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bam"
FT                   /product="indoleacetamide hydrolase"
FT                   /EC_number="3.5.1.-"
FT                   /note="ORF_ID:bll0246"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45511"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45511"
FT                   /db_xref="GOA:P59385"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59385"
FT                   /protein_id="BAC45511.1"
FT                   /translation="MAKKTASKKKSVSRKVTKTSSKKATARKGAVAKAAKKSVKKAAPR
FT                   KSATARRPKGPVWQWSAVDTAAAIRSGAISAVETVEAHLDRMRAVNPRLNAVVVDLSKE
FT                   ALKAAHAADKQRAKGGELGLLHGVPITIKENVDYEGRPNFNGVPANKDYIAPSDAPVVR
FT                   NLKKAGAIVIGLTNTPEFSFRGFTDNPLHGLTLNPWDPDITCGGSSGGAGSAVAAGIGT
FT                   IAHGNDIGGSLRWPAHCNGVATIKPTQGRIPAFNGSATAERPMLAHLMSAQGPLARHVA
FT                   DVRLALEVMSQRDPRDPWWVPAPLVGPKPKGPIKVALAKIPDDMDVDPAVAAALRRAAD
FT                   HLERSGYRVSEVEVPDINGVWQTWCDIITNETMVMQEAAMLKVTSEDFHNAWNGMKAKA
FT                   NVLDLKAWMQATAARNGHIRAWQLFFEDYPVVLAPTTVSPTPGPRDDTISAERVQEVFW
FT                   GGIRFISAINVLGLPGAVVPVALHEGKPIGVQLITGRYREDLALDAAAAIENRAGVLAH
FT                   RLWETMD"
FT   CDS_pept        243956..244246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0247"
FT                   /note="ORF_ID:bsr0247"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45512"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45512"
FT                   /db_xref="GOA:Q89XR1"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XR1"
FT                   /protein_id="BAC45512.1"
FT                   /translation="MADLRGAAFLTDFFAAFATAPLRAVAFLLEVFVTFLETLFFLLAV
FT                   FFATPHLLKLRRGGYGDHATVYRRVSAWRVVATLCHGPGARDAREPLRPLS"
FT   CDS_pept        244354..245172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0248"
FT                   /note="ORF_ID:blr0248"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45513"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45513"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="PDB:5GN2"
FT                   /db_xref="PDB:5GN3"
FT                   /db_xref="PDB:5GNW"
FT                   /db_xref="PDB:5GRK"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XR0"
FT                   /protein_id="BAC45513.1"
FT                   /translation="MLTEFDAGYGEQPFRDLCANYPGAEAYDPHDFRIEWGPIFHRGRL
FT                   DGSARVLIVGQDPAQHETIVRRILVGTAGRRTQGFLAKLGIVQSYVMVNTFLYSVYGQS
FT                   GGSKHKNEPGIVDYRNKWFKAVLGPGNIEAVVSLGGLADEAWKAWLKSSDGAAYKTLAY
FT                   QHITHPTWPESSAHDSATQAANTKIMLAKWNAALAALAPEVKHPDVPTTLVPYGDAFKP
FT                   SELVDIIAKDLPAGLPAWMRGDTPWAVRQGVDAAAKRRTIMITIPDGVIP"
FT   CDS_pept        245169..246779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0249"
FT                   /note="ORF_ID:blr0249"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45514"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45514"
FT                   /db_xref="GOA:Q89XQ9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XQ9"
FT                   /protein_id="BAC45514.1"
FT                   /translation="MSPAANPKRWALTGRIVTMATEGDVIKNGTIFIEDNRIAAILPKG
FT                   QPAPVGFEAVAAVTTGGTIYPGLIELHNHLSYNVLPLWRVPQLFGNRDQWQNAKSYKTS
FT                   VTGPMSAIALADDGSLLPALVRYVEAKCLVAGTTTSQGITLSNWSGTIHKYYKGALRAA
FT                   EIGSPPDLPRAHSKIPDIDAEDWAKFDNELKSSACFLLHLSEGIDPKAHSHFLALRNSA
FT                   GDWAIEPSLAGIHCTALDATDFGTMAQHQAKVVWSPLSNLLLYGKTTDVVAACAAGLTI
FT                   ALGSDWSPSGSKNLLGELKAAKVVSAHFNLGFSDYDIVAMATRNPAAILKWDSKLGTIA
FT                   KGKFADLVVVKGVTGDPYAHLIKSREQDIVLVTIGGRARYGTKKAMQQAGGSGEALKVG
FT                   RSARVIDFTSPDQDPGIEKITLAEATTRLSAALGNLGTLQPHSIAMSAAIASGTVSRTG
FT                   WRLALDEQFGNNVQLRPRLAYNGIRTGPDLAAVAAAAEPLHPIKLDGLTVADDPVFIDT
FT                   LKSEPNLPQGLGAAIAAFY"
FT   CDS_pept        complement(246787..247821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mocA"
FT                   /product="oxidoreductase"
FT                   /note="ORF_ID:bll0250"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45515"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45515"
FT                   /db_xref="GOA:Q89XQ8"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XQ8"
FT                   /protein_id="BAC45515.1"
FT                   /translation="MEYRSLGASGLKVPVLSFGTGTFGGQGPLFSAWGRSGTEEARRLV
FT                   DICLDAGVNLFDSADVYSNGASEEILGAAIKGRRDKVLISTKMSLPMGDGPLDAGSSRQ
FT                   RLLTAVDAALQRLGTDTIDLLQLHAFDAFTPIEEVLSTLDTLVRAGKLRYVGVSNFAGW
FT                   QLMKSLAIADRHGWPRYVAHQVYYSLLGRDYEWELMPLARDQGVGALVWSPLGWGRLTG
FT                   KIRRGQPLPQQSRLHATAQFGPPVDEQRLYAIVDVLDAIAAETGRTVPQVAIAWLLSRP
FT                   TVSSVIIGSRDEAQLRDNLGAVGWSLGADQIKRLDEACAVMPPYPYYPYRIQEGFARLN
FT                   PPLV"
FT   CDS_pept        complement(247832..249070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0251"
FT                   /note="ORF_ID:bll0251"
FT                   /note="putative efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45516"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45516"
FT                   /db_xref="GOA:Q89XQ7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XQ7"
FT                   /protein_id="BAC45516.1"
FT                   /translation="MLLLQRGYLRGSCHPLESRMPPAVLALTAGAFGIGTTEFIIMGLL
FT                   LQVAADMHVSVPIAGLLISGYALGVFVGAPVLTLATRRMPRKTVLLALMAIFTLGNAAC
FT                   ALAPNYELLMAARVLTSLAHGTFFGVGSVVATGLVAEDKRASAIATMFIGLTVATLLGV
FT                   PFGAWFGLMLGWRAAFWAVTVIGVIAFAVVAAFVPGHVGNGDKPISLAEELAVLGRPQV
FT                   LLGLAMTVFGFAGLFVVFTYIQPILTRFTGFSEEAVSPILLVFGAGLAIGNVAGGKLAD
FT                   RGLARALIGTLAALAIVLLGLAAVLSVKIPAIVLILLLGIAAFATVAPLQLRVLEAAGP
FT                   SGRTLASSLNIAAFNLGNALGAWAGGVTIDRGLDLSALPLVAAGITAIGLVLALWSLQL
FT                   DRTATAVAACPAE"
FT   CDS_pept        249112..250089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0252"
FT                   /product="transcriptional regulatory protein"
FT                   /note="LysR family"
FT                   /note="ORF_ID:blr0252"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45517"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45517"
FT                   /db_xref="GOA:Q89XQ6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XQ6"
FT                   /protein_id="BAC45517.1"
FT                   /translation="MARFDTNRSAEMEVFVRVVDLGGFTQAARKLRLTPSGVSKLISRL
FT                   EVRLGSRLINRTTRKLTLTEEGQAFYQRAVRILAEMEEAEREAASGAAPRGRLTVNSNI
FT                   PFGMLHVMPLIPRFLEQHPDVTLDLVLTDTLIDLMQERADVAIRVGPLRASRLVARKLG
FT                   TSRMVVVGAPNYLARFGTPKIPADLADHRGIGWTFPRSIRGWPFKRGDRTEEAVPPPAA
FT                   RASDGEAARRLALGGVGLARLALFHIGPDIESGRLVPVLQNYNPGDREDIHAVYVGHTA
FT                   PLPARVRAFIDFLAEHVRVSDPALKRAGDGKWRVMEIQRTRPIP"
FT   CDS_pept        250249..251145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0253"
FT                   /note="ORF_ID:blr0253"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45518"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45518"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XQ5"
FT                   /protein_id="BAC45518.1"
FT                   /translation="MKRAPVSAACFRNPPTRPFARTFRLNQTPRGPQMHPTDLPGQPGI
FT                   VPPGAIGHNRGVVGRNFAFMPPEGVLKSRLPAWKSTTVRFLAAPSLGAGFAQYMLEIEP
FT                   AGGTAQPICVDLQHFFYVVAGGVDVTIGSDPPVELAVGAFVYVPPGVSFTMSCHPTAPA
FT                   RIIAVKKRYEKAEDIATPTAIIGQQQSMPMTNHTGLQGRGFKHLLPMGDLRFDFEMNLM
FT                   FFQPGVCFPAVETHIMEHGLFMLEGQGLYYLGNSWHEIWVDDFIWMGSFCPQQFYPTGL
FT                   NHSVYLLYKNVNRDVVL"
FT   CDS_pept        complement(251201..251608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0254"
FT                   /note="ORF_ID:bll0254"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45519"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45519"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XQ4"
FT                   /protein_id="BAC45519.1"
FT                   /translation="MNANDITRIPNRNLPSKSAVTTYHMPGGGGLLWAVAVSPDRTQDI
FT                   RIQTLGALGVIDTYLKDAGLDRTRIVKAEIVVTDHDNKPAFDEAWASWMPAGYGPVRSF
FT                   VQSVMPDGDLIEIIITAALPAGTRDTSQASG"
FT   CDS_pept        complement(251789..252043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0255"
FT                   /note="ORF_ID:bsl0255"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45520"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45520"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XQ3"
FT                   /protein_id="BAC45520.1"
FT                   /translation="MSNPGIQALLLQLVGIHSALVHHEIMGLLEIARGLGASYRFASSE
FT                   PGAGAFYGRVTINFCRLIAAGIAHYALMEPSIEETATQS"
FT   CDS_pept        complement(252040..253005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0256"
FT                   /product="transcriptional regulatory protein"
FT                   /note="AraC family"
FT                   /note="ORF_ID:bll0256"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45521"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45521"
FT                   /db_xref="GOA:Q89XQ2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XQ2"
FT                   /protein_id="BAC45521.1"
FT                   /translation="MHPRVEWSARIAELLCSHRIRTSRQTLPMRNGTRSSTMSLQMSHP
FT                   QNAKDHVAAAIDVSSIECGRLRSSRRSRRSGEEAMTLSLVHLDVALAIEPPAPDVRGSA
FT                   DREPSFRVSAKRLACASSEVDRETGAEGFTDPVMQRLADALAATKAMHHPHSAILVDAL
FT                   RLAILTRKASRRTVAGQGQPESAEGDHEGRVCRAVRSLQKWRLKRVMQYVDDNLAAKVT
FT                   LEHLAAVAGLSRMHFAAQFRAAVGIRPHEYLLKRRIERAQELLQQADVSLVDIALTVGF
FT                   QTQAHFTTVFKRFAGDTPYQWRSAYLAQFLPLPPVGARPS"
FT   CDS_pept        253333..255243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0257"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="ORF_ID:blr0257"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45522"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45522"
FT                   /db_xref="GOA:Q89XQ1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XQ1"
FT                   /protein_id="BAC45522.1"
FT                   /translation="MTNLDRPTGSSMSRAGLRFWSAALAFAVFMVDVLTPLEGAVAVLY
FT                   VIAILLAARTNRRNDIIVAATGCVVLTITAYLLSHDLHEIASPALRALVSLAAIGITTL
FT                   LVLQNHAATTHLAAQARLLNLSHDMIFVRDRSGVITFWNKTAEQTYGWSPDEALGQLAD
FT                   KLLRTSYSDRREAIEASLLDTGRWEGRVEQRTKAGAALTVDARWALQHDHLGKPVGVLE
FT                   THTDVTDRVAAHSALVQSEQRYRRMFDASRIGVVEEDWSGLRTALDSLQTGGADLRDYL
FT                   ARNPDFVRHARRLARITDVNPALQKMAGASGSAAFIENADKLLGENDRSFLDALVAFAN
FT                   GEPFHEGETQLVSFDGRKVPVLFTITFPPEPDGDQNVLVFVVDITERKQAQDALLAAQA
FT                   ELAHAARVATLGELSASIAHEVNQPLAAIVTSGEAGLRWLRRDVPDLKEVATTIGHVVA
FT                   QGRRASEIVTRIRTFLKKAAPQQDLLQIGEVIEEATALVARELAKDDVALIVEPQHGLP
FT                   PVRGDRIQLQQVLVNLLINASQAMSGRPGSRVITLRAGTVDSETLAITVQDSGPGIPPD
FT                   DMARLFDPFFTTKDGGMGMGLAICRTTVEAHGGRLSVVSTPGSGATFHLTLPYSQEHAP
FT                   P"
FT   CDS_pept        255240..255911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0258"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:blr0258"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45523"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45523"
FT                   /db_xref="GOA:Q89XQ0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XQ0"
FT                   /protein_id="BAC45523.1"
FT                   /translation="MTRPNQAQPPTQPSSATVIIVDDDAGIRASLDSLFRSVGLETRLF
FT                   GSPAELLGGSLPGGPGCIVLDVRLPGVSGLDLQSQLVRQGISYPIIFMTGHGDIPMSVR
FT                   AMKAGAVDFLSKPFRDQDMLDAVTAALERDAQHRAEAATKEDIRAQYGTLTAREREVMG
FT                   HVTAGLMNKQVAALIGLSEITVKIHRGNVMRKMGVRSLADLVRKAEALGVSQTRGTTDH
FT                   T"
FT   CDS_pept        256005..256388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0259"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:blr0259"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45524"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45524"
FT                   /db_xref="GOA:Q89XP9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XP9"
FT                   /protein_id="BAC45524.1"
FT                   /translation="MPMAKTPVIAIVDDDEGVRTSLASLVRSIGYEAQAYESGMDFLRQ
FT                   TPGDDPACMIADVQMPVITGDELQAQLIASGRRFPIIFMTAFPSESVRRRVMAAGAHCY
FT                   LGKPSSGDEIIRYLEEALAGHAP"
FT   CDS_pept        256542..258425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0260"
FT                   /note="ORF_ID:blr0260"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45525"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45525"
FT                   /db_xref="GOA:Q89XP8"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XP8"
FT                   /protein_id="BAC45525.1"
FT                   /translation="MPVNTTSAAAPRPLVFAGFPASSWAFALRVWLAMLLALYVGFWLE
FT                   LESPSSAALTVAVLALPTRGQGMEKAGYRLLATVIGVIASIAIAGLFSQTGGLLLVVLG
FT                   IWVGLCTYVAGLLDGNRAYAAALCCITVALIAVEQIDTPLQVFPTGVARGAAIGIGVLA
FT                   VALVNEVLAAPSYHPVLASRIEVLHRRVTDLARDAERGETPSAAVGAGLLHDIAAVRPE
FT                   IASLTTESSIGTARTAAARSALVDLVSALSLGRMLAALPAASALAPEAAGLVAISRSWL
FT                   RAEIGRNNAQVRGSLDALREGTSPYRAWRAPLYRSRRIAAETGARAAISFTLIAIVFVL
FT                   TGWPTTELCLSLVAVIIGLGSTSPSPRNFTMVAVMATPIACVLAGILKYLVFNGVSEFQ
FT                   LLAIGLAPVVIGLALLITLPSPMLSSIGRLVLVFTLVVLAPTNPQSYDPEVFLVTSLFV
FT                   CLSSVLVFAAQQLLPPLSGDRRVRLLLGEARRELSRADGGRARHLAPEEAAFRDAARIE
FT                   QILTANGPSAIDDRMAGTAMRCFDQAAALRRCRAELDRVGQGPLAVAAQAAREALTRRN
FT                   SGVILAAAEALHQSAARSDLSASAAIAALIAASVAFAPSQSPADSSQGRRS"
FT   CDS_pept        258637..259932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0261"
FT                   /note="ORF_ID:blr0261"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45526"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45526"
FT                   /db_xref="GOA:Q89XP7"
FT                   /db_xref="InterPro:IPR030196"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XP7"
FT                   /protein_id="BAC45526.1"
FT                   /translation="MEATLPRDAAPLRSEPSAEAPGDASSTAEGSAAPETVARDTSDRT
FT                   ADTVRPPTQATPSARPLRKAVGRFMLGAGKHLATLGIALVAVLISVATWQHYVTAPWTR
FT                   NGSVRVQVANVAPQVAGKIVALRVGDNQFVHKGDVLYVIDPFDFEVAVRIGKALVDQRA
FT                   ADLEVKQAEFDRRRHLSNLATTPEEQQIYAGNAAQAKAAYEAAAHQLAQAELNLKRTSV
FT                   TSPVDGYVTNLLLRAGDYAVTGVSNISVIDSNSFWIDGYFEETKMARVCVGDRAEAQLI
FT                   GYAKPILGHVKTVTRGVSVSNAAAGTQGLPSVDPIYTWVRLAQRVPVRVAIDTVPPDVP
FT                   LVSGMTATVTIRQPSAGDHQTRFDRFRASFVDPVTDLFGAGQPPRANCLQATSQQRPEV
FT                   EAIPYSREPPVPSAQSIAPGLTPGIDASPRLP"
FT   CDS_pept        260169..261236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0262"
FT                   /product="transcriptional regulatory protein"
FT                   /note="AraC family"
FT                   /note="ORF_ID:blr0262"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45527"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45527"
FT                   /db_xref="GOA:Q89XP6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XP6"
FT                   /protein_id="BAC45527.1"
FT                   /translation="MDQLHSAAVTTAAESRTRGRTMLTDIQAAGARSTYQPSRHKPASP
FT                   QETRAFPLERRWRQPAATPDDITISRWTCTQTGIRHEEATTPADRYFFAIALKTSRAKL
FT                   TRGRHTIFDGIMPAGTLYIGAPLQQLSAQFSAPCDFLHFHVSASTYFPFLRPGAGTASA
FT                   EGLNDLVLLRDPFAEQLAKALTERGHSADREFARCIGQTLAMHLARRELPHSKVNALPK
FT                   WRLRRVEEYVGTHFDHCISLSELAKVAGLSRMHFAAQFRAATGYRPREYLLHQRIERAK
FT                   SLLSNSETALAEVALTVGFCTQAHFSTVFKRITGDTPARWRCASRNASASSRLSGGDPA
FT                   STYKAVSHVLPADFS"
FT   CDS_pept        complement(261455..262393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0263"
FT                   /note="ORF_ID:bll0263"
FT                   /note="putative malonyl CoA-acyl carrier protein
FT                   transacylase (EC 2.3.1.39)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45528"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45528"
FT                   /db_xref="GOA:Q89XP5"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XP5"
FT                   /protein_id="BAC45528.1"
FT                   /translation="MTLAILCSGQGGQHRDMFALTGGAPEAADLFAHAATLLGGSDPRD
FT                   FVRGEPDEALHRNRTGQILCTLQPLAAARALADVIPRGVIIAGYSVGEVAAWGVGGVLD
FT                   ATATLDLVARRAEAMDAATRAGDGLIFVRGLSREEVGRLCERHGAAIAIVNPGDAFVIG
FT                   GGREALGGIADDARAMHGARIVALPVEVASHTKRLAAASAAFRETLRLAPAVFPPRTGA
FT                   RILSGIDAAPVVSLESGRDKLAAQISQTVQWADCLQACVEAGATGFLELGPRHALSSMV
FT                   AEIGAGLPARSLDDFRSLQGVRAWAARHLND"
FT   CDS_pept        complement(262403..263353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcF"
FT                   /note="ORF_ID:bll0264"
FT                   /note="probable malonate decarboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45529"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45529"
FT                   /db_xref="GOA:Q89XP4"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XP4"
FT                   /protein_id="BAC45529.1"
FT                   /translation="MMSNAILMALVPVFFVLLLGYAAGKFHIVDNLHVDALNALVMDFA
FT                   LPASLFAATASASRRDMIEQVPLSMVLGVTMLLLYVAWYCAARRFSKASRSDASLQALT
FT                   IGFPNLAGVGLPILSSVLGPAGTVPVAVALATGSILISPLTLIMVEMGASRAQGAELSM
FT                   RQILTAVRRAITKPVVLAPAAGILLSLSDVSLDALAHACLALIGSAAAGVALFLTGAIL
FT                   SAQSFRLDWRIVAATAASDVVRPLLAIAVIHFIPIAPDPAKTAILLAAVPSGFFGILFA
FT                   VNYRLDSATAGSMVIASTGFSVVTLAIAIAMLFPG"
FT   CDS_pept        complement(263350..264228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcB"
FT                   /note="ORF_ID:bll0265"
FT                   /note="probable 2-(5''-triphosphoribosyl)-3'-
FT                   dephosphocoenzyme-A synthase (EC 4.2.-.-)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45530"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45530"
FT                   /db_xref="GOA:Q89XP3"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017555"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XP3"
FT                   /protein_id="BAC45530.1"
FT                   /translation="MITMAARGMERPLLRRARMMPDVSAIGAVAADCLVKELETWPKPG
FT                   LVSHVDNGSHDDMDAGTFRRSAAAIRPYLQRLADAGAFGCGMGRLRIIGLEAERAMFAA
FT                   TSGVNTHRGAIFGLGLLCAAAGARAGGLVDPELPLGDVVARLWGDSILDGPVLLHSHGS
FT                   VARRRFRAGGARIEAARGFPSIYGIGLPALRRATVVVEDTEAARVEACFALIASVEDTN
FT                   LLHRGGLDGLRFAHDAARRFVDAGGVCASGWRARAQSIHESFVARRLSPGGSADLLAMT
FT                   LFVDVHERPIP"
FT   CDS_pept        complement(264225..264905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcG"
FT                   /note="ORF_ID:bll0266"
FT                   /note="probable malonate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45531"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45531"
FT                   /db_xref="GOA:Q89XP2"
FT                   /db_xref="InterPro:IPR017557"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XP2"
FT                   /protein_id="BAC45531.1"
FT                   /translation="MTSPCKHGDRPPGRHDLVFVSPAGWRAMLDARDDLAADSLLARWP
FT                   KMRWPTIRRRALPHEATGVALGLPLPPSAGKKRVALLVEIDHVASVARPPSLQQARAYA
FT                   PRNWWPTLDRLDGLALRHSVDARVYGSLAWQSLTGLDYVTGRSDLDVLFEFRSETDIDR
FT                   FVADVAAIETSAPMRLDGELMSADGAAVNWREVHGGASELLVKSIERVVLLDRHQFISG
FT                   ATGS"
FT   CDS_pept        complement(264880..265602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcE"
FT                   /product="malonate decarboxylase gamma subunit"
FT                   /note="ORF_ID:bll0267"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45532"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45532"
FT                   /db_xref="GOA:Q89XP1"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XP1"
FT                   /protein_id="BAC45532.1"
FT                   /translation="MTLDDIIASLFPDGHEVSNDNGVLHGSATLRSGGTMLVIGIANRT
FT                   ALGVDEAIRLSAHVLKSIGRDSGPILVLVDSDSQRMSKRDELLGLNEFLAHLAKVLIHA
FT                   DMNGRPTIGVLYGHSAAGALLATGLATRVLVGLPGADPAVMDLPSMAKVTKLSMEALQE
FT                   KAKSTPVFAPGLSNLAQMGAVHMTWSNAASLADQLEALLADMPAAQDRRDALGKQRGGR
FT                   LKAAEIAERVRDLALQAR"
FT   CDS_pept        complement(265589..266452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcD"
FT                   /product="malonate decarboxylase beta subunit"
FT                   /note="ORF_ID:bll0268"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45533"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45533"
FT                   /db_xref="GOA:Q89XP0"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XP0"
FT                   /protein_id="BAC45533.1"
FT                   /translation="MRLELLLDAGSFVEFIGPEQREVSPHLKIFDLPEQFDDGIVVGHG
FT                   RLDGSPVFVAAQEGRFMGGAFGEVHGAKLTGLLRAAREIGSIPVLILFDTGGVRLQEAN
FT                   AGELAIAEIMRAVMEARAAGVKVIGLIGGRSGCYGGGGLIAGCCSALAVSEPGRIAVSG
FT                   PEVIETNRGVEEFDSRDRALVWRTMGGKHRRLLGAADVFADDNVQDFREAALELIGLVG
FT                   PFGLDRLKAEQERLAGRLRRFGACADAVDIWTAEGIEHAETVPELPADQFIALANRIGR
FT                   TSRDAR"
FT   CDS_pept        complement(266524..266841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcC"
FT                   /product="malonate decarboxylase delta subunit"
FT                   /note="ORF_ID:bll0269"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45534"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45534"
FT                   /db_xref="GOA:Q89XN9"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XN9"
FT                   /protein_id="BAC45534.1"
FT                   /translation="MEDLSFRHPVRARADGARRSAIVGIVASGNLEVLVERVLPDAECA
FT                   IDIKTAAVGFGEVWRAVIGDFVERYSPGGLKFSINDGGARPDTVSLRLAQAVRSIAENG
FT                   Q"
FT   CDS_pept        complement(266852..268498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcA"
FT                   /product="malonate decarboxylase alpha subunit"
FT                   /note="ORF_ID:bll0270"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45535"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45535"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XN8"
FT                   /protein_id="BAC45535.1"
FT                   /translation="MTSWQDNRVARDACIAAGAVLARGKVVEAHDVTRLLEAVIRPGDR
FT                   VCLEGDNQKQADLLSRALLAVDPSRVNDLHMVQSGVVLPEHLDLFDRGVAKRLDYAYSG
FT                   PQSARIARMLFGGKIELGAVHTYLELFARYFIDLTPHVALIAAVSADREGNLYTGPNTE
FT                   DTPTVVEATTFKDGVVIAQVNEIVETVPRVDIPADRVHFIVKANKPFFVEPLFTRDPAA
FT                   ITEGQILTAMLAIKGVYAPYGVQRLNHGIGFSTAAIELLLPTFGERLGLKGRIATHFAL
FT                   NPHPALIPAIESGWVRQIHSFGSEVGMDDYIRARSDVYFTGPDGSLRSNRAFCQAAGLY
FT                   ACDMFIGSTLQIDLQGNSSTVTTSRIAGFGGAPNMGADARGRRHPSEPWLKAGAEADPD
FT                   GSALMRRGRKLVVQIGETFGDKNVPLFVEKLDAIELAEKLKLELAPVMIYGDDVTHIVT
FT                   EEGVANLLLCRTAQEREQAIRGVAGYTDVGRRRDHGMVARLRERGVIRRPEDLGINPLD
FT                   ADRSLLAARSIKDLVRWSGGLYAPPSKFRNW"
FT   CDS_pept        complement(268495..269361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0271"
FT                   /note="ORF_ID:bll0271"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45536"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45536"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XN7"
FT                   /protein_id="BAC45536.1"
FT                   /translation="MNVIETTGAALNWKVTTVKRAGLSRDLPSGNPDLMWVANSSTLIY
FT                   GERDAVLVDTFLTAGQSKTLLDWVASCERNLTTIYVTHGHGDHFFGLAPLLDRFPQAKA
FT                   VAVPEVVDEMKAQLSPASLDGFWRKRFPGEIAERLVAAAPLEGELTLEGHKLVVIDMGR
FT                   TDTARSTALHVPSLDLIVAGDTVYNGIHPYLAETDTQSRLEWIAALDRLAALKPRFVVA
FT                   GHKKPDNDDDPRNIAATRQYLLDFNRLDKATTSPRELYEAMLELHPDRANPGSLWSGAN
FT                   AAKGQKS"
FT   CDS_pept        complement(269459..270244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0272"
FT                   /note="ORF_ID:bll0272"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45537"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45537"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XN6"
FT                   /protein_id="BAC45537.1"
FT                   /translation="MKHLNAGLAFAAALSLLSTVAPANAEPLKNIVLVHGAWVDGSGWK
FT                   PVYEILTKEGFRVTMVQEPETSFADDVTAAKRILDLQDGPTLLVGHSYGGSIITEAGVH
FT                   PSVVGLVYVAAHAPDVGEDESALGKKTPSVLGKTEGVIKVTPDKFTYLDPVQFPKLFAP
FT                   DLPRERAEFVARSQVPAAAQVFSTPLTAAAWKTKPSWGIVAGNDQIINPDLERWYYERA
FT                   KSQTTVIPGASHSVYESHPKEVAAVITRAARSIQQPVTR"
FT   CDS_pept        complement(270252..270518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0273"
FT                   /note="ORF_ID:bsl0273"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45538"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45538"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XN5"
FT                   /protein_id="BAC45538.1"
FT                   /translation="MNDRARIDRLSRMNAGRSRLREIIVMNVSVHDVGPPLEVRLSTGP
FT                   RPEDVRAAIVAARVSRRAKWQGPLLAEIRGQASKLVLRHSNPE"
FT   CDS_pept        270565..270906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0274"
FT                   /note="ORF_ID:blr0274"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45539"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45539"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XN4"
FT                   /protein_id="BAC45539.1"
FT                   /translation="MTSIAKCSVALFALLCATMPALAGSCADDIAQTQAQLDLAIEKDA
FT                   GSHGWKPESLSALRSHQPTPRSLAEAEGGNGVDFTDALDSLDRARTANRAGDIAACSRE
FT                   IAHARAILR"
FT   CDS_pept        complement(271050..271550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0275"
FT                   /note="ORF_ID:bll0275"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45540"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45540"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XN3"
FT                   /protein_id="BAC45540.1"
FT                   /translation="MPPVDVGPGTGTDGLIPAPPISVEPSGIPTRPTVDVEGRDETAAV
FT                   LPGQLVDKVPDSPPPSNNAPEDEALPDPAQAVVFGAGLIGEMPGVAISVDPNGMPTGRV
FT                   DCGLSGEVASMPAGGCVPGIVVWAMAAVETSHRTLVASIAAGCIKENRRDSELRAPASF
FT                   GEC"
FT   CDS_pept        271601..272773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0276"
FT                   /note="ORF_ID:blr0276"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45541"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45541"
FT                   /db_xref="GOA:Q89XN2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XN2"
FT                   /protein_id="BAC45541.1"
FT                   /translation="MKRNLTIAFVALAAILIGAGLWFFGTDRKPAVAAAPVPTAVPVVA
FT                   ASVTGKDVPIYLRGIGTVIAYNTDVVRSQIQGQIVKIAFTEGQTVKAGDLLAQIDPRPY
FT                   EAQIEQLTANRDRDQAQLANAEANLSRYNQLGDKGYATPQLIETQTAQVAQLKAAVKAD
FT                   QAQIDEANVQLSYTRLSSAVPGITGVRQIDVGNVIHPTDPNGLVIVTQIEPISLLFTLP
FT                   QADLPVIQEHAAKGELKVIAYSQDNKTKLDEGTLLLVNNEIAGTTGTVQLKAVFPNHEH
FT                   KLWPGQLVNARLLLEVQKGALTVAGSAVQQGPNGSYVYVVTDGQTATLRPVHVVQISDG
FT                   QALIDQGLKSGDVVVIDGQYRLTEGSRVRELHGKAAREADLQSAVQDAIP"
FT   CDS_pept        272770..275913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0277"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /note="ORF_ID:blr0277"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45542"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45542"
FT                   /db_xref="GOA:Q89XN1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XN1"
FT                   /protein_id="BAC45542.1"
FT                   /translation="MNLSAPFILRPIATALLMAGLLLCGLAAYPLLPVGALPNVNYPTI
FT                   QISAQLPGADPGTIASSLATPLEQQLSQIPGVTQLTSSSALGVAQLTVQFELSRTVDSA
FT                   AVDVLAAINAASPFLPPNIPYPPTIRKVNPAETPIMLIALTSDSLPLTTVDAYAENILL
FT                   PKISQVPGVGLVGIGGQQKPAIRVRVNPQALAARGIGLEDVRNVIAGANVDLPKGTLNS
FT                   PRVTYTLNTNDQLLKPSAYEDLIIAYRNGSPVRIRDIGTAIEGPENDLLAGWYGKEPAI
FT                   ILAVQRVPGANVIETVDRIKKLLPQLQASVPPAIKVTIAADRTATIRAAVSDVQFTLML
FT                   TVALVVMVIFLFLRNFWATIIPAITVPLSLIGTFAVLYVLGYSLDNLSLMALSIAVGFV
FT                   VDDAVVVIENIVRHLEQGMTPMEAALKGSSEIGFTIVSITLSLIAVFIPLFLMGGYVGK
FT                   LFQEFAVTITASLLLSLVISLTLTPMMCARLLKDDSRKKHGRIYLAFERGFDALLALYA
FT                   SGLRIVLRHRFVTLLVMLSTIALTGYLYVIIPKGFFPQQDTGQIVGITEAAQDISFPAM
FT                   SERQQAIVDILSKDPAIQSVASYIGPGGPTATLNQGRIFIVLKPKPGRKASADQIIERL
FT                   GPQLAHIQGIRLYMQAAQDITIGARLSKTQYQYTLTDADSNELTNWSAIFLKKLRELDL
FT                   ITDVASDQANAGPRLEVTVNREVASSFGILPTTIDNALDDAFGQRIVSTMFTSLNQYHV
FT                   VMEVDPRFQYGPEALKDIYLNSATGQQVPLSTLVHSVIKPAPILINHQSLFPSVTISFN
FT                   LQPGAALGDAVTAIQNIEKSTGKPASLSTSFQGNAQAFQSSLRGTPLLIGAALIVIYII
FT                   LGVLYESLIHPITILSTLPSAGIGALLLLLAVHMDLSVIAIIGIILLIGIVKKNGIMLV
FT                   DFALEVERQHGLSPEEAIYQACTLRFRPILMTTMAALLGGVPLMIGSGTGAELRQPLGY
FT                   TIVGGLMLSQILTLYTTPVVYLYLDQLSNWLTGRKPQAAATPTSSTTKADAELSHESA"
FT   CDS_pept        275900..276316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0278"
FT                   /note="ORF_ID:blr0278"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45543"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45543"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XN0"
FT                   /protein_id="BAC45543.1"
FT                   /translation="MNPLERLTAGMTAEKLVTVTSEMTVGHVVPGMPAVYGTPMMILHM
FT                   EMAAGSAVQPFLPTGHVSVGMMVNIRHLAATPVGRTVRAIARVVAVEARSVLFEVEAWD
FT                   GDRKIGDGSHRRGVVDVAEFERRFGVTKPAAEMA"
FT   CDS_pept        276419..278269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0279"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /note="ORF_ID:blr0279"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45544"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45544"
FT                   /db_xref="GOA:Q89XM9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XM9"
FT                   /protein_id="BAC45544.1"
FT                   /translation="MTLERLDGPNFVQLQRWWRRLLQDWAKQDRTPLWAWSSVALCLLS
FT                   FAWSLLGFNSTTIALAAFLATSLAAISLTRWSGEHGHLAAYLAEAQKLSQTGSFGWNVV
FT                   TGELFWSDETFRIFDLAQTSRPSLAVVLKRTHPDDVNAVREAIDRAVNERGDFSHENRL
FT                   VLDDGSIRTIRVVARGMTNGRGQFEFVGAVMDITAQKKAHTELERSEQRYRHLFSRMPI
FT                   AFRQLDASRLVVLFRKLRAEGVKDLGAYFDSHPEFLRTCMDALSFQEANERAIQMFGGG
FT                   VEGYVGRSMAESWKERPDTFRRAMESRYRGETNFEEETKMVTWDGRVVDVLFTTARVGP
FT                   INDLEVSLVGTIDISQRVRAQQKLQQVQAEFAHAARVSMLGELTASIAHEVNQPLAAIA
FT                   TNGAAGLRWLNRPTPDIVEIRKTIENIIVDTQRAANIVARVHGMASRKVPEQASLSFDE
FT                   IVREALLFLRHELESRGVTILHQPDPTTPQVLGDRTQLQQVIVNLAINAVQAMTQAGYD
FT                   DRRIVISTVTQDAATLCCAVEDNGPGIAVEHVDRLFESFFTTKDSGMGMGLPICRSIVE
FT                   AHGGRIGAGGNGASGGARFWFTLPVSVPADSLRCDLNADT"
FT   CDS_pept        complement(278293..280584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhF"
FT                   /product="formate dehydrogenase alpha subunit"
FT                   /note="ORF_ID:bll0280"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45545"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45545"
FT                   /db_xref="GOA:Q89XM8"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XM8"
FT                   /protein_id="BAC45545.1"
FT                   /translation="MTTKSVRPYREPAGGWGALKALSEALLVQRVPLKGAATLSRMNQP
FT                   EGFDCPGCAWPDPKHTSSFEFCENGGKAVAWEATSKRCTPEFFAEHTVTELTSWNDYDL
FT                   EMVGRLTHPMAYDAASDRYLPVEWSDAFDMIGRELRALPDPNMAEFYTSGRTSNEAAFL
FT                   YQLFVREYGTNNFPDCSNMCHEATSVGLPYSLGVGKGTVLLEDFDKADCIFIFGQNPGT
FT                   NSPRMMTSLRNAARRGASIISFNPFRERALERFQAPQSPIEMITLSSTAISSKLFQVRV
FT                   GGDVAVLKGIMKILVEADEAARAAERPEILDWDFIRGHTVGVEALIDDLKRTQWPDIER
FT                   QSGLTREDMEYAAGAYMKAERAILVYGMGITQHWRGANNVQQIANLALLRGNVGREGAG
FT                   VCPVRGHSNVQGDRTVGITEVPKADFLERLEQRFGFKPPTAPGHNVVTALEAMIRGEVK
FT                   AFFAMGGNFAAAIPDWQATQAALRNLDLTAYVATKLNRSHLVHGRAALILPCLGRTEID
FT                   VQASGPQSITVEDSMSMVHASGGRNKPASEHLLSEVAIIAGVAKATLGERTVVDWDDFV
FT                   ADYDRIRDAIEAVFPIFQGYNARIRVPGGFHLTSTARERIWATPSGKANFLVFAGCGED
FT                   PPQGDPDFLWLTTIRSHDQYNTTLYSMSDRYRGVFGQRDVVFLNEYELKRRGLVDGDRV
FT                   DLITASTDGAERIVRNFRVVAYSFPTGCCAAYYPETNPLVPLYARDPLSFTPSYKGVPI
FT                   RLVRSAATGE"
FT   CDS_pept        280833..282080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0281"
FT                   /product="oxalate decarboxylase"
FT                   /note="ORF_ID:blr0281"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45546"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45546"
FT                   /db_xref="GOA:Q89XM7"
FT                   /db_xref="InterPro:IPR006045"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017774"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XM7"
FT                   /protein_id="BAC45546.1"
FT                   /translation="MFSRRDLLAMSAAGAAMVGSSAQAATFGNPDEPPQGAVNAKSPGS
FT                   LSDPGPQNPELAKQFPSAQTPPATDVGGLPMDWASFNNAPRRIQNGGWARQVTVEDFAI
FT                   SKEISGVNMRLSAGGIRELHWHQAAEWAIMTYGSCRITVLDTQGRPYVGDLKAGDLWYF
FT                   PPGAPHSLQGLGPDGCEFVICFDDGHANEFNTLLVTDWLAHTPPEVLAKNFGVPADAFA
FT                   KIPLHNRWIFQGTVPGDLADDRAAVSRHAEAPPYPFIHSLGSSPPVKESAAGSIRVADS
FT                   SNFKVATTVAAALVTMPPGAVREMHWHPNADEWQYYIKGKARMTVFDTGPNALTTDFSA
FT                   GDIGYVRRNLGHYVENVGDTELQFVGVFRAPRYEEVSLSNWLTHTPPKLVAQHFNIDEK
FT                   LIAQWPDNGPGVMPKS"
FT   CDS_pept        complement(282161..283147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0282"
FT                   /note="ORF_ID:bll0282"
FT                   /note="putative quinol oxidase subunit II transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45547"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45547"
FT                   /db_xref="GOA:Q89XM6"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XM6"
FT                   /protein_id="BAC45547.1"
FT                   /translation="MVMFWVALLAISILIYLLLDGFDLGVGMLFGLADGEARRDEMLRT
FT                   IAPVWDGNETWLVVTGVIMWGAFPVVYAMLMPAFYIPVVVMLLGLILRGVAFEFRGKAS
FT                   RSRRVWDFSFAVGSFAASFMQGAMVGALVEGLQFSNGEYVGGTFGWLTGFSVLCGIGLC
FT                   FGYALLGVCWLVRKCEGPIRDATRRQIPLLAVAVLAFLVVVFTHALVEHLPILRRWIER
FT                   PYLFVFPLIGAGAAAVLATSILRHDDYWPFHMVALIFASAFGTLALSFWPYMIPFVITI
FT                   EEAAAPHASLAFMFWGAGLFVFPLMLLYVAVGYRVFRGKTAATADHY"
FT   CDS_pept        complement(283150..284556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0283"
FT                   /note="ORF_ID:bll0283"
FT                   /note="putative quinol oxidase subunit I transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45548"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45548"
FT                   /db_xref="GOA:Q89XM5"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XM5"
FT                   /protein_id="BAC45548.1"
FT                   /translation="MDPTALLLSRLQFAFTISFHIIFPAFTIGLAAWLTVLEAMHQYSG
FT                   KPVYRTLFEFWLKIFGVAFGMGVVSGVVMAFQFGTNWSVLSKMSGPIQGPLLSYETFTA
FT                   FMLEAGFFGILIFGRPRVPPWFYLFSTAMVALGTTLSAFWIMVNNSWMQVPTGYVLQNG
FT                   QFVPNDWAQIIFNRVVWVRFPHMLLASYLTGAFCVAATGAWYLLRRTYRAEAHVMLRMG
FT                   LALAAVLLPVQLFIGHLVGDYVHDYQPAKFAAIEARWHDEQPASEVLIAIPDSSTESNK
FT                   YAISIPVLGSIIGSMSLTSKEVGLTSFAPQDRPPVAIPFFAFRVMVGCGFVMLGLAWFG
FT                   TWLGLKHRLDRSRLLLWGIFLSFPLPWIAILTGWYTAEVGRQPWTVYGVLRTADAVTPS
FT                   LTAAAATASLILFVAVYAFIFSFGTYYIYRLLRAGPAGLGGKPLHVPVPNRPMSLADQV
FT                   PSHSYLEAGE"
FT   CDS_pept        complement(284576..286114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqo"
FT                   /product="malate:quinone oxidoreductase"
FT                   /note="ORF_ID:bll0284"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45549"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45549"
FT                   /db_xref="GOA:Q89XM4"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XM4"
FT                   /protein_id="BAC45549.1"
FT                   /translation="MPAASDRETDVVLIGAGIMSATLGAFLKELEPSLTIQMLETLDDC
FT                   AQESSDSWNNAGTGHAANCEMNYTPQRPDGSIDISKALQVNVEFDLSRQFWSYLIGRGA
FT                   IADPRSFIHPVPHMSFVHGTENVEFLRKRFKAMSAHHCYEGMEHTEDPRKIAEWAPLVM
FT                   DGRSGDEPVAATRIITGTDVDYGALTHLLVGHLVSQPGCAVHYNSCVTGLVREQGGRWR
FT                   IEVRDTASGETRSVRAKFVFIGAGGGALPLLEKSGLPEARGYGGFPVSGIWLRCDDPEI
FT                   NKRHHAKVYGKAAVGSPPMSVPHLDTRVIGGKHSLLFGPYAGFSSKFLKHGSLLDLFES
FT                   IRPANVKPLLSVARDNFDLTEYLVGQVLQSESHRLAALDEYFPKADPKDWRLQVAGQRV
FT                   QIIKPDVKRGGLLEFGTELVGADDHSLVALLGASPGASTAAFIAISVLEKCFAGELTAS
FT                   AWLPKLKQIVPSYGVSLIDDADFCRQIRATTAEVLKVDNIPQPAARAPAAAKRA"
FT   CDS_pept        complement(286157..286561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0285"
FT                   /note="ORF_ID:bll0285"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45550"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45550"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XM3"
FT                   /protein_id="BAC45550.1"
FT                   /translation="MIRCVRLWTGEDNNSHFEEGFLELEPGQRGDFLTGKFDAVSVSFQ
FT                   ETESGGAFAWHTAPIRQLVITLSGTLDFQTRDGHHFLIHPGNVLLAEDTAGSGHSWKLT
FT                   DDSSWRRAYVILRPGADVPFRAKTRQSVQA"
FT   CDS_pept        complement(286635..288299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /product="fumarate hydratase"
FT                   /note="ORF_ID:bll0286"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45551"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45551"
FT                   /db_xref="GOA:Q89XM2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XM2"
FT                   /protein_id="BAC45551.1"
FT                   /translation="MRSLALPASKPSTLEPCDCLSVPHAQRAFARCKPRRPPCHSEKGR
FT                   SFAEACALCRPYTLGRRRKSAPDINCHERQRMNDLRKETDSLGEVNVPADKLWGAQTQR
FT                   SLEHFSIGRDLMPREMIQSYAILKKAAANANYAGGRLDGKIHKLIVHTCDEILAGQHHD
FT                   MFPLHVWMTGSGTQFNMNVNEVISNRCCQLAGTALGSKLPVHPNDHVNMSQSSNDSFPS
FT                   AMYIAAAMNVTQRLVPAVEALHDAIAAKSNQWDDIVKIGRTHMQDATPLTLGQEWSGYA
FT                   AMLADGLARIDDALKGVFRLALGGTAVGTGINAAPGFAEAVAAEIARLTGLPFVSAPNK
FT                   FAVQGAHDALVQLSGTLRTLAGSLYKIANDIRLLSCGPRAGFAELRIPENEPGSSIMPG
FT                   KVNPTQAEALTMIAVQVMANDVAVGFGGAGGYLEMNVYKPLIIHNIAQSVTILTDGCTN
FT                   FRTFLVEGTEPNRKKIKEYVERSLMLVTALAPVIGYDKASRIAHYAMDNDLTLKSAALK
FT                   LGFVTEPEFDRIVDPAKMVKPYVAEIKVPLAIGAKTG"
FT   CDS_pept        complement(288239..288925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0287"
FT                   /note="ORF_ID:bll0287"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45552"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45552"
FT                   /db_xref="GOA:Q89XM1"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XM1"
FT                   /protein_id="BAC45552.1"
FT                   /translation="MAMQAASTEALAETRVEAYAPERSLLVASLLSMSGGFLDAFTWLS
FT                   LGVFASSQTGNVVFLGIDAQSGQWLRALHHLLPIVAFVLGAVVAARTRAALRCLVGEIV
FT                   CLATAMLLLHRVPDQIVILVISFGVALQSASFRQVGRWKYLSVTASGNMLRAIDQFVAA
FT                   SDRDAARGGGAMVAICLMFLLGAAVGGCVTKWLGTWSLALPIALSVCVLWLCRHRSHQH
FT                   WSRAIV"
FT   CDS_pept        complement(288944..289780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0288"
FT                   /note="ORF_ID:bll0288"
FT                   /note="putative formate dehydrogenase associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45553"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45553"
FT                   /db_xref="GOA:Q89XM0"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XM0"
FT                   /protein_id="BAC45553.1"
FT                   /translation="MMTGSTFTRHREIAWRGGRTRSTSRLVAEESAIALTYNGSTHAVM
FT                   MGTPADLEDFGVGFSLTEGIIGCASEIRSIELISNELGVEVRMWLDGDRAASLAARRRA
FT                   ISGPVGCGLCGIESLEQARRAPSRVESPGIAFHARDLLSAMQALSPLQTLNQQTRSVHA
FT                   AAFWHPRAGIAVVREDVGRHNALDKLAGAIVRDGNSARDGAVLLTSRVSVEMVQKAAMI
FT                   GAPVVVAVSAPTALAIQTANEAGITLLAVARDDGYGVFTHSRRVLLPEEAAPPAGC"
FT   CDS_pept        complement(289784..290383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0289"
FT                   /note="ORF_ID:bll0289"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45554"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45554"
FT                   /db_xref="GOA:Q89XL9"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XL9"
FT                   /protein_id="BAC45554.1"
FT                   /translation="MTDMSNSKASLGRAIHAIAGKWGWFVALGVGELILGGIASANLMA
FT                   ASLASVLVIGATMAVAGIFQIVHAFSVHGLRGFLFWLFAGIIYGAAGAVILYDPLLASF
FT                   TLSLAMCAFLIVAGVTRIWVGFHMQPAAGWRWIVAAGVVTFCVGVMLVAAWPTIGLWLL
FT                   GAMLVVDLIFQGWGFIAFGLALRNRASRHSAEPATV"
FT   CDS_pept        complement(290727..291236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0290"
FT                   /product="hypothetical low temperature-induced protein"
FT                   /note="ORF_ID:bll0290"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45555"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45555"
FT                   /db_xref="GOA:Q89XL8"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XL8"
FT                   /protein_id="BAC45555.1"
FT                   /translation="MTTMSKADLQSPTDLGANANRDIPAALRALLADVFALYLKTKNFH
FT                   WHVSGRHFRDYHLLLDEQAEQIFAMTDDIAERARKIGGTTLRSIGHIAREQRILDNDAD
FT                   YVEPQDMLAELRSDNQQLTREMRRVHELCDEYGDVATASLLENWIDETERRIWFLYETG
FT                   RSGPNS"
FT   CDS_pept        complement(291291..291854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0291"
FT                   /note="ORF_ID:bll0291"
FT                   /note="probable cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45556"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45556"
FT                   /db_xref="GOA:Q89XL7"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XL7"
FT                   /protein_id="BAC45556.1"
FT                   /translation="MSNAPHRFALLQRLLHWLMAVCIIAMLFIGVGMVSTVAPTYLPLI
FT                   LIHKTLGVTLLALVVIRLALRRHYSAPPLPADLPPAMKLAARLSHQLLYGFMIVMPLLG
FT                   LGMLWAAAYPVVLYGDIRIPALLPQSDRLHTLLWNAHVYLGFAFFALVLLHLAAGLFHA
FT                   LIRRDGVFGTIALLPLRNRTTPAE"
FT   CDS_pept        complement(291851..293128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0292"
FT                   /note="ORF_ID:bll0292"
FT                   /note="putative sulfur regulated plasmid-encoded protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45557"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45557"
FT                   /db_xref="GOA:Q89XL6"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024168"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XL6"
FT                   /protein_id="BAC45557.1"
FT                   /translation="MSDFQIARNISRKPEIRRGRAPQTGQARTCLREIGDPVSEDRGRG
FT                   RQLQRNPSRSTERAVGPDCGAACVLQGAAMNQSGNLPRSRLGSLVLIVAVLGGGAAALA
FT                   YTAGWLSPGRLTPDRMIAALTPPSGPPLGHRRNHAKGICFTGVFEANGNGVELSKARVF
FT                   ERGTYPALGRFNLGTADPNAVDATARVRGLGLQIATADGEEWRMAMINPPFFAVSTPQA
FT                   FHDLLIASGKKDPEAMKIFIQVNPEFAAFAAWAKTAPWTASYAEEPYHGLNSFNFTDAK
FT                   GAEHAVRWSLLPTAEVVPLSQAELEKRGPDFLEQEIAERVRIAGPQRWTMVTTVADPGD
FT                   PTADPSKPWPEGRRTVQVGTLIVQRIEPERDGPCRDINFDPTVLPQGIRVSDDPFPAAR
FT                   SSVYRKSYDLRAAEARDYPRTETARP"
FT   CDS_pept        293168..294148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0293"
FT                   /product="oxidoreductase"
FT                   /note="ORF_ID:blr0293"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45558"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45558"
FT                   /db_xref="GOA:Q89XL5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XL5"
FT                   /protein_id="BAC45558.1"
FT                   /translation="MALRTRPAVGRRTMNVSRRRWRLCGSWSAIGVRMSKVIIVTGAAN
FT                   SIGRSTCKTLAQAGHTVYVSMQETKGHDDHGVEDAGKHGAELRTIAFDVASEASVNSAI
FT                   DAIVAENNRLDVIVHNARQVIYGPAEAFTPDQLAELYDTNVLNAQRVNRVALPQLRKQG
FT                   QGLLIWVSSSSARGASVPFLGAYASSKAALDALALGYAGELARWGVETTIVVPSALGPG
FT                   HYIRSGRPLDTARAEEYADGPTADVSEIAQSALAQLPAKDRTPQDVATAIADVVGMPFG
FT                   QRPLRVHFGPDDDGAAAVNAIADSVRMELLRRIGLDDILKPASIG"
FT   CDS_pept        294378..297347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0294"
FT                   /product="transcriptional regulator"
FT                   /note="ORF_ID:blr0294"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45559"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45559"
FT                   /db_xref="GOA:Q89XL4"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XL4"
FT                   /protein_id="BAC45559.1"
FT                   /translation="MCFQVIERDESCAGLKFPMAPRWQSNNTQSSNTMAAAGRSAQDEA
FT                   AREILVFGPFRLDPSQRRVERDGSPLQLSGRAFDILLALVRQAGNVVSKTELMATTWPG
FT                   AAVEENSLRVHIAALRKALGDGNDGVRYLSTVSGQGYCFVAAVSRPEQRQPAPTNPTYV
FT                   HNLPAHPRQMVGREQAIQDISERLRAQRFVTVVGPGGIGKTTVAISAGHALLAEFAGHV
FT                   HFVGLGETGSAAPVPAIVASSLGLRARSNDPTNSLATFLRDMRMLLILDCCEHVIEAAA
FT                   ALAERLYQAAPELHILATSRELLRVEGEFTYRLPPLPSPPEKIVLTAANALAYPSVKLF
FT                   VERATAGGGEFALTDANASDVGNLCRRLDGIPLAIELTAGHVGAYGARAMVQLLDQHLN
FT                   LLWEGRRTALPRHRTLRATIEWSYNLLSDAERVILGRLSVFVGSMTLDAVRSIAAGSED
FT                   DDTILAIIDSLVAKSMLALNTGSQPTRYRLADSTRAYAQEKLAASGDSEAVARRHACYF
FT                   LGLLEKIGDEANRDLSTVAEEFGNVRAALTWCFSDQGDRRAGVALAAASIPLFFKLSLL
FT                   AECELWVTRAIEALDDTNGGIRQGLVLHTALGAARMLTGQLDELGANHLRRALELTERI
FT                   GDIPGQIRLIDQLHLLQLFVGKYDDAFGIAKRGEAIALANNDSNAVARMRVLLSISCQY
FT                   LGKFVASRSYVEKALRHTGLDKDVLSGLTLEYPKRAQITLARVLWLQGYPDQATRIVRR
FT                   AISDVIAANHPVMFCRALPWAFGVFFWNGDLEDCEEHIDRFVVEARRHNLAILQLVGEA
FT                   MKGITLLARNETGVGLAMLKGSIEKLHSLCFGAVAGFRMPLADALAATGHGDEALDTID
FT                   QAIAQAQHCNFMMDMPDMLCTRAKALMRKSNPDLSQAELSLIRALDLARHQGALGYELR
FT                   AAIALARLWQRGDRRREAYDMLAPVYQQFTEGFQTRSLVAARGLLAELNPPRSRSFAAK
FT                   "
FT   CDS_pept        complement(297611..300508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0295"
FT                   /product="transcriptional regulator"
FT                   /note="ORF_ID:bll0295"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45560"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45560"
FT                   /db_xref="GOA:Q89XL3"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XL3"
FT                   /protein_id="BAC45560.1"
FT                   /translation="MVSWTENDETAWAVPMMAEPGQRPVYIYAQWEIDLVRRELRSAGE
FT                   LVPLGGRAFEILAELVQAEGQLVTKNDLTERVWRGVFVEESALRVHIAAIRKALGPDRD
FT                   MLSTTVGRGYRLLGAWRIRHMDAPLQSAATGLLPSTNIPSASFDLIGRTAAIAHLWRLL
FT                   SAYRVVSLVGPGGIGKTALALEAARTPPTGLAADRLLVELASLSDPKLVCSVIAGVLGT
FT                   KLEGEEISPESIARAIGPRPLLLILDNCEHVIDAVAQVAELVVSRCPGTFIVATSREAL
FT                   RIEGEHVYRVLPLGVPPEARLEPAGASAYSAVELFTSRAKALGSSFASDEENIGAIAAI
FT                   CRRLDGIPLAIEFAAARAVMLSPPRIAALLDDRFKFLTTGRRTALPRQQTLRATLDWSY
FT                   DLLPDDEAWLLRQLGIFAGEFQLDAVIALAGEHIGDVTGQLARLVAKSLVVADIRRDSP
FT                   HYRLLDTTRAYALEKLHAGGEYPDAARREAKYYCGFFANAEADSEVKPQAEWLTIYGRH
FT                   IDNVRTSLDWAFSSGGDAQVGAALTAAAVPLWVQLSLLSECRERTELALARLDPTAANA
FT                   PRLRMQLSAARGWSLMYGVGRAREAGPAWAATLQLAEQLGDRDYLLRALWGLCIDQFNN
FT                   GEFRRALEFAHRFADAVADSGNPVDRMMADRLLATTLHYLGDQRQAYHHIGRTLSRLSD
FT                   LAAKPQVIRFRFDLRASTHYFQARILWLLGLADQALSVVERNVEEGRTSGHALTFCSVL
FT                   GQGACPIAFLAGDLDAAERYCTMLIEHTERHPIRLWNVWARAFRGVLISRRGDVATGLP
FT                   LLRKALELAGEARFLPRFLLPFGELAVCLGEAGEVLQGLATADEALARCEARDEGWYVA
FT                   ELLRIKGELLLLPGARRSTGGAEQAFDKAFEVARSQGALFWELRTAISVARMRMSEGHP
FT                   ADARDVLASVYGKFTEGFETADLSDARAMMVKLGS"
FT   CDS_pept        complement(300578..300859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0296"
FT                   /note="ORF_ID:bsl0296"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45561"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45561"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XL2"
FT                   /protein_id="BAC45561.1"
FT                   /translation="MRLIPVVCVVACVALSGIASARGDMGSHMSMASGGALGTSAAAPG
FT                   TNSLGTALPSSDSGGRATKGPLLGTDPTIDKDDARLEKMLEGSICRGC"
FT   CDS_pept        301567..302940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0297"
FT                   /note="ORF_ID:blr0297"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45562"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45562"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XL1"
FT                   /protein_id="BAC45562.1"
FT                   /translation="MHAQRPQYASLPGRRGRTTRRRVWYVRNPAAPWRHRLITGRTGYS
FT                   ISGNAWRLGKLVISCAVLAVGSASAEPQYDPGASDTEIRIGNIMPYSGPASAYGIIGKT
FT                   MSAYFRMINDNGGINGRKINFISYDDAYSSSKAVEQARRLVEDDEVLAIFAPFGTASNA
FT                   AIQKYMNHRHVPQLFVITGASHWADPEHFPWTIGWLPSYRTEARIYADYILRHHPGARI
FT                   GILHQNDDFGRDYLLGLKDVLQDKYAQMVVASLPYEVSEPTIDSQVVAIKSAAPDIFID
FT                   IATPKFAAQAIRKLAELDWHPIHIVTNVSVSVGAVLKPAGLDNAKGVLSAGYQMDVTDP
FT                   QWDSHPGMQHFRAFMAKYFPEADRSESGPLVAFNMSSALVEVIRRCGDDLTHERIMQVA
FT                   ADLDFELEAYIPGIRIKTSPTDFHPIEQLQMMRFTGESWEWFGPLLDGRADQATPLPD"
FT   CDS_pept        302903..303538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0298"
FT                   /note="ORF_ID:blr0298"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45563"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45563"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XL0"
FT                   /protein_id="BAC45563.1"
FT                   /translation="MDALTRRRPCPTRTRTSLWDEPSMSEVNAPRRLRAKTKMFVRSTL
FT                   RIRRAHEHVSRAGRGVRRRFLKEMFDDYTEALVGRIRGRSHDCLPRDGSRRQREAYQCR
FT                   GLCVGSARSGLLQARLRPCSRRRCVRNRPLAAAAMRAHLGLLSSRTGSSPVDADWKLIV
FT                   STFRILTSRRKEGRRLTIRPPFLRPVHVSRTHFCSGGLALTILGEVSK"
FT   CDS_pept        303811..306723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0299"
FT                   /product="transcriptional regulator"
FT                   /note="ORF_ID:blr0299"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45564"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45564"
FT                   /db_xref="GOA:Q89XK9"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XK9"
FT                   /protein_id="BAC45564.1"
FT                   /translation="MHGPLMSSPVDRTYSFGHWLIDCQRRELRYNNVAVPIGSRAFEIL
FT                   EKLVGSAGLLVTKDDLIGSVWSGLTVEDNTLQVHISAVRKALGEDRNLLKTVSGRGYTL
FT                   AGTWRSGHLDHPAAAPVTIPADALFSSNLPSIRAPLIGREDSLSELSDVLSAYRAVTLV
FT                   GPGGIGKTKLAIELARSVAPSFNDSVALVELAALQGAALAASATARALRLASNDKEVTP
FT                   ASIAQAIGTRRLLLVLDNCEHVIEAAAQIASAVLHYCPNVTVLATSREGLRIDGEYVAA
FT                   VPALSVPDPDMHAPDLLLRASAVQLFVARTRALRASFVAGAEELQKIAAICRRLDGIPL
FT                   ALEFAAARAANLGVDAVLLRLDKRFELLNGGRRDQLPRHQTLRATLDWSYDLLPPAEQN
FT                   LLCQLAVFPAGFTLDAASAMMDDTLSRSDVIETLFNLVAKSLVSLDPSFEGRWRLLEST
FT                   RAYALEKLADAGLVEQAARRQAVFVRQIIAPLGDASPAPDDISRFAQEIGNVHAALDWA
FT                   FSPGGDTALGIELTSGFVPVWMQLLSFVECSTRIEHALAHFSPGFTCVPKLKAQLYVAL
FT                   GFALLNTTGSADRMKAALSIGLALAEELSDLELQLKAVWTLWSYNLNSGQYAAAKDVGE
FT                   RYLEIALRTGNPANEAVGRRLIGAAAHFFGAQEVARRELTLSLDDSAHGLSGGTNLMWF
FT                   LLNQSVLAKAMLARVLLLQGKIAQSRSLAAECLQDAEREKDKLAIAYALRNAVCPIALM
FT                   THDLAAADQAISSLLELVTREGIAFWTSWTSCLKGQLLVLQGNHDDGIALLRSGLKART
FT                   ENGWLMRNPEFLGSLAEGLLASGEAAQALAAVEEALSISRQGRQLWCLADLLRIKAEIL
FT                   LANGPSELSRSELLFAEGLSVAREQQCSFYELKVAAAWARIMAKSNRQQTALDLVGPVS
FT                   ALFDQEIDLPALTFARALAEIPGISLSTYDGERPPSCTCH"
FT   CDS_pept        complement(307469..308740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ragD"
FT                   /product="RagD protein"
FT                   /note="ORF_ID:bll0300"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45565"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45565"
FT                   /db_xref="GOA:H7C6E1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:H7C6E1"
FT                   /protein_id="BAC45565.1"
FT                   /translation="MSDVRERSDDDEAADRPGAESLRIVELPGKVARSKRRYGGPLLGG
FT                   GVLLLLAGGLGIGGWRHYEAAREVAAVAEQVRTNVPEVRVATVQASGDLMKVTLPATTT
FT                   AFEAANIFARTSGYIEKRYVDIGDRVKKGDLLVEITAPELDQQIAQAQATLAQDQAALQ
FT                   QAQASRELADVTNSRDSNLVKQGWLTAQQGDNDRLTLRAQQGAVGVAQSNIAAQEAQIR
FT                   VLQQEKSYQRVVAPFDGVVTQRNVDNGSLVQAGSTFMFTMMHSNVIRTQVFVPQDEAFG
FT                   VAPGVDSDIRVPEIPGRTFAGKVTRIATALQPGSRTLLTEIDVPNPDGLLSPGIYCTVE
FT                   LSIPRRTPSTTIPSDALVFDQNGLHVAVVRNGTVHFQQVSISRDFGTTVEVRDGVQPGD
FT                   QVVLNPAVNLAEGSKVTVRKSEVS"
FT   CDS_pept        complement(308737..311919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ragC"
FT                   /product="cation efflux protein"
FT                   /note="ORF_ID:bll0301"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45566"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45566"
FT                   /db_xref="GOA:Q89XK8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XK8"
FT                   /protein_id="BAC45566.1"
FT                   /translation="MGIVRFALRLPHTFYVLAALILFLGGIAIRSMPTDIFPEIRIPVV
FT                   TVIWSYTGLSTPEMEQRVSTYSQYSISANVTGIKNIEAQTLNGLSVQKIYFQPDVNLDL
FT                   AISQIVSATNAIRALMPPGIQPPIIVQFNASSVPVLQLSLESNSLNEQQLYDFGIYRVR
FT                   QQLAPVPGVTLPTPAGGKYRQIMVDIDPNKLLSRGLTPLDIVNAVNTQNLTLPTGTTKI
FT                   GDTQYTVRTNATPATIQDLNMIPVKFANGATIFLKDVAQVRDGAQVQQNIVREDGHRAV
FT                   LLSVIKNGNASTLAVVNGVKAALTSIRASAPAGLKINELFDQSIFVTHSVNGVLREGAI
FT                   AAGLTALMILVFLGSWRSTLVVLISIPLAMLSSLVVLYFLGETLNTMTLGGLALAVGIL
FT                   VDDSTVTIENTHRLWTEEGMPLSEATLHGAAEIAIPTLVSTLAISCVFTSVVFLEGPAK
FT                   YLFTPLGLAVVFAMLASYGLSRTLTPITIGLLLKGERRHGEGERSSNIFARASAAFERG
FT                   FEHLRDGYSDLLLTLLRRRVIVPVVAVLVLALGATMFVYVGRDFYPLIDGGQIQLHVRA
FT                   PAGTRIERTEAIFQAVEDKIREVIPKRDRALIVDNIGLPARPYNLAFTDGSTIGVNDGT
FT                   ILVSLKDGHKPTADYIRKLRQVLPSAFPEDTFYFQAADIVTQILNFGLPAQIDVRTVGY
FT                   GSNNLAVAKELQKSLAAIPGVVDAHLQQEVDAPAFYADIDRTRAAQLGLNASTVATNIN
FT                   VSLSSSAQVSPNFWTDPTSGIPYYLAVQTPEYRANSLNSLGNTPVSASLAASGQTVPGL
FT                   LSNVATFKRGTVPTNLNQANVQPVFDVYASVQGRDLGSVASDIDKVTSTLQKQLQPGNS
FT                   IQVLGQIQSMHQSFRDLGIGLLFAAILVYLLMVVNYQNFGDPFVVIMALPATFCGIVTM
FT                   LFVTGTTLNVPSLMGAIMAVGVASANSILLVTFARDEQLKGHSAFQAALSAGRTRIRPV
FT                   LMTAAAMIVGMIPMAIGGPGEEQNAALARAVIGGLLFATPTTLLIVPYLFAMLRKGNDG
FT                   KPRHGVFEEQPE"
FT   CDS_pept        complement(311999..312922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH3"
FT                   /product="RNA polymerase subunit"
FT                   /note="ORF_ID:bll0302"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45567"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45567"
FT                   /db_xref="GOA:H7C6T6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:H7C6T6"
FT                   /protein_id="BAC45567.1"
FT                   /translation="MQTSHEVARSASVAAAGAAVSAPFLSAYSAAIRRYELLEPGQEQQ
FT                   LARRWHETRDRGAADALVTSHLRLAAKLARGYKGYGLPMVDLIAEANLGLVIAASRFEP
FT                   GRGARFSTYAIWWIKAAIHEYILRSWSLVKIGTTAAQKKLFFKLRSEIRKATGSVMSGL
FT                   TPDVAELIAGKLDVTAREVIEMDARLNGDMSLNARVGGEESGTELEALLVDGAVDAETM
FT                   LADHEQTERRAKALRVALGGLAARERHVFEARRLTECPVTLDQLARELSISSERVRQIE
FT                   IRAFAKVKRAVMLAAQDAPRAAVCNV"
FT   CDS_pept        complement(312983..314407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ragB"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="ORF_ID:bll0303"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45568"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45568"
FT                   /db_xref="GOA:H7C6U5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:H7C6U5"
FT                   /protein_id="BAC45568.1"
FT                   /translation="MHQSQLIRSSTFLWALAVAAAFALFVVGLFAFIYWKLDDYLVARS
FT                   DRMITTRIHFIADLPPARRISAIADHLGQDSRGVQYAGLFDAAGTRLAGNIDHLPRELG
FT                   LDGAVQGVRLDLFEKPAAHVPVVRAVGRRLDGGDVLVMGRNVDETREISSVVGQALALG
FT                   LLPAFSLCLLAGAWLSIRAQRRVEEVNQRVQRIVAGELRERLPEGGTDDPFARLAGIVN
FT                   GMLDEMETMINALAGVGNDIAHDLRTPLTRVRLALERGRTHAATLEDLQEITDKAIAGI
FT                   DQSLAIVTALLRLTEIENNRRMAGFGEVALDEILREVCDVYEPIAEDKRIALGVVIERN
FT                   VQVWGDRDLLFEAVANLVDNAVKFTPSGGRVELALEAEDGTALVRVSDTGPGIREQERE
FT                   AVLRRFYRSDKMRNTPGVGLGLSLVAAIVKLHGFRLIVGPAPGGRIEILAWTGRADKAA
FT                   TCRSRTLRHADADLMG"
FT   CDS_pept        complement(314417..315391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ragA"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:bll0304"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45569"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45569"
FT                   /db_xref="GOA:Q89XK7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XK7"
FT                   /protein_id="BAC45569.1"
FT                   /translation="MFDQRSWQRSPEDDHDIGNTHRPCTGAAREARGPHHELQFNGAPC
FT                   DASLSCTAASGRRQAASGPRVRRGRALSMRPRAAEPSLPHRAPKRRAERGTRIMNRILL
FT                   IEDDAETAEAIVAELADRGFEVQWAGDGVDGLDRARTSSPDAMIVDRMLPGMDGLAVIE
FT                   ALRKDQVRTPVLVLSALGAVDDRVRGLRMGGDDYLTKPFAIIELVARIEALLRRPTDSR
FT                   ETILHVGPLEIDLIERTARRGERELELLPREFRLLEYMMRRNDQLLTRAMLLEEVWNYK
FT                   FVPATTNLIDVHMGRLRHKVDGPGEVQLIHNVRGSGFVLRSRL"
FT   CDS_pept        315588..315971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0305"
FT                   /note="ORF_ID:blr0305"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45570"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45570"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XK6"
FT                   /protein_id="BAC45570.1"
FT                   /translation="MTTSKLLSMGLIAAAMLGGPVMAREHHRVVQQPAVEADTVATSAP
FT                   FYPGERACIPAPRVGAFATAPWTGNNVPCEPARAASDCTNAAGRMAPPGASHRMTGSGL
FT                   FDSARSLACVATTRGAFTFARGA"
FT   CDS_pept        316121..316498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0306"
FT                   /note="ORF_ID:blr0306"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45571"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45571"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XK5"
FT                   /protein_id="BAC45571.1"
FT                   /translation="MKRAIMILATAALASTLAIGAADAHGGGGGGGGHGGFGGGGFGGG
FT                   HAGFGGGAHFGSMGHEGGFGGGARFGGEHLGFGGHADGLRQHAFHHFGRYRPGYGFYGA
FT                   YPDCYDWYELHPNQPLPLSCS"
FT   CDS_pept        complement(316855..317811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0307"
FT                   /product="transcriptional regulatory protein"
FT                   /note="ORF_ID:bll0307"
FT                   /note="RpiB family"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45572"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45572"
FT                   /db_xref="GOA:Q89XK4"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XK4"
FT                   /protein_id="BAC45572.1"
FT                   /translation="MPRAKRIHPAKAAGTAVSTPSRRDAFVAGDIISVIRQSAPSLSPS
FT                   EQRVAMALLADVEFAIHASNAELARSARVSEPTVTRFSRSVGCRGVRDLKVRLAQAMAV
FT                   GRIYVELPPHVGTDLARPALWRSVFQEIRRAIAAAEEGLRKEDIERAAEAISRCSKLAA
FT                   FGVGGGSTLAAMEVQNRFFRLGIAVSHTSDPSLMRMIAATLGEEDVVVAISTTGAASEV
FT                   IEAAGIAKQYGALVVAITRPQSRLASIADIALGVHVPEAPDALKPTASRYALLAAIDLL
FT                   AASTAYCKPLEAQTRMRRIKYELLKGTDGNSNGPLGD"
FT   CDS_pept        318039..319595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0308"
FT                   /product="ABC transporter peptide-binding protein"
FT                   /note="ORF_ID:blr0308"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45573"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45573"
FT                   /db_xref="GOA:Q89XK3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XK3"
FT                   /protein_id="BAC45573.1"
FT                   /translation="MGGAIMRCDLSVLMRGAVGIATALFLNAQASAATLLREATIGEPP
FT                   PLDVMLTTADVASVIGRHIFETLYALDSAYTPRPMLAESDREEDGGKTIVIKLREGVPF
FT                   HNGKEMTARDVAASLTRWGNFGARGKLLMAAATSVEATGKYEVTLKLSAPNGAWKNLIA
FT                   DVNGGLAIYPEEIAANAGNRPIEQKDYIGTGPYKFVEWRPNRYVEVEKFDGYKPVKEKG
FT                   DGFAGARIAIFDKIRFIPVPDVGTRVSGVQAGDYDYAEMISGDLYESLSKDQSVQVQRT
FT                   NASIFGLFFMNSKQGILKDNYKLRRAIQTALDKSQALRVAFGSKDLWNAEGSIFPKGTP
FT                   WYSAEGVSGYSPHDPKKAKELAKEADYTGTPIRLLVSTNYQAHYDEASVFTRQLADAGI
FT                   NVQMMVVDWATLLKMRGQPEQWDIFVTHHSFSPDPLLLTFLNASYPGWWDSPEISSLRA
FT                   ELIKSTDPTARKSTWDKIQSLIYDQVPVMKVGDAYTYDIASPKLKGLNPNGPVFWNVST
FT                   K"
FT   CDS_pept        319675..320619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0309"
FT                   /product="peptide ABC transporter permease protein"
FT                   /note="ORF_ID:blr0309"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45574"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45574"
FT                   /db_xref="GOA:Q89XK2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XK2"
FT                   /protein_id="BAC45574.1"
FT                   /translation="MWSYALKRAGTTAVTLLAASVIIFAFIHIVPGDPIYVLLGDTATP
FT                   DQIDALRHQLGLDQPIILQYLTWTGHVLEGNLGRSIFFQAPVLSVIADGAETSALLATM
FT                   TMIWVTLIGVPIGMIAAVRHGTWLDQGLSGAAMLMASIPTFWVGLYLILIFAAWLGWFP
FT                   SSGYPSIFEGGLVNLRYLVLPSLALAAPNAALILRLTRASMLDVAREDYVRTARAKGIR
FT                   PWQVVVRHILRNALLAVVSAFGFTFAALLSEAVVTETVFALPGIGRLVVQSILRRDYPV
FT                   IQGVILVIVVVYLLINLIVDLSYRLLDPRVELQ"
FT   CDS_pept        320616..321476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0310"
FT                   /product="peptide ABC transporter permease protein"
FT                   /note="ORF_ID:blr0310"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45575"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45575"
FT                   /db_xref="GOA:Q89XK1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XK1"
FT                   /protein_id="BAC45575.1"
FT                   /translation="MSRDGATLWLKPFIARPIALVGLGLLLGTVLAATFAPWLAPYDPY
FT                   AIDPSIRLTPPNALHWFGTDQFGRDTLSRVIHSARMALLIGSGVVVFALATGVPVGVLS
FT                   ALFPRLGHLLMRMIDVLMAFPSLLLALGLIVVLGPSVANAILAIGLGYMTTTTRIVYGL
FT                   TLRLRVETYVEASRSMGAGTAWLIGKHILPNLISPLLVQASFVFAFAQLGAASLDFLGL
FT                   GAPPEIPSWGNMLAESRTFITRAPWLLFFPGMMIVATAFSLNLVGDALRDRLDPRFRQV
FT                   FSEKG"
FT   CDS_pept        321480..322454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0311"
FT                   /product="peptide ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:blr0311"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45576"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45576"
FT                   /db_xref="GOA:Q89XK0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XK0"
FT                   /protein_id="BAC45576.1"
FT                   /translation="MLSVRDLTVSLGSETTPVDIVAGVSFELGKGEILGLVGESGCGKS
FT                   MTSLAVMGLLPQPGPRIRAGRVLLEGCDVTQLQPWQRVEAGHGRMAMIFQEPMTSLNPV
FT                   RRIGDQIAEAVRVHDRSSGPPAIARARELLELVRMPDPAMQLSAYPHQLSGGQRQRVMI
FT                   AIALACRPQVLIADEPTTALDVTIQVQVLGLLRELCNRLDMAMLFITHDMGVIAQLADR
FT                   VSVMYAGRIVETAGVEALFGRPRHHYTRGLMDCMPSRNSGARRLPTIAGQPPAPGTVGA
FT                   GCVFASRCAAVRESCRTAAPPRAEVSRGHEVLCAFPLDGGESR"
FT   CDS_pept        322451..323407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0312"
FT                   /product="peptide ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:blr0312"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45577"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45577"
FT                   /db_xref="GOA:Q89XJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XJ9"
FT                   /protein_id="BAC45577.1"
FT                   /translation="MNGNAVLDIRDLRVSFSVRRAGRKYQVRAVDGVSLSLAEGEVLGI
FT                   VGESGCGKTTLGRSIVGLARPDSGTISFKGTDMTGASLRNMRLNIRMVFQDPYASLNPR
FT                   RSIGDSVAEAGDINGFFTSRAERSAAIATTLTAVGLDPSFAARYPYELSGGQRQRAGIA
FT                   RTILPSPSIVIADEPVSALDVSVQAQVLNLMMDLREQLRLSMLFISHDLGVIGQISNRV
FT                   AVMYMGRIVEQAATRTVLDDPRHPYTRSLVAAIPKPDPSKRILGAIETGEPPSLFKRPS
FT                   GCAYAPRCPIASHRCLVDVPELRSAGADGRAIACHNA"
FT   CDS_pept        complement(323507..324601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0313"
FT                   /note="ORF_ID:bll0313"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45578"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45578"
FT                   /db_xref="GOA:Q89XJ8"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XJ8"
FT                   /protein_id="BAC45578.1"
FT                   /translation="MRAPLGLENPEQHAFFGAWDLERERRDRPGRALLFLPKSPLTQEL
FT                   DRIDATLSTERVFALDQARQLFREDLVMPLLRTSLLMSEPAGTLESLDELFALANAMEE
FT                   EAAKRYSALAEEMRRQNKDALAEVFANLAAAEREHVDSVARWSQSRRGKAPDPALVRWE
FT                   APETFDAETAREIETSRLTTPYRALAMAVRNEERAFAFWSYVAAYSRDLEIKQAAEAMA
FT                   REELGHISTLRKERRRAYHKEHEQTERRGRDDSAVMQIDARALELRLAAQLADLERGLA
FT                   GAAAVRTRELVEETMQMSEKAEGIGKFPVSLEQRDAETISEALADGYLESAESAGDQTQ
FT                   VVLLQELAEGAIARLAWLRSLTVA"
FT   CDS_pept        324547..326886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosR"
FT                   /product="nitrous oxide reductase expression regulator"
FT                   /note="ORF_ID:blr0314"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45579"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45579"
FT                   /db_xref="GOA:Q89XJ7"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR011399"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XJ7"
FT                   /protein_id="BAC45579.1"
FT                   /translation="MLQRTHVVPDFLTQAARALFALAFLCVLSSFNTASAADLNGYLSK
FT                   IAPADFFAGADRFGPPQGEPPIIPAYRGDQLQGFVYLNSDFANAVGYSGKPIQMLVGID
FT                   PKGVLTGLKLVEHKEPIVLVGIPEKRILEAVNKLIGADLGSVARGAAPAPQVDIVSGAT
FT                   VTVLVIGDSIVRSATKLIRSGRLGAQGSPVAAAGPRAAKAIDAAKSEVRDWQTLVGDGS
FT                   VRRLTLSVADINQAFEKSGNAVAAARPEEGAPDDSFIDLYVADVAVPTIGRSLLGDESY
FT                   GRLAGRLKPGQQALVVAGAGRYSFKGAAYVRGGIFDRIELIQETNSIRFRDRDHTRLGS
FT                   LAADGAPDFPEIALFIVPADFAFDATEPWALQLLVQRVVGARDKAWVTFDLGYTLPETY
FT                   LKREAPVRPAAAAAAPTAKSSPAAAPEARVPTTDEDPLWMRIWRADALKIGTAMLALGA
FT                   LTLIFFFQNFLVRRPAVYTWVRRFYLLFILVWLGWYANAQLSVVNVLTFTNSLLTGFSW
FT                   EYFLSAPLIFLLWASIAAGLLFWGRGPFCGWLCPFGALQELLNNAAKALKVPQYRVPWG
FT                   LHERLWPIKYIIFLGLFGMSLYSTAFAEQLAEVEPFKTSIVLKFAREWPFVVYALTLLA
FT                   AGLFVERFFCRYMCPLGAALAIPGRIRMFEWLRRWPECGSPCQRCANECPVQAIHPEGH
FT                   INVNECIYCMHCQELYFDDHRCPHMIQVRLKREKRMAMSSPSMRSGGKGPNTIITAGGK
FT                   PVGASPVDAITPSATCNLNRKPRRQS"
FT   CDS_pept        326883..328835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosZ"
FT                   /product="nitrous oxide reductase"
FT                   /note="ORF_ID:blr0315"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45580"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45580"
FT                   /db_xref="GOA:Q89XJ6"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR023644"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XJ6"
FT                   /protein_id="BAC45580.1"
FT                   /translation="MSDSDNIKGVSRRTLLGTTAAAAGVGLAGGAVVTKDGAGFVSTAD
FT                   AQTKSAAPKAPPARPAVQKTEVAPGELDEYYVFFSSGQSGEMRIIGLPSMRELMRVPVF
FT                   NRCSATGWGQTNESLKVLTEGMQPATREFLKNRGGTFMNGDLHHPHVSFTDGTYDGRYA
FT                   FMNDKANSRVARVRLDVMKCDKIIELPNQHTVHGLRLQKYPRTGYVFCNGEDGVPLPND
FT                   GKVLDNPKEYHSIFTALDGDTMKVAWQVMVSGNLDNVDSDYQGKYCFSTCYNAEEGVTL
FT                   AEMTANEQDWVVIFNLKRIEEAVKKGDFKEMNGVPVIDGRKGSPYTRYVPVSNNPHGMN
FT                   TAPDGIHIVAAGKLSPTVTVMDVRLFDQLFDDKIKPRDVVVAEPELGLGPLHTAYDGKG
FT                   NAYTTLFLDSQVVKWNIDLAKRAFKGEKVDPIIQKLDVHYQPGHNHSSMGQTKEADGKW
FT                   LISLNKFSKDRFLNVGPLKPENDQLIDISGDQMKLVHDGPSFAEPHDATIVHRSKINPI
FT                   SIWDRADPMFADAVKQAKADGINLEADSKIIRDGNKVRVYMTSTAPAFGLEQFQVKQGD
FT                   QVTVYITNIDAVEDLTHGFCIVNYGIQMEVAPMATASVSFSADKAGVYWYYCSWFCHAM
FT                   HMEMKGRMFVEPKSV"
FT   CDS_pept        328850..330211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosD"
FT                   /product="periplasmic copper-binding precursor"
FT                   /note="ORF_ID:blr0316"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45581"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45581"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR026464"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XJ5"
FT                   /protein_id="BAC45581.1"
FT                   /translation="MRLPSRMLPAALVAAGLSGFASAETLTAVPGQPLQALLDRARDGD
FT                   VVELAPGDYNGSIRIDRPLALTGRPGAVLDGGGSGNVVTVTAPDVTVRGVTIRGSGRDL
FT                   QAMNSGVFLQKTAERATIENNRLVGNLFGVYVHGATGSRVANNLIEGLRGHRLSEAGNG
FT                   VSLWNAPEVTIADNTFRYGRDGIFTISSRKDRFVGNRFEQVRFAVHYMYTNDSEVSGNV
FT                   SIGNHVGYAIMYSNRLIIRDNISDRDRDHGLLFNYANYAEIDGNRVTGGLLDTVSAGSE
FT                   EGPDDERGMIPDTKREQSLRSGPEKCVFIYNTNHNRFRNNWFERCAIGVHFTAGSEGNE
FT                   ITGNAFVGNRNQVKYVGTRNLDWSKGGRGNYWSDNPAFDLDGDGIADTAYRPNDLVDRV
FT                   LWTAPSAKVLINSPAVQVLRWAQAQFPALYPGGVIDSHPLIAPPPRPSGKEGGR"
FT   CDS_pept        330208..331116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosF"
FT                   /product="copper ABC transporter"
FT                   /note="ORF_ID:blr0317"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45582"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45582"
FT                   /db_xref="GOA:H7C7Y2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:H7C7Y2"
FT                   /protein_id="BAC45582.1"
FT                   /translation="MSATVSVTGVVKNYRTVRALRDVSFDLAPGRLSALVGHNGAGKTT
FT                   LIKLMLGLIRPDQGSIRVLDEDPAAGEFSARRQLGYLPENVAFNAALTGRETLTFYARL
FT                   KHVKPSKAWAFLDRVGLTDAADRRVGTYSKGMRQRLGLAQALLGRPRVLLLDEPTTGLD
FT                   PALRQTFYEILNELRDDGATVLISSHALNELEDRAEHVLIMNRGLLAAQGTLSELRSIS
FT                   QLPIRVSVDFAPGAGVPAAWVNGASVATPRGRMLLVPDEARKMDVLRAAASDPGVINIE
FT                   IAAPTLDELYAHFLNSQESAA"
FT   CDS_pept        331113..331940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosY"
FT                   /product="nitrous oxide metabolic protein"
FT                   /note="ORF_ID:blr0318"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45583"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45583"
FT                   /db_xref="GOA:H7C6F5"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:H7C6F5"
FT                   /protein_id="BAC45583.1"
FT                   /translation="MRTIVIIAAKEIQEGLRNRWVLATTLLLAALALSLTFLGSAPTGN
FT                   VGAGALDVVVVSLSSLTIFLLPLIALLISHDAVVGEMERGTMTLLLSYPVGRGQVILGK
FT                   FCGHVLILAFATVIGYGAAAAALATTGASVLAASWYAFASMLGTSVMLGAVFVAVGYLI
FT                   SSLVRDRGTAAGISVGVWLLMVLVFDMALLGVLVVDQGNIVSAPVLEALLFLNPTDLYR
FT                   MTNLTGFNVSQFSGMAGLAGTATTSVGALLTGLTAWVVAPLGLAAAFFARREL"
FT   CDS_pept        331937..332485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosL"
FT                   /product="NosL protein"
FT                   /note="ORF_ID:blr0319"
FT                   /note="protein required for nitrous oxide reduction"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45584"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45584"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:H7C803"
FT                   /protein_id="BAC45584.1"
FT                   /translation="MILRILCMIVALVLAGCNRDGSDAVMPPPAALNSDAMGVFCGMNV
FT                   LEHPGPKGQIITASRIDPYWFTSVRDTVAFTLMPDQPRDIRAIYVSDMARAPSWEEPGA
FT                   TNWIDAKKAFFVIESRKQGGMGAAEAVPFGNRAAADAFTAANGGKVVTFADVPSGYVLG
FT                   SDSAAVDQTGHERPSARTN"
FT   CDS_pept        332497..333495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosX"
FT                   /product="NosX protein"
FT                   /note="ORF_ID:blr0320"
FT                   /note="protein required for nitrous oxide reduction"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45585"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45585"
FT                   /db_xref="GOA:Q89XJ4"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XJ4"
FT                   /protein_id="BAC45585.1"
FT                   /translation="MAPANLTRRRMITIAAATAGSAFLSGGGHASSTGAVRWRGSALGA
FT                   QVSIDIFHPDREEAERIIQDCLTEVRRLEGQFSLYRADSAICALNRSGILVAPEPDMVA
FT                   LLKASLQFSDLTGGTFDPTVQPLWQLYAAHFSSENPDPGGPPAGKLAEALAKVGSSGLR
FT                   VSEKLVALLRHGAAITLNGIAQGYATDRVVDVLRARGLSTTLVNMGEIRALGARADGTP
FT                   WRVGLSDPDRAGALTETIDLIDRAVATTAGAGFRFDPAGRFTHLFDPRTGRSPALYRTV
FT                   SVIAPTATEADALSTAFSLMPASQIGDIAATRPDVQVRLITNDGNLRLYGA"
FT   tRNA            complement(333518..333607)
FT                   /product="trnS-GGA"
FT   CDS_pept        333780..334145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0321"
FT                   /note="ORF_ID:blr0321"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45586"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45586"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XJ3"
FT                   /protein_id="BAC45586.1"
FT                   /translation="MPNTTGGAMTIRKTIAALGLISALGSAFAGPALAQVCTRQGVDVS
FT                   CDDGRRGVLSGDAIIWPDGTRSSSSPHPSVIIGNKSSVHVGPGVFVGQGKGMVPLDDPN
FT                   APNKRQCAILDGVSYCY"
FT   CDS_pept        complement(334204..335688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsA"
FT                   /note="ORF_ID:bll0322"
FT                   /note="probable trehalose-6-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45587"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45587"
FT                   /db_xref="GOA:Q89XJ2"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XJ2"
FT                   /protein_id="BAC45587.1"
FT                   /translation="MNRRGRPVNLVVVSNRVARGKPNEPMTGGLAAALLPVVEHSGAIW
FT                   VGSSGRVRDGHQKEPFAEIEALGSGAIATLDLPAAHYGGYYEGFANSALWPALHSRSDL
FT                   IRVSREDYVSYREVNAFMARALMRFRKPRTAFWVQDYHFLALGAELRDLGVDDPIGFFL
FT                   HTPWPVAAVTQGVPNHRELITAMLAYDLIGFQTEEDRQNFLGYVAGELGLVIDDGVVLS
FT                   QHGRTRCEVFPIGIDAEKFAQYAAKSASHPDVSRLRRSLNGERLAIGVDRLDYSKGLVN
FT                   RISAFDRLWTEQPQFLRSISLLQIANPSRGAIEAYGNLQNEVARLVTDVNGRHGEVDWT
FT                   PIRYLNKGFSQAVLAGLYRTAQIGVVTPLHDGMNLVAKEYVAAQNPADPGVLVLSKFAG
FT                   AANELDTALLVNPHDIDAMARAIAIAAAMPLTERKMRWDAMMKKLRGHTIQQWSADFVA
FT                   ELEKCRIEKAAVAPLAAQPPQALRWLKSAISGVRLI"
FT   CDS_pept        complement(335900..336721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsB"
FT                   /note="ORF_ID:bll0323"
FT                   /note="probable trehalose-phosphatase (EC 3.1.3.12)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45588"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45588"
FT                   /db_xref="GOA:Q89XJ1"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XJ1"
FT                   /protein_id="BAC45588.1"
FT                   /translation="MKSELAEMAVDQKRTMPVDDDVPETVPVPHALVPHLDETAILLDI
FT                   DGTLLDLMPTPREVWVPPGLSETLKRLVERTSGALALVSGRSLNDIDLIFAPDVYRAVA
FT                   GHGAEMRLSVDNEVDDVHAPPLDKELKRRLAAIAKLSPGILLEDKGYSLALHYRLAPHA
FT                   EKAIFEAVSLIRADLPNAPIEVLPGKFVCEIKHSGFTKATGVHELMKHEPFRGRRPLFI
FT                   GDDVTDETVFAIMPDMNGLAFSVGRRAMGVNGHFDAPSDVRAFLARLLDPR"
FT   CDS_pept        complement(336725..338278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0324"
FT                   /note="ORF_ID:bll0324"
FT                   /note="putative sugar transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45589"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45589"
FT                   /db_xref="GOA:Q89XJ0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XJ0"
FT                   /protein_id="BAC45589.1"
FT                   /translation="MIGSPLATSCEPGSLPLVRPSNAMELQQSQALNYGPAVSAVATDR
FT                   IIETSIPSRLDALPWSGFHTRVVLALGITWILDGLEVTLAGALSGALKQSPSLQFSNLD
FT                   LGIANSAYLAGAVLGALGFGWLTDRIGRKKLFFITLALYLSATAATALSWDIASYALFR
FT                   FLTGAGIGGEYTAINSTIQELVPARYRGWTDLVINGSFWIGAAMGAVAAIVLLDPALIG
FT                   PDLGWRLAYLIGASIGLVVLLMRMWIPESPRWLMIHGRPDQAHAIVDEIERSVIGHDQD
FT                   ASDRRFTRIRLKMRDHTPIREVMHTLFTVYRQRALVGLVLMGAQAFFYNAIFFTFALVL
FT                   TDFYGISADHVGWYLLPFAAGNFLGPLLLGRLFDTLGRRAMIMFTYGASGLLLALSGYL
FT                   FSIGALSAQGQTIAWMVIFFFASPAASAAYLTVSETFPLEVRALAIAVFYAVGTGIGGV
FT                   IGPALFGALIDTGSRTSVFAGYLLGAFLMIAAAIVAWRYAVSAERKSLEQIARPLAFME
FT                   "
FT   CDS_pept        338392..338751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0325"
FT                   /note="ORF_ID:blr0325"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45590"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45590"
FT                   /db_xref="InterPro:IPR021513"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XI9"
FT                   /protein_id="BAC45590.1"
FT                   /translation="MAHVRKTTHSRKTAARSRKTSVRKSAKRATPKRWSQRVTKESDAL
FT                   DLKRGVFTLTSPKKIAASLKRSAEHSSRRKTGAYRSALSMLTFYINRAGKTLPKTQRAR
FT                   LEQAKVELKRAFGRE"
FT   CDS_pept        complement(338948..341053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0326"
FT                   /note="ORF_ID:bll0326"
FT                   /note="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45591"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45591"
FT                   /db_xref="GOA:Q89XI8"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XI8"
FT                   /protein_id="BAC45591.1"
FT                   /translation="MHTSREAGCFRAAPGFPRMEWGGGMSVKSKPNTSKLPTLRFRAKI
FT                   ILGFVAVLAILAVSMAFAYFGFERIQAAVASYRTSVAEADLARTVDRELIAYQGLARAY
FT                   TLTGATDDETAAKAAEENLKAAIAKSTSATTGAARREQVGKLEAEFQRFTKVFGEIITL
FT                   TRENNKIAADELNSVGNKIRFKFDDLADTAALAGLASVQTTAKDVTSQYLAVSTSVGAF
FT                   VAKPEPKTADGVIARIKFLETLLVSIYANDQKITDRVTEISNLLKQYRTSFAKLTENVK
FT                   VIVKSNGEMTKTAASILKLSSELRSDLTADQQRIEASANATIGETERLMLMLALGGLAI
FT                   GAVLALMLGNGISRPMIAMCKAMRELASGNFDVVLPGLGRKDEIGEMAGAVEEFKVQAV
FT                   AKAERDAAASEAQSREQAASRRSELIRFADDFENAVGAIVSNVSASAVQLESAASTLTR
FT                   TAETTQSLSSQVAGVSEQASSNMQSVATATEELSASVEEIGRQVRDSSRIAEAAVVQAK
FT                   ETDGRIGKLSHAAQQIGEVVKLITAIAEQTNLLALNATIEAARAGEAGRGFAVVASEVK
FT                   SLASQTAKATDEISSHITGMQGATAESVAAIKEIGATIGQISSISTSIASAVEQQGAAT
FT                   QEIARSVQTVAQGTQTAATDIGEVNRGAAETGSASEEVLNSAKTLSSESTRLRAELDRF
FT                   MGNIRAA"
FT   CDS_pept        complement(341337..343619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0327"
FT                   /note="ORF_ID:bll0327"
FT                   /note="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45592"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45592"
FT                   /db_xref="GOA:Q89XI7"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XI7"
FT                   /protein_id="BAC45592.1"
FT                   /translation="MPDKCPTSLQRIRRFPVSRNTAPHGLVRLVAREGPETLSTRGAGR
FT                   TDLPPLDVSALIFRTRSERAASGPRDRCKNIRLGVGMSGRIASPSKRTIFPTLRFRAKI
FT                   ILGFAAVLVISAGSMAFAYFGFERVSSGVGSYRTSVSEADLARNIDRELLAYRSSARYF
FT                   VVTGKEDDAKAALEAEASLKNAIDQAIKGAKRPARQESLNKLAKEFSNFSATFAKILQA
FT                   KRDSALLVQNQLQRNANLLKYKLDDIGNNASDAEAQAIEFGTKQVNAQFQTASSAASNF
FT                   ILNSDQAVATSALARLKFVENSLGAVYSMDDKIVAGLKDAKVLLAAYRDALEKLIANAK
FT                   MVDELVTEMSGSAGAILQGATAMKADLVAEQQRLDTESEATIGQTEQLVLMLAVGGTLL
FT                   GAILAFLLGTGISRPMIAMCKAMRELASGNFDVVLPGLGRKDEIGEMAGAVEEFKVQAV
FT                   AKAERDAAASEAQNKELATARRSELIRFADDFESAVGAIVSNVSASAVQLESAASTLTR
FT                   TAETTQSLSSQVAGVSEQASSNMQSVATATEELSASVEEIGRQVRDSSRIAEAAVVQAK
FT                   ETDGRIGKLSHAAQQIGEVVKLITAIAEQTNLLALNATIEAARAGEAGRGFAVVASEVK
FT                   SLASQTAKATDEISSHITGMQGATAESVAAIKEIGATIGQISSISTSIASAVEQQGAAT
FT                   QEIARSVQTVAQGTHAAATDIGQVNRGAAETGSASEEVLNSAKTLSSESTRLRAELDRF
FT                   MANIRAA"
FT   CDS_pept        343660..344826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0328"
FT                   /note="ORF_ID:blr0328"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45593"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45593"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XI6"
FT                   /protein_id="BAC45593.1"
FT                   /translation="MGQTDFRFGGASGVAVAKSKAASVDEAVAELAAQLPSDELALILV
FT                   FLSPSYDPHHFIAEITRQFDETQVCGCTTAGELAPDGWDENSVVALAFSRADFSAAVRP
FT                   ILNLDSFRVEDGRRIGGELRHELLRITPQVDRGNPFGLVLIDGLCRREEAVMSAIYASL
FT                   DDIPVVGGSAGDGMRFEKTWVFCDGKAHTNAALLILLNTSLPFRAFKCDNFEPSPQKMV
FT                   VTEADIENRTVRELNAEPAAEEYSRMVGILDAKLDPFSFASHPVLVRVGGAYYARSIQR
FT                   VEPDGSLHFFCAIDEGMVLTAATSRSLVGSTRDTFAEIRDQIGDVSLYIGFECLLRRLD
FT                   AEQHQLARDMSDLYRQNRVVGFHTYGEQFGSMHVNQTFTGVAIGRRPS"
FT   CDS_pept        344823..346181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0329"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /note="ORF_ID:blr0329"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45594"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45594"
FT                   /db_xref="GOA:Q89XI5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XI5"
FT                   /protein_id="BAC45594.1"
FT                   /translation="MTDILQGPDAVDQLRREAVKLKKINAALMSRVERSMDQQLNAFSL
FT                   FETAIALDHKVRDRTHQLREALHSVERANEGLYRAKQQAEAASSLKSSVLISVTHDLLQ
FT                   PLNAARLTLSALTEMMESQEAGLLIDQADRSLLMLEDLLRSLLEIAKLDAGALKPDVRA
FT                   IALAPLFEQLRNEFEPVAARQGLSLRIRTSPRAVRSDAMMLRRILQNLLANAIRYTRNG
FT                   GVVMGCRLRGDHICIQVSDTGPGIAQAQQQAIFREFQRGEATATDQAGFGLGLSIVRRF
FT                   ATVLGHEVRLSSQVGRGSTFTLELEPADLAEVSDEVHEVKLAERRYSGLEGAKILLIEN
FT                   DPNGSEAMAALLEGWGCDVATTRSAADALLRLSELGGAPDAVIADLHLDHGESGLSAIA
FT                   DVRQHLKLDTPAMIITADYSEKAAKDASRHGLEVLKKPIKPAEMRALLSFLLS"
FT   CDS_pept        complement(346365..347063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0330"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:bll0330"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45595"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45595"
FT                   /db_xref="GOA:Q89XI4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XI4"
FT                   /protein_id="BAC45595.1"
FT                   /translation="MMRFLIVEDHPLFREALEGALRMVAPAADILQATSIDGALEQVAA
FT                   TTELDLILLDLSMPGTTGLSGIIRIRKAFPKIPVVIVSGYQDRQIISGALSLGVSGYIL
FT                   KSSSKQDLAQSIGEVLRGAVCVPAAYRGQVRPQRAAGPAQDLLKRLHELTPQQLRVLEM
FT                   LKRGLQNKQIAFELKISETTVKVHVSDILRKLNVISRTKAIVEMSRIDFATLAGGGTAA
FT                   ERERPRPDQQ"
FT   CDS_pept        complement(347185..347868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0331"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:bll0331"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45596"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45596"
FT                   /db_xref="GOA:Q89XI3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XI3"
FT                   /protein_id="BAC45596.1"
FT                   /translation="MTSFLIIDDHPLFREALGNAVRLALPEARIFEAMSIGDALHILSA
FT                   GEGIDLALLDLSLPDATGFSGFLRLREAYPRLPVAIVSSEEDQHVVREALALGAAGYLP
FT                   KSTSKRELAQSIEGVLSGSVSVPKDFVATPRRRADASKALEVKLRELTPQQLRVLDLLR
FT                   RGYPNRQIAQELQLAESTVKAHITEILRKLGLFSRNKAIIEIGKMELPDPRSRPHARVD
FT                   RGRPQ"
FT   CDS_pept        complement(348007..349314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0332"
FT                   /note="ORF_ID:bll0332"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45597"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45597"
FT                   /db_xref="GOA:Q89XI2"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XI2"
FT                   /protein_id="BAC45597.1"
FT                   /translation="MTTRARIPAGYARAFSRLWLRHRPMPGAAALGSTSSGSTKLWETR
FT                   MRPNHSGIGASRNRAIAGLLTCAALIVPVSLRADEAQPLRLCADPTNLPFSSDSPSQPG
FT                   FYVEIGQALAQALGRPIAYDWYKSYFGKRTVRVTLLGKQCDAMIGLPRSEDFMGPAVIF
FT                   SNAFAKQGYALVAAKGQALDGIDGLKGKRVAVQFASTPQNLLASRDDIQKVTVLSPEQG
FT                   MQALDQGKADVAFIWGPVAGWLNKTSYGDRYQIQLTEGEGLSWDAAIGFAKTSTELRDR
FT                   VDAVLPQLQGTIGALAVKYGLPTGQPARFGATQAMPAGTTTGTGPGVTQTANVVATETK
FT                   GDAAAPAAEAVGSGKEIFNGTCAHCHGPDAIQSERKIDLRLLRHRYGDEMREKFWTTVH
FT                   EGRPTKGMPAWKEVFTDEQFDHIFSFLLTVQSESND"
FT   CDS_pept        complement(349311..351059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0333"
FT                   /note="ORF_ID:bll0333"
FT                   /note="probable alcohol dehydrogenase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45598"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45598"
FT                   /db_xref="GOA:Q89XI1"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XI1"
FT                   /protein_id="BAC45598.1"
FT                   /translation="MACTTTSWREYMTFGTKGFLAGISMVAMLATATSGVRANDSLLKA
FT                   QSDSSQWAVAGHDYGNTRFSPLKQINTENAGKLTLAYSFSLASLRSNESSPIVVGNTLY
FT                   VSSSWGPKYVYALDAATGVRKWTYEPDIPEDVLQYACCDVNNRGVSYADGKIFVGRLDG
FT                   KLTALDAATGKALWTAKVVDYKQGSVITSPPLVVRDKVITGFGGGEYGVRGSLQAFDIN
FT                   TGKQLWQTYTVPSPDEPGGDTWKGDSAQHGGGAAWLVGSYDPKTDTVYWGTSNPGPWNT
FT                   AVRSTGDGNFGKLTNLYTASTVAFDPNTGKIKWHIQTTPADAWDYDGVNEAVLADLKIG
FT                   GSTVPALMKADRNGYFFVANRETGKVLSAEKYVFSNWAKKWDIATMRAVEDPDKRPGPN
FT                   HPAKDICPNLIGGKNWQPMSFNPQTGLVYIPSNNVCMDWSVSDVAYKRGVFYLGAEFPT
FT                   KEGPGGFLGELVAWDPVAQKKVWSIKEDLPFNGGTLTTGGGLVFAGNIHGDFRAIDAKS
FT                   GKVLWSRNLGSGIGAGPVTYQVDGKQYVAIVVGRTAALPAFLGEVGKKMTAAAPEGGSL
FT                   FVFSVQ"
FT   CDS_pept        complement(351433..351918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0334"
FT                   /note="ORF_ID:bll0334"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45599"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45599"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XI0"
FT                   /protein_id="BAC45599.1"
FT                   /translation="MPYKQRSKGVEAMQMNDSQRIPASKANVWAALNDPDILRRCIPGC
FT                   QSLEMASPTEMIATVVLKVGPVKATFSGKVTLTDIDAPNGYRIVGEGAGGVAGFAKGGA
FT                   KVRLEEESPGVTVLHYEADAQIGGKLAQLGSRLIDSTSRKLAANFFESFAAVVAPSS"
FT   CDS_pept        352151..352960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0335"
FT                   /note="ORF_ID:blr0335"
FT                   /note="putative carbon monoxide dehydrogenase small chain"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45600"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45600"
FT                   /db_xref="GOA:Q89XH9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XH9"
FT                   /protein_id="BAC45600.1"
FT                   /translation="MGACSYSQQRTRHQREKRRAKGADIQGQRLAPAAEPSRHRRSGDR
FT                   FRKLPARSRHALAAARNIVAESLTCDNRHDDLSMTRSPQNPSCKVPFALSLIGITTNIR
FT                   EDFTVSTVKLTVNGKAVAVDVEDRTLLVHLLRDHLNLTGTHVGCDTSQCGACVVHMDGR
FT                   AVKSCTMLAGQADGASVTTIEGIAKGDELHPMQAAFRDNHGLQCGYCTPGMIMSAIDIV
FT                   HRHGGELDEATVRQELEGNICRCTGYHNIVKAVLDAAGRMKVAQAAE"
FT   CDS_pept        353045..355387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0336"
FT                   /product="carbon monoxide dehydrogenase large chain"
FT                   /note="ORF_ID:blr0336"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45601"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45601"
FT                   /db_xref="GOA:Q89XH8"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XH8"
FT                   /protein_id="BAC45601.1"
FT                   /translation="MGVEGIGARVVRKEDKRFITGKGRYVDDIKLVGMTHAHFIRSPHA
FT                   HAKVKKIDSSAALKMPGVVAVLTGQQIVDDKVGNLICGWAITSKDGSPMKMGAWPAMAP
FT                   ETVRFVGQAVAVVIADSKNLARDAAEAVVVDYEELPAVADVHAAIKAGAPQLHPEAPGN
FT                   QVYDWVIGDEGATDAAFAKAANVVKLDVTNNRLAPNAMEPRAAIADYDAAEEHFTLYTT
FT                   SQNPHVARLVLSAFYNIAPEHKLRVIAPDVGGGFGSKIFIYPEEMVALWASKKVGRPVK
FT                   WTGDRTEAFLTDAHGRDHVTHAEMAFDASNKITGLKVKTYANFGAYMSLFSSSVPTYLY
FT                   ATLLSGQYNIPAIHAEVIGVYTNTTPVDAYRGAGRPEASYLIERLMETAARQLKVDPAA
FT                   LRRTNFITQFPHQTPVIMAYDTGDFNASLDAAMKAIDYAGFAARKAKAKADGKLRGIGV
FT                   SCYIEACGIAPSKAVGSLGAGVGLWESAEVRVNPVGTIEILTGSHSHGQGHETTFCQLV
FT                   AERLGVPISQVSIVHGDTDKVQFGMGTYGSRSAAVGLTAILKAMEKMESKAKKIAAHAL
FT                   EASEADIVIENGEFKVTGTDKAIAFPMVALAAYTAHNLPDGMEPGLKESAFYDPTNFTF
FT                   PAGTYICELEVDPGTGKTSFVNFVAADDFGRLINPMIVEGQVHGGLVQGIGQALLEHAI
FT                   YDANGQPVTASFMDYAMPRADDVPSFNLSHTTTLCPGNPLGIKGCGEAGAIGASAAVIN
FT                   AITDAIGKNNLEMPATPDRVWRTIHAA"
FT   CDS_pept        355527..356327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0337"
FT                   /note="ORF_ID:blr0337"
FT                   /note="putative carbon monoxide dehydrogenase medium chain
FT                   (EC 1.2.99.2)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45602"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45602"
FT                   /db_xref="GOA:Q89XH7"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XH7"
FT                   /protein_id="BAC45602.1"
FT                   /translation="MYQTTYHRASSVDEAASLFGKSSEAKFLSGGQTLLPVMKQRLASP
FT                   SDVIDLGKIKDMIGIEAAGDTLTIKAATPHYDVATSDAAKKAIPALAYLASLIGDPAVR
FT                   YRGTIGGSLANNDPAADYPAATLALGATVKTNKRSISAEDFFKGLFTTALEDGEIITAV
FT                   SFPVPGKAGYAKFPHPASRFALTGVFVAQTKSGDVRVAATGASQSGVVRIPAIEAALKA
FT                   NWSPSAIDSVTISASGLLSDIHGTSEYRANLIKVMAQRAVAAAG"
FT   CDS_pept        356479..357645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="AMACR"
FT                   /product="Alpha-methylacyl-CoA racemase"
FT                   /EC_number="5.1.99.4"
FT                   /note="ORF_ID:blr0338"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45603"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45603"
FT                   /db_xref="GOA:Q89XH6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XH6"
FT                   /protein_id="BAC45603.1"
FT                   /translation="MRRLPDHRHLPATRGNNNVLDKSAPTSSVRASGPLSGFRIVEFAG
FT                   IGPGPFACMMLADMGADVVTLDRVGAKKSMKSVAGRGRKVIELDLKDKAAIAQVLDLLA
FT                   SADALVEGFRPGVMERLGLGPEMVLARNPKLVYGRMTGWGQEGPLANAAGHDINYISIT
FT                   GALAAIGPKEAPVPPLNLVGDFGGGALYLVVGVLAALLEASRSGKGQVVDAAMCDGAAS
FT                   LMSFFFDMTTIGRWTEGRNQNFLDGGAHFYGVYECACGHFVSIGSIEPQFYALLRQHAG
FT                   LTDADFDAQMDRKAWPALKEKLKAVFKSKTREDWCKIMEGTDICFAPVLTMSEATQHPH
FT                   MVARQVFVERHGVKQPAPAPRFSRTPSAVREPEGAEIAAVTKAWQAAK"
FT   CDS_pept        complement(357890..359008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0339"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="ORF_ID:bll0339"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45604"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45604"
FT                   /db_xref="GOA:Q89XH5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XH5"
FT                   /protein_id="BAC45604.1"
FT                   /translation="MGPFPHDAPPATISADNPMGTDGFEFVEYAHPNPEQLHALFKLMG
FT                   YVPVARHKTKAITVYRQGDINYLVNEEPGTHGYDFVAAHGPCAPSMAFRVVDAKAAYDR
FT                   AIALGAEPANVSSAQKALDVPAIKGIGGSLLYFVDRYGAKGSAYDSEYEWLGARDPKPV
FT                   GAGLFYLDHLTHNVHRGRMDVWTGFYERLFNFRQIRFFDIEGRASGLFSRALTSPDGKI
FT                   RIPINEDAGDSGQIEEYLKIYRGEGIQHIACGCRDIHQTIEGLREAGLPFMPSPPETYF
FT                   ERIDARLPKHGEDIARLQKNGILIDGEGVVDGGQTKVLLQIFSANAIGPIFFEFIQRKG
FT                   DDGFGEGNFKALFESIEEDQIRRGVLKVDDAA"
FT   CDS_pept        359106..359609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0340"
FT                   /product="transcriptional regulatory protein"
FT                   /note="AsnC family"
FT                   /note="ORF_ID:blr0340"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45605"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45605"
FT                   /db_xref="GOA:Q89XH4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XH4"
FT                   /protein_id="BAC45605.1"
FT                   /translation="MHQMDKARMISVDAFDLRILGALQDDGRLTNQELAELAGLSASQC
FT                   SRRRMRLEEEKVIAGYHADLSSEALGFGVIAFIQVGLATHSPDNSKRFRALVNRIDEIQ
FT                   EAYSLTGDADYVLKAVLRDLKGLSNLVNDVLMPHQSVAHVRSSIVLDRLKESSKLPLKE
FT                   LKAG"
FT   CDS_pept        359681..359992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0341"
FT                   /note="ORF_ID:blr0341"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45606"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45606"
FT                   /db_xref="InterPro:IPR010696"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XH3"
FT                   /protein_id="BAC45606.1"
FT                   /translation="MALQLRPNCEYCDRDLPPDATDARICSYECTFCADCVETKLSNVC
FT                   PNCGGGFAPRPIRPTQEWRPGVCTTRQAPSDKRVHLKYSVEDVAAHCARIRDVPPERR"
FT   CDS_pept        complement(360089..361360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fah"
FT                   /product="fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="ORF_ID:bll0342"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45607"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45607"
FT                   /db_xref="GOA:Q89XH2"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XH2"
FT                   /protein_id="BAC45607.1"
FT                   /translation="MPHPNDPSLRSFIDVDPASDFPIQNLPYGVFSTAASPTPRVGVAI
FT                   GNYVLDLWELEQDSRLDVGALGVFSGASLNPFMALGPKVWARTRARISELLRADHPELR
FT                   DNEELRKQALVPMRDAKLHMPFAVSGYTDFYSSREHATNVGVMFRGKDNALQPNWLHMP
FT                   IAYNGRASTVVVSGTNVKRPRGQLKPPNVDVPSFGPCKRLDFELEMGVVVGQPSAMGGM
FT                   LTEQQAEEMIFGFVLLNDWSARDIQQWEYVPLGPFLAKAFATSISPWVVTREALEPFRL
FT                   KGPEQEPVPLDYLKQAKPQNYSIELDVSLRPGGANAPTSISRTNFKYMYWSSVQQLMHH
FT                   ASSGCAMNVGDLLGSGTISGPEKNQRGSLLEISWNGTEPVELPGGIKRSFLEDGDSLVM
FT                   RGWCQGAGYRVGFGQVEGTILPAE"
FT   CDS_pept        complement(361493..362869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0343"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /note="ORF_ID:bll0343"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45608"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45608"
FT                   /db_xref="GOA:Q89XH1"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR022950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XH1"
FT                   /protein_id="BAC45608.1"
FT                   /translation="MGCLARRRIVMNINTSPDQIIRSSAQVTPGYMSGFGNSFETEALP
FT                   GALPIGRNSPQRCAYGLYAEQLSGSPFTAPRGTNERSWLYRIRPSVKHSGRFEKADAGL
FT                   WRSAPCHEYDLPIAQMRWDPTPVPKEEVTFVQGVQTMTTAGDVNTQAGMAAHVYLITKS
FT                   MVDQHFYNADGELMFVLQQGNLRLVTEFGRIDAEPGEIVVIPRGVKFRVEIPNGPARGY
FT                   LCENYGGAFTLPERGPIGANCLANARDFLTPVANYEDKDTPTELFVKWGGSLFKTTLPH
FT                   SPIDVVAWHGNYAPYKYDLRTFSPVGAIGFDHPDPSIFTVLTSPSETAGTANIDFVIFP
FT                   ERWMVADNTFRPPWYHMNIMSEFMGLIYGVYDAKPQGFVPGGMSLHNCMLPHGPDRDAF
FT                   EHASNGELKPVKLTGTMAFMFETRYPQRVTAHAANASTLQDDYADCWKGLEKRFDPNRP
FT                   "
FT   CDS_pept        complement(362842..363798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0344"
FT                   /note="ORF_ID:bll0344"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45609"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45609"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XH0"
FT                   /protein_id="BAC45609.1"
FT                   /translation="MAKNFASTGDLAEKKITFSEIGADLYAFTAEGDPNTAVIVGDDGC
FT                   LVFDAQATPAMANKVIERVRTVTDKPIKYVVLSHYHAVRVLGASAYKAQGIVASQETYR
FT                   LIEERGKQDWDSEYGRFPRLFQDAQSIPGLTWPTLTFEGEMSIYLGKREVRLMQLGAGH
FT                   TSGDIVAWVPDAEVMFSGDLIEYHSACYCGDAHLREWPLTLNEIRNFNPKAIAPGRGDA
FT                   LKGAATVREAIAMTRDFVTSLYGAAEISVAKGRTLKESMAATREVMDPKFHSFAIYEHC
FT                   LPFNVSRAYDEASGIDDPVIWTDKRDQEMWAALQGGG"
FT   CDS_pept        complement(363822..364058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0345"
FT                   /note="ORF_ID:bsl0345"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45610"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45610"
FT                   /db_xref="InterPro:IPR021233"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XG9"
FT                   /protein_id="BAC45610.1"
FT                   /translation="MPLSTSSNFARPDDAFRAIVEAHRGLTEEQSADFDAALVLILANH
FT                   IGDIDVLREAIGLAKRRMIDGQQQQQQQQQQQQ"
FT   CDS_pept        complement(364067..365695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0346"
FT                   /note="ORF_ID:bll0346"
FT                   /note="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45611"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45611"
FT                   /db_xref="GOA:Q89XG8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XG8"
FT                   /protein_id="BAC45611.1"
FT                   /translation="MAQVNVHQTKTQFGYRRHPDQDRPGQSPAEHPVVVVGAGPVGLSL
FT                   AIDLAQRGQSVVLLDDADRIGEGSRAICFSKRSLEYWDRLGVGDRMVGKGVVWSVGRIF
FT                   HGESQLYQFNLLPEDGHKRPAFINLQQYYAEAYLVDRISDLPEVDLRWRNKVTALEQRN
FT                   DSVALTIETPEGAYRLHAQYVVACDGARSSLRQMVGAEFAGQVFEDQFLIADVKMTAEF
FT                   PTERWFWFDPPFHAGRSALLHRQPDDVWRIDLQLNRYADPVVEKKPENVRPRIARMLGH
FT                   DKFEFEWISLYKFQCRRMDRFIHGRVIFAGDSAHQVSPFGARGANSGLEDAENLSWKLD
FT                   RVLRGTSPASLLESYHAERSMAADENIRESTRSTDFMAPNSHQEARLRKAVLSLAKETE
FT                   FGKRMVNGGRLSVPCSYDTSLSSPDADMWGAGPRPGCSMLDAPVASSAGEQAYLTDVFR
FT                   KGGTDFTLLSFSNGTELGVPEGVKDIRIGGEGGLADPSGLVARRYDADAGAAYLLRPDG
FT                   YVAARFRHPTRETIAAALSRAEGLN"
FT   CDS_pept        365899..366348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0347"
FT                   /product="transcriptional regulatory protein"
FT                   /note="MarR family"
FT                   /note="ORF_ID:blr0347"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45612"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45612"
FT                   /db_xref="GOA:Q89XG7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XG7"
FT                   /protein_id="BAC45612.1"
FT                   /translation="MPFRLNRLAAEVSSALAVEYQERHGLDIPAWRVIATLGFRNDACS
FT                   AQYISQCTRTHKSTISRAVTMLLHEGLIERVENEADRREFRLQLTKKGRALYEELFPQL
FT                   LRREDEILACLSAQERKQLSALLGKIEQSLDLIQTSEEADAKQAY"
FT   CDS_pept        complement(366565..366864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0348"
FT                   /note="ORF_ID:bsl0348"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45613"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45613"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XG6"
FT                   /protein_id="BAC45613.1"
FT                   /translation="MAIVQFTRFKSDKPEEMIKTAKQAKAIFEKHGAEFLRLSRFHTGM
FT                   WAGEFLIATRYSSWEVYGKVQEALAKDEAFTKLYAHTLTFAELKGRNIAVGIDL"
FT   CDS_pept        367324..367731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0349"
FT                   /note="ORF_ID:blr0349"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45614"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45614"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XG5"
FT                   /protein_id="BAC45614.1"
FT                   /translation="MGRHCTALIKRGISQIAMSAAIAMVMSPAPGRDLDGRYRNSPLLE
FT                   WFESLASGKGLCCSHADGHAVEDVDWEARDGHYRVRLPKTADSKLMIWVDVPDDAIITV
FT                   PNKVGRTMVWPIYNDLYPEISIRCFMPGSMT"
FT   CDS_pept        368020..368319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0350"
FT                   /note="ORF_ID:bsr0350"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45615"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45615"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XG4"
FT                   /protein_id="BAC45615.1"
FT                   /translation="MRLPNAVPPETTSILNRLFWRSASRGRAPIGESFATKSTCATKDA
FT                   RRCCSASAMFSLRGDRMRKHRCKPFNKLPSVGFALMSLVRHKATFRVRGVSALP"
FT   CDS_pept        complement(368634..369503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0351"
FT                   /note="ORF_ID:bll0351"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45616"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45616"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XG3"
FT                   /protein_id="BAC45616.1"
FT                   /translation="MAWCARTSPKVHTRSKTKRKIMGNAYEIYALRYATMSPRTPSMNF
FT                   LAPDPHDSAAQDLDYFVWLIRGGGRDILVDTGFNAEEASARARKLTLNPVDALERFGVK
FT                   ASAIRDIIVTHLHYDHAGNLDRFANARFHLQEREMAYATGRCMCNGLLRHPFSVEHVTQ
FT                   MVRHVYGERVNFYSGDGEVAPGITVHRVGGHSDGLQVVKVETARGPVVLASDAAHYYAN
FT                   LQRRSPFPIVYNVGDMAQGWETIERLAGHPDRFIPGHDPIVTEIYPRASDKVDAWALHL
FT                   PPSRSFAK"
FT   CDS_pept        369849..370931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0352"
FT                   /note="ORF_ID:blr0352"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45617"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45617"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XG2"
FT                   /protein_id="BAC45617.1"
FT                   /translation="MKIRFLFLLPLLVSLVPTAPSLAAGDRYALVIGNAKYPDADAPLK
FT                   EPLNDARDVADELKRDGFSVEIGENLTGDGMRRAFDKLYGKIKPGSVALVFFSGFGIQS
FT                   ARQSYMLPIDAQIWTESDVRRDGFSLEAVLGELNTRGAGVKIALIDASRRNPFERRFRS
FT                   FSAGLTPVIAPNGTLVMYSAALASVVSDAGGEHSLFVQELLKEIRVPDLMAEETLNRTK
FT                   MGVTRASRGEQVPWISSSLAEDFSFIPGAGGSRPTMAPPPAPPAPPPVVANNPPPAPPV
FT                   PPSPPPPPKPADTAAAPAPAPVPAPSPKPQVEAALPPPPPPVKPADPAPAPNADAGPSA
FT                   AALAEDPTIKGPDGQDRGQS"
FT   CDS_pept        370936..371376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0353"
FT                   /note="ORF_ID:blr0353"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45618"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45618"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XG1"
FT                   /protein_id="BAC45618.1"
FT                   /translation="MNALYRRGQVYASKGAYNLAIKDFDDTLRINSKDVEALNNRCWTR
FT                   TVVGDLQGALKDCNEALRLRPNFVDALDSRGLVNLKSGAVKNAIADFDAALRINPRLTS
FT                   SLYGRGIAKQRNGSAQEGALDIANAKAMDPNIVQEFASYGVR"
FT   CDS_pept        371443..372195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0354"
FT                   /note="ORF_ID:blr0354"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45619"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45619"
FT                   /db_xref="GOA:Q89XG0"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XG0"
FT                   /protein_id="BAC45619.1"
FT                   /translation="MPQAAFPGGPIAGILEPRSSAAQEGLAMRSAAKGLTAILSIMAIG
FT                   AALSLPASPAFAGDDGNSKNVTEDEIVRALAPPQKKPLTRGLSIAPQADPAPSASETKL
FT                   IQSVRGRSTRSLSSTEREEIASVAKDKPNIDLEITFDYNSANISTKSLASVQALGRALT
FT                   SPDLKGSTFVVAGHTDAAGGESYNQDLSERRADAIKRYLVEKYSISATDLVTVGYGKSK
FT                   LKDPSQPMAEVNRRVQVVNMENKTTASK"
FT   CDS_pept        372354..373283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0355"
FT                   /note="ORF_ID:blr0355"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45620"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45620"
FT                   /db_xref="GOA:Q89XF9"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XF9"
FT                   /protein_id="BAC45620.1"
FT                   /translation="MNVSDYLKPAGTVAFIVALGIGYYLFEHRRRPEAKETPGEALVIV
FT                   TKSTNACFSDLVRVTGFFVPRREAVVVADQEGSRVTDLFVTEGTMVTDNQELARLTAPP
FT                   QIPGQPQRSGAQGPISLKAPAPGLVTEVRTIVGAPASPQAGPMFRIAVNNEIELDAQVP
FT                   AVHMPKLSAGATVRISRDDAPDLIGRVRLVAPEIDRATQLGRVRISVTNNPSLKVGVFA
FT                   RASIDAKRSCGVAVPKTAIDHLTVQVVKGNTIETRKVRVGLSSDTATEILEGLDVGEIV
FT                   VADAGSSLHDGDQIKTMFADELDRTRVR"
FT   CDS_pept        373283..376429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0356"
FT                   /product="Acr family transport protein"
FT                   /note="ORF_ID:blr0356"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45621"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45621"
FT                   /db_xref="GOA:Q89XF8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XF8"
FT                   /protein_id="BAC45621.1"
FT                   /translation="MALNISAWSIRNPLPSVVFSIILLILGWTSFAKLAVTRLPSADIP
FT                   VISVAVSQFGAAPAELESQVTKTIEDAVSGVEGVRHITSSITDGLSLTTIQFALETNTD
FT                   RALNDVKDAVTRVRSNLPQNVTEPLIQRVDVIGLPIVTYAAISPGKTPEQLSYFVDDVV
FT                   KRALQGVRGVAQVERIGGVEREILVSLDPDRLQAMGLTAVNVSQSLRGTNVDVAGGRAE
FT                   IGKNDQAIRTLAGAKTLSDLAGTMVPLFGGGEVRLDDLGTVTDTIADRRTFARFNGEPV
FT                   VALGIKRSKGASDVKVADAVQKRIDALKAAYPDVDLKLIDTSVEYTNGNYEAAISTLFE
FT                   GAILAVVIVLLFLRDLRATIIAAISLPLSIFPAFWAMDLLGFSLNLVSFLAITLSTGIL
FT                   VDDAIVEIENIVRHMNMGKSPYRAALEAADEIGLAVIAISLTIIAIFAPASFMSGIAGQ
FT                   FFKQFGITVSVQVFFSLLAARFVTPVLAAYFLKHGHHEEPPPGRVLRSYHRIVAWSVKH
FT                   YFITVLIGFGIFAASIWSITLLPQGFLPAQDSARSLLALELPPGTQLAYTEKVTEDIVA
FT                   RLRKRPEVKSIFVDGGRVPPGTQEVRRAALIINYTPKGDRDITQRELEFSISQELENIP
FT                   DIRFWFLDENGLRAISLVVTGVDANIVNNVASELATQMKRIPTISNVISETTLERPELR
FT                   IEPRADLAARLGVSTESLSQTIRVATIGDVGPALAKFDVGDRLVPIRVQLEDAARGNLK
FT                   TLEQLRVPLGEHGEKGGVPLSVIADVKLDQGPTSINRYDRDRQATVAADLVGSAALGDA
FT                   TKKINELPVMKSLPKGVKVSPSGDAESLNELSDGFATAITAGLMMVYAVLVLLFGTFLQ
FT                   PITILFSLPLSIGGAIAALLVTGKQLTTPVWIGILMLMGIVTKNAIMLVEFAIEAIRDG
FT                   KPRDEAMIDAGMKRARPIVMTTIAMAAGMMPSALAVGAGGEFRSPMALAVIGGLIFSTI
FT                   LSLVFVPAMFMVMDDLGALIWRFGKRLIVHSEDTEAPGHHHEASPAQPAQKSIVHPAAE
FT                   "
FT   CDS_pept        complement(376445..377119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0357"
FT                   /product="transcriptional regulatory protein"
FT                   /note="Crp family"
FT                   /note="ORF_ID:bll0357"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45622"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45622"
FT                   /db_xref="GOA:Q89XF7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XF7"
FT                   /protein_id="BAC45622.1"
FT                   /translation="MSKQAEFAVILKMNPMFADLGADELQRLSNLCHTQHLANGEVLFQ
FT                   KGDAGDALFGMRRGQVRIETGAADGSRLTLNFMGPGDLFGEVAVLDGQNRTADATAGEA
FT                   SELFVLRREDFLAFLEREPKVAIKIIALLCQRIRWQSERMEESMLQPLPVRLARRLCAL
FT                   AADFGSEVHISQEQLGVFVGAARESVNRQLQAWRKDAILDLQRGRILLRNMTKLTAIAR
FT                   NE"
FT   CDS_pept        377356..379425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0358"
FT                   /note="ORF_ID:blr0358"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45623"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45623"
FT                   /db_xref="GOA:Q89XF6"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XF6"
FT                   /protein_id="BAC45623.1"
FT                   /translation="MRAVKFAGAAVAAVVIVIALLLVVGIPSGFLTSTIASRVESATGY
FT                   RLSIDGTTRISLWPTLNVTLNDLTLQDPKDRSGITRLTVDSVQADMSLSSVWSGRPKIS
FT                   ELIVTRPVLYQPLLRERLPNAGTSSKPLALDTDGATIDRVKVTDGEVAFARVRDRVESR
FT                   ISAINADAVVGRDRNVSITGTARVGEHPTKFDIKATTPAPPTDRPTIPVEFAIDMPDVL
FT                   KSRLAGHAEMRLSGDLVMINGVNGTLGDGAFNGWASVDIASKPLVKVDLDFQRLTIPLA
FT                   KSPDGASGQPWSNAPIDVSGLNYVDAQIRISANDAVIGDARLAPLALDAKLAGGVLKAG
FT                   TANLGAYGGQVSGEVILDATSGAPSFAMHSDLVGVRALPLLRGLAEFDRIDGKLQAKLA
FT                   LRSAGTSQRALMANMQGTAFVNFQDGAIRGINVAQMIRSLTSGTLSGWQDNQNSSQDQS
FT                   TDLSQLSASFRIDKGQAVTTDLNLIGPLVRVTGAGTIALDTKMLGFRVEPKLVMTTEGQ
FT                   GRASEPVGFGIPVMIQGSWSQPRIYPDMAGMLDNPDAAYAKLREMGKGLFGPDGAGLGN
FT                   ILGSLGLGGTTAPGGGNAGSNANPQTQQPGQNNLLGGPLGEALGNLIQQGLSSGAATGT
FT                   GTGRSRSLPATPSTPAPQASPAPAPPARAPDEPPVAQQDSQPMNDVLRQLFNNR"
FT   CDS_pept        379674..382121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0359"
FT                   /note="ORF_ID:blr0359"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45624"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45624"
FT                   /db_xref="GOA:Q89XF5"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XF5"
FT                   /protein_id="BAC45624.1"
FT                   /translation="MAGANDKTRFLREGLFAKYVVSLVGLVVFVLAVSGAMETWISYRA
FT                   TKTQLTDGLEDKAQAAARRVEQSISELERQISWVTRASQDTLEKRRADYAQLLHQVAVV
FT                   NQLFQLNGEGREVLRVSRQSTTTGGNADLSRDMRFTDTVARGVSYAPAWFSDRTPLMSI
FT                   SVAHSGFNAGVTVAEIDLSFLSELLSDAQVGKAAFAYVVDPRGRVLATSSKGPDVGKDL
FT                   SKLPQVAAAISPGRGPDTSGTDFNGYSVLTAASTVPKLGWSVLFEQPTTQALTPIRDQL
FT                   VRIALLIGMGLMVAILAGTLLARRMIIPITALRDGAHKLGEGDFSHRIDVHTSDELEDL
FT                   AGQFNRMATQIQETYSNLETKVEERTRDLAQSINELKVLEEVGRAVASSLDLNAVLPTI
FT                   AARAIEITHADAVLIYGFDAGTRRFNLVESNGIDKSADGAHVTIDEGDNILSDAAASCE
FT                   PIALADLDHAAEQPLRDVAIAAGFHSVLVVPLVDQQGTLGSLVVLRRAGGEFAASIIGL
FT                   MRTFANQAVLAMRNARLFTEVDHKSHALEAAHETVRAQADKLRVQTEQLKDWNKSLEER
FT                   VEKQLGEIERIRKLERFLAPQVAQLIASSDSPEGLLTSQRREVTVVFCDLRGFTAFTEA
FT                   TEPEEAMNVLREYHAALGTLIFKYEGTLDKYAGDGVMILFNAPIQFEDHTQRAVKMAVE
FT                   MRDTIGPLTERWRNRGHSLGFGIGIALGYATLGQVGFEQRLEYAAIGSVTNLASRLCGE
FT                   AKANQIVVSRRVYGMVEPWVEARALDDLVLKGFNHPVLAMEILSWREEVDNVVDAAAAR
FT                   RRG"
FT   CDS_pept        382518..383384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0360"
FT                   /note="ORF_ID:blr0360"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45625"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45625"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XF4"
FT                   /protein_id="BAC45625.1"
FT                   /translation="MAFALPSRAYDLQMLDRPTERARDHGWVYGLPPGITSEQWPLDPV
FT                   TGYPLMHGFTLLLPDDYRLHGDDIVAVSFFATAPDHNDGGAPDDPEIREAVLARPAHPR
FT                   LSRMTDILDYEYAALLLTKAEYDGAFATPPAPLALATADRPRWLDVGGACAFFETAAPY
FT                   ARKMFAAPPRADLAETRAIGLTPRAADPNAGKGPQDEHVRQNPPTGYQPYYYYVGGVPS
FT                   RDNFRLHDWSKDHAHNHLGGTMRPCQAVPEMSPFYIEFEEYFGGYNFGGGNAQLDFKEM
FT                   KFDWACG"
FT   CDS_pept        complement(383385..384707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0361"
FT                   /note="ORF_ID:bll0361"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45626"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45626"
FT                   /db_xref="GOA:Q89XF3"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XF3"
FT                   /protein_id="BAC45626.1"
FT                   /translation="MVRAWRWRRAKVVRSAIMSGSRMAPVLAGAALVVLAVLLPNRAEA
FT                   QFGLRGGPLGVARFAVGHVIGLSRLRHARMAVRGGGYRSAALRSQDPRGVEGRQPLNPA
FT                   ILRAALTAQAALSGWHGGRRPQGWWRHPDGSYGWAGPVFWPFAHDDLANAIILGDTTSI
FT                   SLYGYGDIYAALFSPYAAKELAAYAAPQGRFARRIPSAQNICDVSDPAGFPADRITAAV
FT                   QPNELQRTALDDLSAAWLAARNSIRATCPAQVPATASERLGLMRERLEAMIKATDAVAP
FT                   PLSKFVDLLDANQKSRLDALANEARAALASSQHKDAQAAAACAADSDPRYDPQLQRQYE
FT                   QLVQQQWPVADIASTLRLDDIGRARLDVLQDTTLRTMETLSACPTKPAATPQGRLAAVK
FT                   ARLETMLQAVSGVADALDDFEADLSDEQKAGFEAIGPKRGA"
FT   CDS_pept        complement(384793..385818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0362"
FT                   /note="ORF_ID:bll0362"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45627"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45627"
FT                   /db_xref="GOA:Q89XF2"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XF2"
FT                   /protein_id="BAC45627.1"
FT                   /translation="MMTASKAFIAFCLLAVVGTVLVIGPTELRRLLPGGTSTEIAVAAK
FT                   SEAKVGANAEIKTEPKAETKAVPTPEEPKLAAGAPPAPAAAPKPAGPLAETQKQVTALA
FT                   DLVPVKPPVAATDAGPRFDVARIDDHGEAAVIAGQATPGAKVELLRDGQPLHSVVADAS
FT                   GQFVMTPPQLPAGSYELTLRARAPDGTVTQSSRTMPVTIAEAAPPPARVAPPAAKLETK
FT                   RAATPDARSDVVASLPSASDRPATRPRMMGATKSRGSMARAPAATTVASASPGDALSGT
FT                   PAEAGGSRVISRGDSLWALSRLAYGDGARYAVIFNANRAKIHNPNLIYPGQTLVLPQKA
FT                   E"
FT   CDS_pept        complement(385956..386738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0363"
FT                   /note="ORF_ID:bll0363"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45628"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45628"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XF1"
FT                   /protein_id="BAC45628.1"
FT                   /translation="MRSPRFGGGRRGQISPLDLPVQRLRVALGEHRRHVELAGLEVITA
FT                   FPVGQSLHGDVLRMLVHFARQRDQEVAIVGPVNTEPAISIFGALHQIGRDVVVELHVLR
FT                   VRPAVEIGPGEVTERLLRRAHEGAVLDMVEKQILLARAGLLHPHQPLRVAGEAEAGPVA
FT                   LLGLQLRHPLAVPRPGLPFDVEILAVLHVLLDPGGAVGRGEGEIGIVGEDVVRRRARGG
FT                   KCGGGGEHHGKRQPWRGAAECSHGKNPQKIGRDAASII"
FT   CDS_pept        387015..389678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0364"
FT                   /note="ORF_ID:blr0364"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45629"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45629"
FT                   /db_xref="GOA:Q89XF0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XF0"
FT                   /protein_id="BAC45629.1"
FT                   /translation="MGTSIRWTARMRALLRRWRGAPLTWLIVGGFVLMAATAIGTALTV
FT                   DRFRQNAIESGRDSLESAVRLLVRHFDREFADFAVLQKSVIAELESHGIASTDVFRSEM
FT                   GTLAMHEALRAKASGWSDVAGANVFDANGALINSSRRWPVADISVADRGYFNRLKSDPT
FT                   SQEEIEVVPGRFGNGPAIVFARRVSGPHGEFLGMVSRAITPDQLESFFASTGLGDDSSI
FT                   AMHHQNGQLLARIPHVDAMIGQNYHTGSPEQKAVFERTFVTMQLASPIDGKDRIVASRL
FT                   LTGAPLVIVATRSLDATLATWRTQTKFFVTVAVLSIGLLVLTLFLIFRQVTRRLSLEKQ
FT                   RLDTALNTMTQGLLMFDQDERLIVCNRRYIEMYHLSTDVVKPGAYFRDVIQHRHDTGSF
FT                   DGDVDSYCDGILGSVGRTQSAIVETADSRLIEIKNQPGAAGGWLATHDDVTERIRADER
FT                   IAHMAHYDALTDLPNRVLMRGHLERRVAELAEGKPFAILYIDVDEFKGVNDSLGHEVGD
FT                   ELLRQVANRLRACVSGNDLVARLGGDEFAIVKAGTRDQAELTALAETILNALRAPVNCK
FT                   GQEVPTDASIGIAIAPDHGDNLDDLLKRADLAMYAAKSEGRRTFRVFVPEYDAKARLRR
FT                   QLELDLRQALARGEFEVHYQPLVDLAANVVTGCEALLRWHHPERGMVSPADFIPVAEDT
FT                   GLIGEIGEWVLKQACTEAASWPGDIHIAVNVSPVQFRSKTLALKVAAALAESGLAPGRL
FT                   ELEVTETVLIRDDEEALTILQQLRELGVRIALDDFGTGYSSLSYLHRFPFDKIKIDRSF
FT                   ISDIGEPEDSSPIVQAVVHMAAARRMATTAEGVETEAQREVLRQLGCSQMQGWLFSPAV
FT                   PAAKLKRLLSAQAAAA"
FT   CDS_pept        389916..390236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps21"
FT                   /product="30S ribosomal protein S21"
FT                   /note="ORF_ID:blr0365"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45630"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45630"
FT                   /db_xref="GOA:Q89XE9"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XE9"
FT                   /protein_id="BAC45630.1"
FT                   /translation="MQDCRISQPDEETQLQVLVRDNNVDQALRVLKKKMQREGVFREMK
FT                   QRRSYEKPSERKTREKSEAIRRARKLARKQAIREGLLPAPPKKKLPERKPPLPQTAARP
FT                   AG"
FT   CDS_pept        390274..390600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0366"
FT                   /note="ORF_ID:blr0366"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45631"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45631"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XE8"
FT                   /protein_id="BAC45631.1"
FT                   /translation="MRTGRHRCCASCIREDGPYLIGMMKLTLVQDQAIQALMAGIVGAE
FT                   TFDRVFAGIRFDNIEGTMLYAFAGNAEVASDIEDSYSPYIAAVASQVLDKQVDVVIVMP
FT                   KVLQ"
FT   CDS_pept        390760..392454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0367"
FT                   /note="ORF_ID:blr0367"
FT                   /note="putative glucose dehydrogenase (acceptor) (EC
FT                   1.1.99.10)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45632"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45632"
FT                   /db_xref="GOA:Q89XE7"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XE7"
FT                   /protein_id="BAC45632.1"
FT                   /translation="MYDYIIVGGGSAGSVLAHRLSAKSANKVLLCEAGQDTPPGNEPAE
FT                   IRDSYPGTAYFDPRFHWTELKVTTQVVSHNNPTEARPPLRKYEQARVLGGGSSINGQMA
FT                   NRGAPTDYDEWDARGAEGWTWNDVLPFFKKVERDLDFDGPYHGKDGRIPVRRIPREHWT
FT                   RHSQAFADAFQQAGHQFVADQNGEFVDGYFAVTHSNQAEQRVSAAMGYLDRDTRKRANL
FT                   TISTNTQVRELLFEGTQCVGVKARVDGREQEFRGREIILSSGAIHSPAHLLRAGIGPVG
FT                   HLKDMGIPVLTGLPGVGQRLMDHPSISLSSFVRRGARMNEHTRRHMQLGLRYSSGLSGV
FT                   PKGDMFVVVLSKSAWHAVGAQIGSLLTFVNKTYSETGQVKLASRDPSAEPIVEFNLLSD
FT                   RRDLDRLMSGFRKMAAVQMSEIVRKVTDKPFPAAYTDKVRKIGVVNTGNKILTRVAAAL
FT                   MDGPAALRHYLIDNFVVEGFTFDDVMNDDEALEAFVRKATIGVWHASCSCRMGRADDPM
FT                   AVVDNQGRVRGVQGLRVVDASIFPVVPCANTNFPVLMSAEKIAATMQ"
FT   CDS_pept        393209..394405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0368"
FT                   /note="ORF_ID:blr0368"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45633"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45633"
FT                   /db_xref="GOA:Q89XE6"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XE6"
FT                   /protein_id="BAC45633.1"
FT                   /translation="MRRGACRYPLRQNNNAALAPRRTPMPRPTRCVASKTPRAAIATTL
FT                   AFLALISGVRAGMAETFAYVGNADSNDISVFKLSESGEMTPVQTAAFTGVEKPGSSTPL
FT                   AITPDHRVLIAGVRSQPFQAVSFAIDPKTGQLSHVGNGPLADSMANIATDRGGKVLFSA
FT                   SYGGNKVALNPLSANGVVGEPKQVIPTGLNAHAFLPSPDNRYVFATNLGSDQVLSFAFD
FT                   VTTGTLTPSAPPNYKVPEKSGPRHFVFHPNGKFVYLIHELNGDVAAFTYEAKSGAWDEI
FT                   QRTTALPEGFNGKPWAADIHITPDGRFLYASERTTNTLTAYKVDAASGKLTTVGSVPTE
FT                   KQPRGFNIDPSSRYLAAVGELSDGMTVYAIDQSSGALSKLKSYPTGKKPNWVEFLSLP"
FT   CDS_pept        394857..395759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0369"
FT                   /note="ORF_ID:blr0369"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45634"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45634"
FT                   /db_xref="GOA:Q89XE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XE5"
FT                   /protein_id="BAC45634.1"
FT                   /translation="MEFPMRHLPRAAVRALFPATIAAVLVFGQYPAGAADDDAPKGPAV
FT                   TVLKVAKSCFSDIVEATGTIIAREETSVRPERPGLKVTEVLAEAGETTTAGQVLARLAL
FT                   PEGGTLQVTAPVAGVIATSTAQIGNLASAKGEALFTIVARSEYDLVGLVATTDMRKLAV
FT                   NQQATVRIAGAGDIDGKVRRIGPTVEPNIQQGMVYIGISSQKRLLLNASGRALIKTGQS
FT                   CNVAVPLTSVQYSSAGTVVQVIRRNRVETKRVEIGLMSGGNIEVRDGLNEGDVVVARAG
FT                   ALLREGDPVRPVMAAEAAK"
FT   CDS_pept        complement(395996..396844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0370"
FT                   /note="ORF_ID:bll0370"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45635"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45635"
FT                   /db_xref="GOA:Q89XE4"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XE4"
FT                   /protein_id="BAC45635.1"
FT                   /translation="MNVRQLDISRRTIAVAAALIGTVSLVIGAHAALNMRALDAAKAVT
FT                   TDQVTGSIGQASRLALVIGNGHYPDANAPLTQSINDARALSSTLRKNGFDVDMVEDATK
FT                   DDMVRAVNRLKSRIKRDTVVMLFFGGYGVQAGRQSYMLPIDAVIWKESDVRRQGVSIDG
FT                   VLDMMKEQGAKAKLVVVDASRRNPYERRFRSYSHGLAPISAPDNALILSSASPGKVVDD
FT                   GKGEHSVLVSELLGNLAAQGSAESAFNKTRVAISRASEGDQVPTVSSSLLEDVHFGEAG
FT                   G"
FT   CDS_pept        397129..398994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0371"
FT                   /note="ORF_ID:blr0371"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45636"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45636"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XE3"
FT                   /protein_id="BAC45636.1"
FT                   /translation="MPTFSVTAITFVFPANPGSFFKDLQGWCADGSAPAVPDQGPATRY
FT                   FMSFHYFAGAACRALTARKDGPSLYDVCDPVLSGPASGDPHLAKFYKTALGNPALRVLL
FT                   RRAGLPELRNEAKLTRLREALTRARDEAEPDWAAVGQPVADLVDSITLDHPRPPPALFV
FT                   GAMPQASQIDGVIRDCAQHLLGSYRKNGFLPTYAAFNLIGDPDFRGRELTMALTGLNAR
FT                   GYKNSSLLFNLARVFIARSKAAAVVNPPWTGIAEPMWEPVQIRHRSAYYDAFFIEALLS
FT                   FVETGLASPADKTAAERAIADMVDFCVNISREEVEGTDGARFNVITALAPAPHPRFSRF
FT                   FAQIKQDLGFGVYVPDCDTTACSISAATQAGCTDPIIDQPLLDFYSSYQVRAGVNEPRV
FT                   TVPLNDNIDYEGGVATWIDNLRGERPYGNDLDPTLNLDILEVSFRNLVRWKILETPARL
FT                   ATVHRIIGFQKRLAASGAFANPRSHIYYLPELYSAYFGRCYAAFLALPLAAQAAIDPDG
FT                   DFDFIRHRVLSYVKGELMAAEMNVFDAALALIALGHLGADPRAFAPALNVIVGAIGEGG
FT                   RRGPFRAYEWNKMKTPTRILVGGPEVTSAFVLMALAVARRAMARG"
FT   CDS_pept        399144..399866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0372"
FT                   /note="ORF_ID:blr0372"
FT                   /note="putative succinoglycan biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45637"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45637"
FT                   /db_xref="GOA:Q89XE2"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XE2"
FT                   /protein_id="BAC45637.1"
FT                   /translation="MLRKFLLALSLLAPTLAQAADITGTAKVRDGDSVVIGNTRVRLGG
FT                   IDAPSSDQLCLNTHTERWTCGIAARDELAKYTEGKNWVCHARAIDRRGRTVARCEVGGE
FT                   DIQKWLVRSGWALSYTRVSHDYDADEAAAREAKAGMWQGAFIAPWDWRVRNKKTTILGA
FT                   TKPPEGAHAVLLASASGPVAPSPDCTIKGNVNTAGECIYHQPTSRWYTQIKMKISKGTR
FT                   WFCSVEEAEAAGCRETKR"
FT   CDS_pept        399970..401157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0373"
FT                   /product="hypothetical aminotransferase"
FT                   /note="ORF_ID:blr0373"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45638"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45638"
FT                   /db_xref="GOA:Q89XE1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XE1"
FT                   /protein_id="BAC45638.1"
FT                   /translation="MTVRAGREFLAIPGPTTMPDEVLRAMHRPAIDIYSKEMLDLTESL
FT                   LSDISKLFATRGKSYIYIANGHGAWEAALSNVLSRGDKVLVLESGRFAIGWGNAAALMG
FT                   AEVEVLKGDWRRAVRPHEVEERLRRDKEHRIKAVVVVQVDTASGVQNDIEAIGKAIKAS
FT                   GHPALYMVDTVASLGCMPFEMDKWGVDVAMSGSQKGLMTPPGLGFVSANARALEVHKKA
FT                   NMSTPYWSWSEREGTENYRKYAGTAPVHLLFALRKAIDLLHEEGLENAFRRHSLLGEAA
FT                   RRAVSAWTEGQVLGFNIAEASERSNTVTTVTMSNGHDPAVLQRYCKDKCGVVLGTGIGD
FT                   LSGQAFRIAHMGHINAPMLLGTLGVVEIGLNALKIPHGKGGLEAAVAYLGEEVAA"
FT   CDS_pept        complement(401383..402489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0374"
FT                   /note="ORF_ID:bll0374"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45639"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45639"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XE0"
FT                   /protein_id="BAC45639.1"
FT                   /translation="MRGSFTSVMRLLLASVACVLGAAALTFAVDPLQLFRPSRLVAPFY
FT                   SDDTRMQNAGLIRSQSFDTAFIGTSLAIHFRQSDIDRALGVRSLKLAMTGSNSRQQGFV
FT                   LEQAIDRGARRVIWAMDDFSFVDAAGIEADPYLSVDLYRRTAKGIAAYLFSGPMAKESL
FT                   FALLRSVPPLREPLSRAAPFLPVKFALSDVDDIYALPRDFDVARAYNAERTRAAFAYIT
FT                   DPVRSSFLGEGYERDAMIRHFERDAASLITRHPDVTFDVYFPPYSILQFVAMRDASPAT
FT                   LTIVTDLTARIAQRLTQLPNVRLHDFRAIKAVTHDLNNYGDVIHHSPAVDAMVLKWLAS
FT                   GEYRVDPKAPLASLEELKAQVEAYRVER"
FT   CDS_pept        complement(402489..403925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0375"
FT                   /note="ORF_ID:bll0375"
FT                   /note="probable alginate O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45640"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45640"
FT                   /db_xref="GOA:Q89XD9"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XD9"
FT                   /protein_id="BAC45640.1"
FT                   /translation="MLFNSYPFILLFLPAVLAGYFWLGRRGNLTPVIWLAVASLAFYAI
FT                   GNWQFVALLLASIAFNYGVGHLLIAAELMPTQRRAALALGVAGDLLVLGIFKYAGFAAD
FT                   NLNALLGTHVAVHILLPVGISFYTFTQIAFLVDAYRGQVARYALPHYALFVTYFPHLIA
FT                   GPILHHKDMIPQFEREESKQPHAHLILCGIIIFAIGLFKKTCLADGIQPLVALAFDARS
FT                   PSFDQAWCGALAYTFQLYFDFSGYSDMAIGISLMFGIFLPVNFNSPYKAASIVEFWRRW
FT                   HMTLSQFLRDYLYIPLGGNRRGHVLRYVNLLITMLLGGLWHGAAWTFVVWGALHGAYLC
FT                   VNHAFSALVQTIPSLHARPVRILGAVLTFLAVVVAWVFFRAERVDWALRIVSAMADPLN
FT                   IVLGREEIAALVQVAIYAALVWLAPNTQGIMGYDHGNRRVGESLRAGRMRPLFLYGASL
FT                   VLAFGLLGIQSHSEFIYFRF"
FT   CDS_pept        404263..406368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptrB"
FT                   /product="protease II"
FT                   /note="ORF_ID:blr0376"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45641"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45641"
FT                   /db_xref="GOA:Q89XD8"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XD8"
FT                   /protein_id="BAC45641.1"
FT                   /translation="MTQTKTPSQPPVARRRPHSFTRHGITVTDDYAWLKDEKWQEVLRD
FT                   PGVIDPDIRKYLDEENVYTESLLGHTAALQKTLVREMRGRIKEDDSSVPSPDGQFAYFR
FT                   RFREGGQHELFGRMPREGGDGHIVLDGDALAKDHKYFKFGGSRHSPDHKLQAWSADTKG
FT                   SEYFSIRVRDWATGKDFDDLVEETDGGIVWSKDAKSFFYVKLDDNHRPMQVWRHRLGTK
FT                   QANDTLVYEEQDSGWFTHLHESTSGRFCVIAGGDHETSEQRLIDLESPDTPPRLVAARE
FT                   EGVQYSLADRGDQLFILTNADDAIDFKIVTAPLGSPERKNWRDLIPYRPGIYIIDLDLY
FT                   AGHLVRLERANALPAIVIRDLASNEEHAIAFDEAAYSLDTMGSYEFETTNLRFAYSSMT
FT                   TPSEVYDYDMAKRTRTLRKRQEIPSGHNASDYVTTRIMAKAQDGAEVPVSILYRRGLKL
FT                   DGSAPLLLYGYGSYGMAMPASFNANRLSLVDRGFVYAIAHIRGGADKGWGWYLDGKREK
FT                   KTNSFDDFAASARALIDARYTSAKRIVGHGGSAGGMLMGAVANRAGELFAGIVAEVPFV
FT                   DVLNTMLDDTLPLTPPEWPEWGNPIESEKDFRTILSYSPYDNVAAKAYPAILAMGGLTD
FT                   PRVTYWEPAKWIARLRATMRGGGPVLLRTNMGAGHGGASGRFDRLDEVAIVYAFALWAA
FT                   GMAEAGV"
FT   CDS_pept        complement(406415..407134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0377"
FT                   /note="ORF_ID:bll0377"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45642"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45642"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XD7"
FT                   /protein_id="BAC45642.1"
FT                   /translation="MTKLSEATRNKLKSVSTATVATALFKRGLRIQMIQDVHPLGPDQP
FT                   TMVGEAFTLRYMPAREDLNTIDVFKDRSHPQRKAVEDCPAGSVLVMDSRKDARAASAGA
FT                   ILVTRLMKRGVAGVVTDGGFRDSAEIAKLGIPAYHHRPSAPTNLTLHQAIEINVPIGCG
FT                   DAPVFPGDVILGDADGVIVIPAHLADDIANETFEMTAFEDFVTEEVGKGRGIFGLYPAT
FT                   DPQTLTDFAEWRKKNGR"
FT   CDS_pept        complement(407234..408973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /note="ORF_ID:bll0378"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45643"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45643"
FT                   /db_xref="GOA:Q89XD6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XD6"
FT                   /protein_id="BAC45643.1"
FT                   /translation="MTKKKKTPDQLRSARWFAPDDLRSFGHRSRTMQMGYAPEEWKDRP
FT                   IIAILNTWSDAQPCHMHFKSRVDDVKRGILMAGGLPLELPALSLSESLLKPTTMLYRNL
FT                   LAMDAEELLRSHPVDGVVLMGGCDKTTPALLLGATSMNIPAIYLPAGPMLRGNWKGKTL
FT                   GSGSDGWKYWDERRAGKISDKDWLDIEAGIARSYGTCMTMGTASTMTAIAEAIGMTLPG
FT                   ASSIPAADANHIRMASECGRRIVEMVWEDLTPKVIQTRKAFENAIAVAMAMGCSTNAII
FT                   HLIAQARRAGQDIGLDDFEIASRKVPVIANVRPSGDAYLMEDFFYAGGLPALMGQIKPH
FT                   LHLDCITVTGQTVAENIAHAEVHNDDVIRSVDNPIYKEGALAVLKGNLAPDGCVIKPSA
FT                   CAPRFLKHTGPALVFDDYPSMKKAVDDPNLDVTEDHILILRNAGPQGGPGMPEWGMLPI
FT                   PTKLVKQGVRDMVRISDARMSGTSYGACILHVSPESYIGGPLALVQNGDRITLDVAART
FT                   INLDVSEAELEKRRAAWKQPERRFERGYGWMFTKHIKQANDGCDFDFLETDFGAPIGEP
FT                   SIY"
FT   CDS_pept        complement(408970..409833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0379"
FT                   /product="ABC transporter permease protein"
FT                   /note="ORF_ID:bll0379"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45644"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45644"
FT                   /db_xref="GOA:Q89XD5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XD5"
FT                   /protein_id="BAC45644.1"
FT                   /translation="MGEARILLRDAPVAAASGAAEVERKLSVTELLWNDGFVRKTVIIL
FT                   FLAAIWEAYGVALDNPLLFPTLHDTIVTMYERVKDGTIPMRAWASLKVLFMGYSAGIVL
FT                   AAIFTVLAISTRIGTDFLETVTAMFNPLPAIALLPLALIWFGLGNGSLVFVLIHSVLWP
FT                   VALNTHSGFKSVSNTLRMVGRNYGLRGLPYVAKILIPAAFGSILTGLKIGWAFAWRTLI
FT                   AAELVFGVSSGQGGLGWFIFENRNLLDIPAVFAGLLTVIIIGLFVENLIFRAIERNTVQ
FT                   KWGTQS"
FT   CDS_pept        complement(409846..410607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0380"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:bll0380"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45645"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45645"
FT                   /db_xref="GOA:Q89XD4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XD4"
FT                   /protein_id="BAC45645.1"
FT                   /translation="MALLDVNGVTLRYKTSSAVVTATERVSFTVDRSDRFVLLGPSGCG
FT                   KSTLLKAVGGYMSPSEGRMSINGREIHGPGADRMMIFQEFDQLLPWKTVLANVMFPLLT
FT                   ARKLPHKDAEARARAYIEKVGLTRVVDAYPHTLSGGMKQRVAIARGMAMEPDILLMDEP
FT                   FAALDALTRRTCQDELLQLWSETKFTVLFVTHSIAEAIRIGNRILLLSPHPGRVKAEVV
FT                   DVDKVSSADGSAGRLEKEIHDLLFAAEATAH"
FT   CDS_pept        complement(410607..411626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0381"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="ORF_ID:bll0381"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45646"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45646"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XD3"
FT                   /protein_id="BAC45646.1"
FT                   /translation="MMMHLRSKLAAAALIAATALSVSAAHAQQKSEISLSRQPGIFYMP
FT                   SHIMEKQKLIEKHAASLGVPGVTTKWVTFSGGGAQTDALLAGGVDILNTGTGNLLLLWD
FT                   RTRGGVKGIVATSAQPMTLISRDANIKSIRDFGPGDKIAVPTVKVSTQAIVLQIAAAEA
FT                   FGADQWSKLDANTVQLGHPDAYAALANSKHEVHTHFSIPPFTFLELKNVPGAHVVLSSP
FT                   DVMGGPLSQAQFFTTTKFADANPKIIQAVRDATKEAQDLIRSDTRQAVEIYKEITGDKT
FT                   SAEELLDLLKEPGMMEWNLEPQGTMKFAAHLYKTGTLKNQPKAWTDYYLPVAHDLKGN"
FT   CDS_pept        411721..412431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0382"
FT                   /product="transcriptional regulatory protein"
FT                   /note="GntR family"
FT                   /note="ORF_ID:blr0382"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45647"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45647"
FT                   /db_xref="GOA:Q89XD2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XD2"
FT                   /protein_id="BAC45647.1"
FT                   /translation="MEVTHTAPRAARPARLDRARQAAPQVFERLRNAIIALELPPGAPL
FT                   SRAELAGQFGVSSTPVRDALMRLEEEGLVDVFPQHATVVSRIDIGRAQQAHFLRQALEL
FT                   EIVRLLAEKHDDALIIRLDHAIALQQQFAKAGEFEAFMAADNDFHAQLYAAAGKQELWA
FT                   LVRSRSGHIDRLRRLHLPSPGKAQNIVRHHRLITRAIEAGDADAAQQHLRKHLSGTLSE
FT                   LDKIRSHHPEYLTD"
FT   CDS_pept        complement(412432..414603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcpK"
FT                   /note="ORF_ID:bll0383"
FT                   /note="probable methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45648"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45648"
FT                   /db_xref="GOA:Q89XD1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XD1"
FT                   /protein_id="BAC45648.1"
FT                   /translation="MFKSIANTGIRTRLLGGFALICILLAATVIYTVAAVSDISSRIKT
FT                   VVDLRAPVAVASTELVGNLYSTLSVLRGYLLTGDAQGKRDRAAVWADLDRTAAAVDRMA
FT                   EGFSNPQNKTNWSEARALIAEFRQAQDKAELAAFTPSAYPASELLAKEAAPLIATMFAE
FT                   ITAMIDEEEALEATPQRKRLLKTFADVRGNLAAAGSQLRLYVASGEAADRDKFEKPLAT
FT                   FRAALASVGTQADLLTERQASAYRAIARANEAFTPLPQKIFAIRQTPQWNAPVFILSTE
FT                   AAPRAARILDLLDGRKDTDGKRSGGLKSDQQSKLAEDARSVADAVERLLLLQWILLAAG
FT                   LALGTTIAILVARSITRPIVELVGDSARLSGGDTSVEFKTAGRGDEIGVVSQAVAKFRD
FT                   NVIAQQQAAASLAREAEAREAANRNMEDAVEEFRGTSRDLLALVGENAGTMRQTAESLG
FT                   GIANHATSQAASAATASEQTAVNVQTVAAAAEQLASSIVEIGRQIELSNKTVRSAGEVT
FT                   ARSEAEIEGLAHAAQSISSVVDLIQAIAGQTNLLALNATIEAARAGEAGRGFAVVASEV
FT                   KALADQTRNATQDIAQHIAAIQNSTGSAVASVKEVATAMRRIDEVTAAIASAVEEQGAA
FT                   TREISQNVQMAASGTQTLATSIGTVSGAIAETNRSADDVMGAANHVSGAAERLATEVQA
FT                   FFVRLRTGPMDRRNSDDADYRGPDRRNAA"
FT   CDS_pept        414997..415416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0384"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:blr0384"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45649"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45649"
FT                   /db_xref="GOA:Q89XD0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XD0"
FT                   /protein_id="BAC45649.1"
FT                   /translation="MANILIVDDDPAVQITIRLLLERAGHHVTVAGDGHKGLALFEASP
FT                   FDLLFLDIFMPGMDGLETMRHIRALAPAIPIIVISGRSITPDAHAEPDFLKMATKLGAV
FT                   ASLQKPFRADALLAAVSGCLDAGKPEGPDVSTGRR"
FT   CDS_pept        415394..418990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0385"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /note="ORF_ID:blr0385"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45650"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45650"
FT                   /db_xref="GOA:Q89XC9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XC9"
FT                   /protein_id="BAC45650.1"
FT                   /translation="MSVPAADDEGVSSAAGQNTHGHPGTPANISMTLATRLAIAMILLV
FT                   AATVTAVGWLGYRNITQAVIPRVLERVEAQSRLLATNLESYVAGVRGDLVGYRSAAAIN
FT                   GLIRAHLGGGIDALDGVSEQTWRERIAARLAAEIEAKPSYGQFRIIGLDDDQRELVRVD
FT                   RSGPNGAVRVAPDSELERKSERTYFQETIRLAPGEIYVSPIELATRQGGTTALHTPTLR
FT                   AATPLFTPDGKPFGIIIANIDMRPVLDRIRSTTSSGGEIYVVNARGDYLVHPDQTREFG
FT                   SLRAPPTNWRSDFPFFSALAGSPGVSTQLATDGSGRPSGAAIAPALLASKEWVAIIVTI
FT                   PPAVFGRVPAAIQKTSLLVGLLAVLAAASLAVLLARSLTRPIGRLTAAVEAIGSGRPAD
FT                   IPVDASGETGVLARAFAHMVEEMKAKTSALEHEVEERRRTEAVRDQLAVRESLFSAAVQ
FT                   SSDDSIVLQTLDGIIIGWNAAAERLYGYSAEEAIGQPTSILLPPDRREEGKDYLRRIAR
FT                   GERIEHFETVRLRKDGSPVEISVSLSPIRGPSGEIIGASGSARSLTEARRTERALQQQL
FT                   EERRQLFDASQDLIMIMDSQGHIAQISPSCEAILGYRPDDMIGYSGADFIHPAHLEQSR
FT                   EEMRALRRGGHPKLADTRCLHRDGREIWLSWLGNWSDQAKRYFFVGRDMTEARLAEESL
FT                   RESEQLARNIVETALDAFVQTDDRSIILNWSSRAEELFGWRRDEALGRNAIDLIVATGE
FT                   RERVKAGLARFLDSGDGQTLNRRRELVCCRRDGKEFKAELSVTALKRREGILFNVFYRD
FT                   LTDKIASEERIRHAEKMEAVGQLTGGVAHDFNNILTVITGTIEILSDAVAKEPELAAIT
FT                   RMIDEAAGRGAELTQHLLAFARKQPLQPREVDINSLIVDTAKLLRPTLGEQIQIESVFE
FT                   EESCVAIVDPNQLTTAILNLALNARDAMPGGGKLIVETGAAYLDEVYASVNDVRPGHYV
FT                   LIAVSDTGTGIPSNMLTRVFDPFFTSKGPGKGTGLGLSMVYGFIKQSAGHIKIYSEEGH
FT                   GTTIKMYLPPGKTATAVGDGVIPATIEGGHETILVVEDDRLVRDYVLAQLHALGYVTLQ
FT                   AANAAEALAIVAAGKPFDLLFTDVIMPGRMNGRQLADELMKTRPDLRVVYTSGYTENAI
FT                   IHHGRLDSGVLLLAKPYRKSDLARIIRKALLG"
FT   CDS_pept        complement(419103..419738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0386"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:bll0386"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45651"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45651"
FT                   /db_xref="GOA:Q89XC8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XC8"
FT                   /protein_id="BAC45651.1"
FT                   /translation="MAEQTSRGEIFVVDDDPAVRDTLSMVLKAAGYEVICFADGAALLS
FT                   VARNRTPAAILLDVHIPGKSGLDILKELHGEDYPAPIFMISGQGDITMAVGAIKSGALD
FT                   FIEKPFRGSEIVGRLDEAIGAYARRQAENAAPKFGSLHFPGREPLTRREREVLEQFAAG
FT                   ASNKEAGRTLGISPRTIEDHRANIMKKLGARNAADLIRIVMTAAQRAS"
FT   CDS_pept        complement(419908..420306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0387"
FT                   /note="ORF_ID:bll0387"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45652"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45652"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XC7"
FT                   /protein_id="BAC45652.1"
FT                   /translation="MVSPATRSWNGTAPDARSCHAIGCSRRRADRDLHRVAGIRQVLQG
FT                   VAKARPADVEGGTRRGIARRDVVEHENVGGTGLIAVVVLLRACIDHGCVDQAHAALDLR
FT                   DQAAKVGRNQLTAVGLGRRDERWRAGQI"
FT   CDS_pept        complement(420263..420766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0388"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:bll0388"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45653"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45653"
FT                   /db_xref="GOA:Q89XC6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XC6"
FT                   /protein_id="BAC45653.1"
FT                   /translation="MPRSSLSPVPSNLPDVAERRALQLLVVDDDATQRSLITVAAKQAG
FT                   HEVTVAPSVAEAIEKLRAARFDCVTLDLVLEDGDGIDVLREMANAKFAGAVIVISGMDG
FT                   KRRSAARSFARSVGIQLQGLPKPLDLAALRISLANLGKTAMGLPAIHTWGGVASDAIVE
FT                   RHRT"
FT   CDS_pept        complement(420908..421225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0389"
FT                   /note="ORF_ID:bll0389"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45654"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45654"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XC5"
FT                   /protein_id="BAC45654.1"
FT                   /translation="MAEDGKGAERVTFSRGYDVCIMAIDGTWRRDCKLNAISDTDAILT
FT                   VEGSIQGLNLKEFFLLLSSTGLAYRRCELVRVNGAEMDIQFLRGKNRKKRGAAGGHDAA
FT                   A"
FT   CDS_pept        complement(421228..422106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR1"
FT                   /product="protein-glutamate O-methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="ORF_ID:bll0390"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45655"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45655"
FT                   /db_xref="GOA:Q89XC4"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XC4"
FT                   /protein_id="BAC45655.1"
FT                   /translation="MTPTEYEYLRKFLKDNSGLDLSADKQYLIESRLLPLARKAGLSGI
FT                   PELVQKLQGGSRALITDVVEAMTTNETFFFRDKVPFDHFRDTIMPEIIKARAGRRSVRI
FT                   WCAAGSTGQEPYSLAMCLKEMGAALTGWRVEIIATDLSQEVLEKARAGVYSQFEVQRGL
FT                   PIQMLVKYFKQTGETWQINPELRAMIQHRQLNLLHDFAQLGTFDVIFCRNVLIYFDQDT
FT                   KINIFNRLARQIEPDGFLVLGAAETVVGLTDTFRPIPDRRGLYKPNDPRAAVAKPALAG
FT                   VAPRMAVMAGR"
FT   CDS_pept        complement(422168..422539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0391"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:bll0391"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45656"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45656"
FT                   /db_xref="GOA:Q89XC3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XC3"
FT                   /protein_id="BAC45656.1"
FT                   /translation="MVDDSSVVRKIARRILEGLEFQVTEAEDGSKALEICQRQLPDAVL
FT                   LDWNMPVMDGFEFMGHMRRLPGGDQPKVVFCTTENNVAHIAQALSGGANEYIMKPFDKD
FT                   IIADKFAEVGLIPVGQAMV"
FT   CDS_pept        complement(422586..423059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /product="transducer coupling protein"
FT                   /note="ORF_ID:bll0392"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45657"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45657"
FT                   /db_xref="GOA:Q89XC2"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XC2"
FT                   /protein_id="BAC45657.1"
FT                   /translation="MANKTQSTEGAMVEYVTAMIGGQLFGLPISRVQDVFMPERVTRVP
FT                   LSSREIAGVLNLRGRIVTVVDMRARLGLPRPEDGKVPMAVGVDLRGESYGLLIDQIGEV
FT                   LRLPEDGKEENPVNLDPRMAKLAGGVHRLDGQLMVVLDVDRVLELETKVQMAA"
FT   CDS_pept        complement(423141..425990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0393"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /note="ORF_ID:bll0393"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45658"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45658"
FT                   /db_xref="GOA:Q89XC1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XC1"
FT                   /protein_id="BAC45658.1"
FT                   /translation="MDDLLREFLTETSESLDTVDNQLVKFEQEPNNAKILDNIFRLVHT
FT                   IKGTCGFLGLPRLEALAHAGETLMGKFRDGMPVTGQAVTVILSSIDRIKEILAGLEATE
FT                   AEPEGTDRDLIDKLEAMVEQGMAAMSASASPIASGSAQPMPAAGSAAAVADAPPLVPEA
FT                   PAAAAPAKDMTTGSLIDQTLERPLRPGEVSLDELERAFRETAIEAPIPAPIVKAEVKAE
FT                   PAPAPAPVAKEAAKEAAKPAAKEKAAPKKSMADEGASEGDRIANQSIRVNVDTLEHLMT
FT                   MVSELVLTRNQLLEISRRNEDTEFKVPLQRLSNVTAELQEGVMKTRMQPIGNAWQKLPR
FT                   IVRDLSSELGKQIELEMHGADTELDRQVLDLIKDPLTHMVRNSADHGLETPAERLAAGK
FT                   GEQGTIRLSAYHEGGHIIICIADNGRGLNTERIKAKAISSGLVTEAELEKMSEAQIHKF
FT                   IFAPGFSTAAAITSVSGRGVGMDVVRTNIDQIGGTIDIKSVAGEGSSVTIKIPLTLAIV
FT                   SALIVEAAGDRFAIPQLSVVELVRARANSEHRIERIKDTAVLRLRNKLLPLIHLKKLLK
FT                   IDDGAASDPENGFIVVTQVGSQTFGIVVDGVFHTEEIVVKPMSTKLRHIDMFSGNTILG
FT                   DGAVIMIIDPNGIAKALGAAGSSAHDMGDENGAHHIGSGEQTTSLLVFRAGSSQPKAVP
FT                   LGLVTRLEELPADKIEFSNGRYMVQYREQLMPLVAMESVTVASQGAQPILVFADDGRSM
FT                   GLVVDEIIDIVEERLNIEVGGSSQGILGSAVIKGQATEVIDVGHFLPMAFADWFTRKEM
FT                   KPSMHSQSVLLVDDSAFFRNMLAPVLKAAGYRVRTAPTAQEGLAALRAQSFDVVLTDIE
FT                   MPDMNGFEFAEVIRSDNNLGAMPIIGLSALVSPAAIERGRQAGFHDYVAKFDRPGLIAA
FT                   LKEQTAGAAGASELSRAAA"
FT   CDS_pept        complement(426400..426879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0394"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:bll0394"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45659"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45659"
FT                   /db_xref="GOA:Q89XC0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XC0"
FT                   /protein_id="BAC45659.1"
FT                   /translation="MPHGSIIESPKREAQTGTESLRHILVVDDDPMVCMAIEVYLQLNH
FT                   FRVTIAEGGEVGLRALEHGQFDLMIIDIFMPHMRGFESIRVFHERAPTIPLIAMSGYAF
FT                   ANLNSPAPDFLRMALELGAARCLRKPFTPHALLAAVNDCFAEHRSDDVASAARLG"
FT   CDS_pept        427324..428034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0395"
FT                   /note="ORF_ID:blr0395"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45660"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45660"
FT                   /db_xref="GOA:Q89XB9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XB9"
FT                   /protein_id="BAC45660.1"
FT                   /translation="MTTSGFPPNQLLQMLDAADFDLLRPHLATVEMVRESVLGEAGAAL
FT                   RYVYFPHGGSISITLGLSEGQMIEIAMLGRDSVVGSGAALADGIAPADAVVLFPGTASM
FT                   LEIAAFRTIAAASVPFRNLMVRHEQVLLAHAQQSLLCNTLHPVEARLARWLLRARDLSD
FT                   SAILPLTQETLAQMMGVRRNAISLVAHALQRAGIIRYTRGQIEIIDLRALETTSCDCHS
FT                   AVKATHSRLLGALR"
FT   CDS_pept        428143..428925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0396"
FT                   /note="ORF_ID:blr0396"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45661"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45661"
FT                   /db_xref="GOA:Q89XB8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XB8"
FT                   /protein_id="BAC45661.1"
FT                   /translation="MMELARAGIRKFALASPCLTRREAVLETMVRPSNGFLSALTADDY
FT                   ELIRPYLHTVELPHEAVLVETGETLKRAFFPHRGVISLVVNLAKGEHVQVAMIGRDSLL
FT                   GTLSTMGDTCALNTAIVLVPGVASVMDLDRLRIAADQSGTLRTLLTRHGLAVYAQVQQT
FT                   AGCNAAHPVESRLSRCLLHTHDLSGDYRLLLTQEAMAQMIGARRNSVSLVANTLQQANF
FT                   IHYSRGHIQILNLDGLRQTACECYATVKAQYDRLLGQR"
FT   CDS_pept        429061..429459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0397"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="ORF_ID:blr0397"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45662"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45662"
FT                   /db_xref="GOA:Q89XB7"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XB7"
FT                   /protein_id="BAC45662.1"
FT                   /translation="MTKAGKAMFEMTAAPAQAALDAEPAREPGAYAALVREIGEDGAGE
FT                   VRAVFWSETCARLQLFRTLALAQHHAKIAREAHSLKSAAGTFGYARLAALALQLEKTAE
FT                   TLGEAEFGDLLSRMDAAYAAARAQEPQA"
FT   CDS_pept        429557..429805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0398"
FT                   /note="ORF_ID:bsr0398"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45663"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45663"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XB6"
FT                   /protein_id="BAC45663.1"
FT                   /translation="MFTYETVDQKEVRRFRIAQFNGRMATVKAGESTVTGFVRSVLEQE
FT                   SSTPPRWTITIIPNAPKEEIKPLRPISRARAFSEDYF"
FT   CDS_pept        complement(429861..430484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0399"
FT                   /product="transcriptional regulatory protein"
FT                   /note="LuxR family"
FT                   /note="ORF_ID:bll0399"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45664"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45664"
FT                   /db_xref="GOA:Q89XB5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XB5"
FT                   /protein_id="BAC45664.1"
FT                   /translation="MGSQNDTATDSRPSEWYESSAAPAEELDFVRLNAARAKAADEMAA
FT                   AIARELNGPLTALLLYMGEIKHHSDQLAPATGDRAYLQRVVENALTQTERVCGLVKQLA
FT                   GPHKVDSPIPPRIEDAEAKIARAPQPQRVPSPELLGLSGQKRLTKREREVLRLISEGYS
FT                   NKQGALRMQISPRTFESHRAEAMRKLGARNTADLVRAALLHSID"
FT   CDS_pept        430826..431989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0400"
FT                   /note="ORF_ID:blr0400"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45665"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45665"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XB4"
FT                   /protein_id="BAC45665.1"
FT                   /translation="MNEIDRLTEFLQRLTPLSRSCLLSELERLELCGIDMPGSADVQAR
FT                   LRAEFRKDGSTQARATSPSRYFFAPLELLLIDGAPEHANMGRISRNTLTPIWEWICRDL
FT                   LPTMAHDYIKAINDQVAANNPKEVLKVASIFQTKVVKVLENTLASAESAEFARGKLAQY
FT                   TASRSAFDDVKKMQQVLRAGAALPKFNEKLPEKIAKFDDGQVAQITAQLDAFKKAHPEA
FT                   LPFALALVARRLKTSWQLVRLATKAAASKSAADVAAAPYACVVAMVLDRLDDKRLALRI
FT                   ALRHNRVLVARDLLAEIYDTEYALKVRIDGIEHCEWGVRLQQLMDAIAALVAAEVSRFP
FT                   ANVGHILGSRRLRSHDTLGGKLSYLAWKGRDAVQDGAAAFRKLIGQT"
FT   CDS_pept        432234..432749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0401"
FT                   /note="ORF_ID:blr0401"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45666"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45666"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XB3"
FT                   /protein_id="BAC45666.1"
FT                   /translation="MRASRENEFFGRSCRSYPPMHGMSIGKESAMRSNRRTLTMAVLLA
FT                   GALALTSTTMAQTSPPQGNAAPTADNAVLLTVFFKHDQSRPLNELNAQLDRQGFHKAFP
FT                   PPGIEVVSWYVMMGIGQVITLRLPASRLREVNRVIEDTAWGSYRTEFYPTYDYKAVGMA
FT                   QHDKATAN"
FT   CDS_pept        433033..434241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0402"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:blr0402"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45667"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45667"
FT                   /db_xref="GOA:Q89XB2"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XB2"
FT                   /protein_id="BAC45667.1"
FT                   /translation="MNDQIVELAGGRPRTFGRRKVTPRACVADGKRHLRAFLAEVLEDL
FT                   GFVTTECASAEELQTVLTRELPDLILLGIAADGIEPGTFLQTLVREAFDGKVLAVGARE
FT                   SIIVRAVQQVGEEYGLAMLPPLTTPFAAETLRERVAMLLPEEPAPSPAVHVGEALHAGW
FT                   LELWYQPKIDARTLIRNGAEALVRIRHPTWGVVPPAYFIPEAHDPHLRDLSDFVIGRAV
FT                   QDWHYLLEHQSPVDLSINLPASYLKEPQAVRDLCRRVPTHPAFGGLTIEIDSEEAIRDL
FT                   DHLAEVAREVRLHNIGLSIDNLGANWPSLMDRDRLPFIKLKADRHFVTGSGNDRLKRTV
FT                   CRHIVELAQGYGACAIAEGVESRADLVAANELGFDFVQGFLFGKPMPLKKFARSTLTKT
FT                   VME"
FT   CDS_pept        complement(434415..435275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0403"
FT                   /note="ORF_ID:bll0403"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45668"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45668"
FT                   /db_xref="GOA:Q89XB1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XB1"
FT                   /protein_id="BAC45668.1"
FT                   /translation="MQSAGSGWGNGLLGVIIFSGSLPATRVAVGGFSALFLTSARAVIA
FT                   ALIGAAVLGLLRQARPQRKDLASLAIVSIGVVVGFPLLTALALQHITSAHSIVFIGLLP
FT                   LSTAIFAVLRGGERPRPLFWLFAILGSATVGGFALSNDGSASLAGDLLMVAAIVLCGLG
FT                   YAEGAALSRRLGGWQVISWALLLAVPLMVPVAILTWPSTWSGVGAPAWIGLAYVSIFSM
FT                   FVGFIFWYRGLAIGGIARVGQLQQLQPFFGLALAGLLLHEPVAWGMIAATALVVVCVFF
FT                   ARRFA"
FT   CDS_pept        435318..436796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0404"
FT                   /product="transcriptional regulatory protein"
FT                   /note="GntR family"
FT                   /note="ORF_ID:blr0404"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45669"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45669"
FT                   /db_xref="GOA:Q89XB0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XB0"
FT                   /protein_id="BAC45669.1"
FT                   /translation="MARTATIQYNPAKLYGYGRQYTLDSGALTKGRGGTRTVDVMSAIR
FT                   AKVAGRALGAGDRLPSIRSLAATMGVSPSTVVEAYDRLAAEGLIRPRRGSGFYVSPTVT
FT                   PPLALTEVEPRRDREVDPFWVSRQSLDADESVLKPGCGWLPPEWMPEEALRRAARALAR
FT                   TDASVLTNYGSTSGSLALRRLLLTRLAEDAIEASADQLMLTGSGTQATDLICRFLLRPG
FT                   DTVLVDDPCYFNFRALLRAHQARIVSVPYTPSGPDVARFEQILVGERPRLYITNSALHN
FT                   PTGATLSLQTAHRLLTASAAHDLTIVEDDIFGDFEPERSPRLAALDGLNRVIRIGSFSK
FT                   TLSASVRCGYIAGRADWIEHLVDLQVATSFGGPSPVATDIIARVLAGGSYRKHMDELRQ
FT                   RLTRARREVARKLQALGIEPWLMPSGGFFLWCRLTGGQDATSVARAALEEDIVLAPGNV
FT                   FSVSQTASRFMRFNVAQMSDPRMWDVMRRALKAK"
FT   CDS_pept        complement(436901..437506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0405"
FT                   /note="ORF_ID:bll0405"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45670"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45670"
FT                   /db_xref="GOA:Q89XA9"
FT                   /db_xref="InterPro:IPR025833"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XA9"
FT                   /protein_id="BAC45670.1"
FT                   /translation="MMELVASVIRLWQRIPKAVLFGVAVLVQCVLLVLMVADRMQILRE
FT                   GREVTLQTQPVDPRDLLRGDYVVLRYDISQLPAGALAGKPAGERNSVVFVKLAPNVNGL
FT                   YEAVSVHAEPVAVTAPEVLIRGRVPYSCGSPGRTFCDKLTIKYGLESYFVPEGEGKKLE
FT                   QARNQQKLRVVAAVLPSGRAAIKRLLLDGEPVYEEPLY"
FT   CDS_pept        complement(437503..438774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0406"
FT                   /note="ORF_ID:bll0406"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45671"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45671"
FT                   /db_xref="GOA:Q89XA8"
FT                   /db_xref="InterPro:IPR018677"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XA8"
FT                   /protein_id="BAC45671.1"
FT                   /translation="MFDKTYRQRLEADLAQWEADGVIAPAAAVSIRNALPPLSPGVNIA
FT                   VVVGIVGGLLIAAAFLAFVAAHWTEIARLLRFGILIAGMVVAGGLGAWFAAKRRTILAD
FT                   LCASIGAVIFGAGIALVGQMYHLGEDFAGGMLLWSIGAFAAALLTESRGALAVALVAAC
FT                   IWTCMRTYDAPDALHLPFVAVWLLAAALALAWNSRVAAHLVAIAALPWWIATSLRFEFD
FT                   GAQPSFVLANGAALLFGAGLAIAAAPSPRALRLGTVLSIYGAFSLAVVAFLEVTTVDDI
FT                   IRFRTGSAPAQPLWVILCGAAGVILALASAGITKRAGEILAGCSIGLALLAAPLWPVST
FT                   AGEPWFAYAALLCAMLSLVVSGMLDDVRPRIVAGWLGIAGVIAGITWAVKGSLLRRSAF
FT                   LAAAGVVAVAFATALNRALPRAGR"
FT   CDS_pept        439172..440275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0407"
FT                   /note="ORF_ID:blr0407"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45672"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45672"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XA7"
FT                   /protein_id="BAC45672.1"
FT                   /translation="MEFLAQQRGYHQTSRQVINNAVEQTGARSGLSGRPVGTVRRALLC
FT                   LVAATTLALQAGAAGAQTAAESWPNRAITWVVPFGAGGVTDLVSRKIAELLRTRLGQPV
FT                   VVENRPGAGGTIGTEFVARAQPDGYTVLYASGGPMTIQPNLGLAKFNYDPLKSYIHVRG
FT                   VSSANQILVATSAAPYSTLAEFVAYAKTNPGKVNFGSPGPGTAQHLAGEMFQAAAGIKL
FT                   THVPYKSGSSQMTDMMSGILDVSFDYLTVLRPLIDTGKVKVLGTTGTARLAALPDAPTV
FT                   LEAGYPDAVSVGSTWVSVPAGTDPRIVGKLSEALAAVLADPGIVADLATNGQVSIADKG
FT                   SAEMGPFIVEETARYKRVIESAGIAAH"
FT   CDS_pept        complement(440354..441370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0408"
FT                   /note="ORF_ID:bll0408"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45673"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45673"
FT                   /db_xref="GOA:Q89XA6"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XA6"
FT                   /protein_id="BAC45673.1"
FT                   /translation="MVHKQERTEEGNVFHVARRRILAVLTVATFAVLPLTAGKAAYPEQ
FT                   LIKIIVTFPPGGSADTVIRALEPLVTAELKQSLVIENRAGAGGNIGMAAVAQAKPDGYT
FT                   LGVAPAGALTVNPHLNSSMPFELKDLAPITLLAEIPFVLVASANIPAHTTAETVALAKA
FT                   KPGALSIGHGGNSTAMHLTAALFTQRTGIAMELVPYRGTAPATVDVLAGHVPFAVLDIP
FT                   ASKQLILEGKLNAIGVSSARRLASLPDVPTLAESGIAGFESVGWFGLVAPAGTPADIVA
FT                   RLNEAFTKALKDPSVAEKIRTLGAEPAPMSPEQFGRFIQSESAKWGKLISEAGIKAN"
FT   CDS_pept        complement(441414..443105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0409"
FT                   /note="ORF_ID:bll0409"
FT                   /note="probable FAD-monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45674"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45674"
FT                   /db_xref="GOA:Q89XA5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XA5"
FT                   /protein_id="BAC45674.1"
FT                   /translation="MPRGRRIRRTARGAETSMRTQVLVVGAGPVGLTAAMDLASRGIDV
FT                   VVAEIRHAGDPPSVKCNHVSARSMEVFRRLGVAAKLRDAGLPADFPNDCSYRTTATGIE
FT                   LCRIDIPSRARRYSATGGPDTWWPTPEPPHRINQVYLEPILFSHAAAQARITILARTEI
FT                   TDIEQGDDHVVALARDLDSGSSLRIEASFVIGCDGSRSLVRKSIGASLSGTPVIQRVQS
FT                   TFIEAPQLKELMGAHKPAWMVLSLNPRRSGTTVAIDGHDRWLIHNHLKPDEPEFDSVDR
FT                   DWAIRAILGVDERFEYRVLSKEDWVGRRLVADRFRDRRVFICGDAAHLWMPYAGYGMNA
FT                   GIADAVDLCWQLAAHLNGWAPASILDAYEAERQPITEQVSRFAMDHAMKMMAQRGGVSA
FT                   EIEDDTPRGQAARATLARAACDLNVQQYCCAGLNFGYYYDASPIIAYDGETPPAYAMGS
FT                   FTPSTVPGARAPHLFLRDGRSLYDAFGAGYTLLRFDPAIDVARLQSAARERGIPLALVD
FT                   IAPDEANGTYAEKLVLARPDQHIAWRGQVAPADPQGLLARITGAAA"
FT   CDS_pept        443172..444065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0410"
FT                   /product="transcriptional regulatory protein"
FT                   /note="LysR family"
FT                   /note="ORF_ID:blr0410"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45675"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45675"
FT                   /db_xref="GOA:Q89XA4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XA4"
FT                   /protein_id="BAC45675.1"
FT                   /translation="MNVTLRQLRAFTGVYRTRSITRAARELGITQSAASLLIQQLETQL
FT                   GVKLFDRSTRSVQPTLAADEAFHSAERMLGDALGLSRRMRDLAQARAGRVAFLASAGAA
FT                   SALLPLVLAKFRAAHPDIEIDMRDVAADDLVPRLIATDAEFAIGSVEGEFAEMTIETLT
FT                   RGRLSAIGRSTADFAARRALTWDELAQLPTIAMRRETRIRMQIDQALGAQGKHLNPTYE
FT                   VTLINTALAMTAQGLGLAILPATMLPADQFPTLIARPLIRPAITRPVSLLQRQGRTLSP
FT                   AAQAFVAMARTVLAGP"
FT   CDS_pept        complement(444087..444962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0411"
FT                   /product="ABC transporter permease protein"
FT                   /note="ORF_ID:bll0411"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45676"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45676"
FT                   /db_xref="GOA:Q89XA3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XA3"
FT                   /protein_id="BAC45676.1"
FT                   /translation="MRRARNAGRTLAWQMAICACFLSIWQWGYDLHGRLPWLVPDLLDP
FT                   YFVSRPSDIFEHFLILSCLKSKLGVFNGWFNGEFARCMARSENNLWIATAVTLKNTFFG
FT                   FATGVSSGFAAGLVLGRSDRLSAIFQPFITAVNSIPRIALAPIIVLAFGIGDTSKVVTS
FT                   WIVVVFLVFFNTFEGARSIDEGFVNAARLLGASEWQITRTVVIPSTMAWVFASLTPAIS
FT                   FALIGVIVGEFIGAERGIGRLIIESEARAEASGMMVAVIVLMLVGVALSALIWRLQAYL
FT                   LRWQQHNLAE"
FT   CDS_pept        complement(444959..445786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0412"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:bll0412"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45677"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45677"
FT                   /db_xref="GOA:Q89XA2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XA2"
FT                   /protein_id="BAC45677.1"
FT                   /translation="MQALHAPHADAPPEMRRIDVRGLCKTFQLAGTAIEAVRDVSFNVR
FT                   RGEFVALLGPSGSGKSTVLNMIATLVKPTSGQILIDGTPVVPGRAASDVGYVFQRDTLF
FT                   PWRTVADNIGYGLELAGVPVAERKERVRACLVQAGLEGFGNAYPSALSGGMRQRAALMR
FT                   TLVVEPQVLLMDEPFGALDTHTKIDMHDVLLRIWEREQQTVLFVTHDLGEALTLADRII
FT                   LFSARPGRIKESFDVDFARPRNAVKIRETPRYAELFQLIWHSLGEEFIKGRKP"
FT   CDS_pept        complement(445789..446841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0413"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="ORF_ID:bll0413"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45678"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45678"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q89XA1"
FT                   /protein_id="BAC45678.1"
FT                   /translation="MMRTRVTRRSALTIVAGAGVSMAAGRAWADTPSGRVIYPVAIPVY
FT                   QSQFVADRAGFFREAGLDCKLIQGGSGVKTREIIASSQGDIGIGDITHPMQLSNHGRSA
FT                   RVLMPVDTRSNAAIFIIRKDLFDQGITTLEALAKWKRPDGRKPIVAVSSLGGTNHVWAS
FT                   YYLETMGLDDKVTWIGTGNVDTMMGTLKTKQVDVLINSPSILKDSIEQGWGALLFDGTD
FT                   EAVWAKYIGGKVPVTSHFTLQSTIDKDPQKMQAFVTALWRATQWIKEHSPEEIYDAIEP
FT                   YVGSTSRDANVFDIGIMKKVTDYECVIDAESFARGQKVWFREMTGIKPLAMADVVTTSF
FT                   IEAARKAYPA"
FT   CDS_pept        complement(446838..448004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /note="ORF_ID:bll0414"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45679"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45679"
FT                   /db_xref="GOA:Q89XA0"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89XA0"
FT                   /protein_id="BAC45679.1"
FT                   /translation="MDSLCRTSGMNTLSNTITVAVVGGEGIGPEVTDQSHRILKWFSDR
FT                   RGAPVILREAQYGLIPYLATGKVLPDDTVEAMEEADAILWGATGGPETTEVPPAARKAG
FT                   SLLSLRSKYDLYANLRPIVANPALADSAPLKAAVLKDVDFIIIRELTSGIYFGEPRGIE
FT                   TLPDGQRRGFNTQQYTTSQIRRVARTAFELARTRKGRVCSVDKANVLETSVLWREEVTA
FT                   LHEAEFSDVELTHLYVDNAAMQIVRAPSQFDVMVTCNIFGDILSDCAAMASGSLGMLPS
FT                   VSLGPPDRLGRRKALYEPVHGSAPDIAGKGIANPLGSILSVAMMLRITLHRPEDAALLE
FT                   KAVDTALAAGARTADIAEPGAKRLSTQEMGDAVLNALDKVVGKEREHA"
FT   CDS_pept        complement(447974..448609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /note="ORF_ID:bll0415"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45680"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45680"
FT                   /db_xref="GOA:Q89X99"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X99"
FT                   /protein_id="BAC45680.1"
FT                   /translation="MAEPFTKLTAIAAPIMRTNVDTDVIISINRMIGNSVRGSLGKWAF
FT                   GSLRYLPDGSDNPEFILNREPYRAAEILVTGPNFGCGSSREAAVWSLQEMGIRAIIGSG
FT                   FGDIFFANCFQNGILPVVLDKAIIDSLAADIEASQGAGRLTVDLQEQTVTSPSGLRHVF
FT                   EIDPRRRAGLLEGLDEISLTLRRDQEIRGFQASDRTARPWIHFAGHQA"
FT   CDS_pept        complement(448610..450148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /note="ORF_ID:bll0416"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45681"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45681"
FT                   /db_xref="GOA:Q89X98"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X98"
FT                   /protein_id="BAC45681.1"
FT                   /translation="MAPCQTVTAHLRDALLSCFPGLPSVGMIGGTTARQMPIRGGRIVD
FT                   TRGRTLLAKIWDQHVIAHVSDDTDLLHVDRHLLHDLGGSRGLIDLKSRNLPVHNPELTF
FT                   ATPDHAISTASGRAGTITTGQELLAALRTETSASGIRLFDIDQPGQGIVHVIGPELGLS
FT                   LPGCLIVCGDSHTCTHGGLGALAFGIGSSELTHVLATQTIIQRRPKTMRVTFDGRMPFG
FT                   VTAKDLILALIGHVGAAGGTGYAVEYAGSAIRGMPIEGRLTICNLSVELGAKMGLIAPD
FT                   QTTFDYVRGRPYAPQGEMWERAVTAWRTLRSDSDAMFDREVTIDVGTIIPQITWGTSPE
FT                   HVLGVDGRVPDPRDIADPARRGAIEIALDYMGLKPGAPIAGTKVDWVFIGSCTNSRLSD
FT                   LRAAAEVARGRKVAPGVRAWVVPGSETVKRDAVAEGLDKIFIDAGFEWREPGCSMCLAA
FT                   NGETVPPGQRSVSTSNRNFIGRQGPRARTHLASPAMAAAAAVSGAIADVRTMER"
FT   CDS_pept        complement(450185..451138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0417"
FT                   /product="transcriptional regulatory protein"
FT                   /note="LysR family"
FT                   /note="ORF_ID:bll0417"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45682"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45682"
FT                   /db_xref="GOA:Q89X97"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X97"
FT                   /protein_id="BAC45682.1"
FT                   /translation="MTAKIDLLTLQLFVAIVEEQSIAKAAEKKNIAASAVSRRISDIED
FT                   RFQVELLHRHSKGIEPTPAGFALLEHARIVLGNLSRLETELTGYRQGKRGLIRVCANKS
FT                   AILEALADELSLFLERHPLVHIDIEEDLSPAIVRAVMENRADIGIFGGNIDAQDLELLS
FT                   YRSDSLVALVTRDHPLAGRSSVRFRELVDFDFVSLEKGSSIETLCVRAAAALGQHLKVR
FT                   IRVSSFDALFRVIDARMGVGVVPLEIVRGRYGVDSLVTVPLDESWARRELVMGVRDYKS
FT                   LPPVTKLLVDHLRTQDDTGLTTSSVSDRLTVVRSRG"
FT   tRNA            complement(451301..451390)
FT                   /product="trnS-CGA"
FT   CDS_pept        451421..452389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0418"
FT                   /note="ORF_ID:blr0418"
FT                   /note="putative epoxide hydrolase (EC 3.3.2.3)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45683"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45683"
FT                   /db_xref="GOA:Q89X96"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X96"
FT                   /protein_id="BAC45683.1"
FT                   /translation="MVGGVNRRGWRARQGAKGENPLPLSTPSQPSGGTAMEHLTIKANG
FT                   ANFHLVRAGKGKPLLLLHGWPEFWLTWEPVMVRLADRFMLIAPDLRGFGDSDKPDGPYG
FT                   PDGHAADMLALMEGLGIERFAVVGHDVGGAVMQPLARQAPGRLAGLFFFDFVYPGIGPR
FT                   MAAPDRLNHIWYQSFHQMEMAVRLVGASRESCRLYISHFLKGWAHRKDAFDDVLDAFVD
FT                   NFSRVGNLAGGFAHYRASHAGRVAMMKGEAPQLPPIDVPTCVRWAEHDPLFPYAWTDRL
FT                   GETFSALDLAMFPGAGHFPHRENPDHAAAEIAAFFQRVGWS"
FT   CDS_pept        complement(452563..453687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0419"
FT                   /note="ORF_ID:bll0419"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45684"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45684"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X95"
FT                   /protein_id="BAC45684.1"
FT                   /translation="MATDELVATTGIAQHGASRLPSVDVDSFNIEIKDEDGFLGDRASK
FT                   GAFREILDRWRKPLRKTGEDPFGKEPSDQISKKTLDAILIGDDTEASALVHSAIEDFAQ
FT                   QLAYVTRRFLKTKAWAKTERIMVGGGFRDSRLGELAIARTEIILKSEDFKIDMQPIRHH
FT                   PDEAGLIGALHLAPSWIFEAHDSILAVDIGGTNIRCGLVETSWKKAKDLSKAKVVKSEL
FT                   WRHADDEPTREGAVKRLTKMLKGLIAEAETEGFKLAPFIGIACPGVIDADGSIEKGAQN
FT                   LPGNWESSKFNLPASLIEGIPEIGEHDTAILMHNDGVVQGLSEVPFMQDVERWGVLTIG
FT                   TGLGNARFTNRRKDNGKDRDSTENGKKKAKSDKE"
FT   CDS_pept        454016..454405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /product="50S ribosomal protein L21"
FT                   /note="ORF_ID:blr0420"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45685"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45685"
FT                   /db_xref="GOA:Q89X94"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X94"
FT                   /protein_id="BAC45685.1"
FT                   /translation="MFAVIKTGGRQYRVAPDDVLEVGKIEGEVGSIVQLNEVLVVGGDT
FT                   PILGLPTVAGASVAVEVLDHKRGPKVIAFKKRRRKNSRRKRGYRDEITVLRVSEILTDN
FT                   AKPTKGPRPKKEKVAKEATKEDAAA"
FT   CDS_pept        454503..454772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /product="50S ribosomal protein L27"
FT                   /note="ORF_ID:bsr0421"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45686"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45686"
FT                   /db_xref="GOA:Q89X93"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X93"
FT                   /protein_id="BAC45686.1"
FT                   /translation="MAHKKAGGSSRNGRDSKGKRLGIKAFGGEVVIPGNIIARQRGTTW
FT                   HPGLNVGMGTDHTLFAKIEGRVTFQAKANGRTFVSVLPIAEAAE"
FT   CDS_pept        454879..455493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0422"
FT                   /note="ORF_ID:blr0422"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45687"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45687"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X92"
FT                   /protein_id="BAC45687.1"
FT                   /translation="MTSTEPDMLQDFSSTTLREARPSVVATERLTLRRPTLADVRTIAR
FT                   LANDRRVAENTRRLPHPYSQDDAIEFIRATAEIGSETVFLIEHDSGPVGMVGIDCSKPD
FT                   NAELGYWLGVEHWGQGFATEAARGAIDFFFEEFEDDHLHAGARVTNPASRKVLEKCGFQ
FT                   WSGVQLHRFLALGSSTPVDCFRLSRGVWASLKSWSSARRVR"
FT   CDS_pept        complement(455680..456594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0423"
FT                   /note="ORF_ID:bll0423"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45688"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45688"
FT                   /db_xref="GOA:Q89X91"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X91"
FT                   /protein_id="BAC45688.1"
FT                   /translation="MPFFKNLSAYDDRSARLAGIALMVLSIFMFSFGDAMGKFLVGTYS
FT                   VGQLLFLRACAALLLLSPLIWRQRRQFLHLERPRLQLFRVVLSTLEVAAFFLATVYLPL
FT                   ADVITYYLAGPIFVTAMSAIFLSEKVGWRRWTAILIGFCGVVIALRPSAQTVSLPALIA
FT                   LGGSLSFATLMLITRSLRKTPDIVMASSQFVGTFLLGAVLSAFHWVPPTSGSLVIFALA
FT                   GCISVTALFCVNRSLKLAPASVVVPYQYSMIVWAVIFGFVVFGDVPSIATIVGAAIIIG
FT                   AGSYIYLRERDLGRPSNEVNPPA"
FT   CDS_pept        456762..457343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0424"
FT                   /note="ORF_ID:blr0424"
FT                   /note="similar to monoamine oxidase regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45689"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45689"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X90"
FT                   /protein_id="BAC45689.1"
FT                   /translation="MSDWDKPATAELNGLSHSSRRGSDRRLIDKESFDMTDFDPARHRM
FT                   IPTQRWFEDFVVGERFVLPSRTQTSAVFAAFQTASGDTHPVHYDVEYCRSRGMPHLLAH
FT                   GFQTLIHTAPGAGLFPFMVEDSLVGFLEQSSRFLKPVFADDTIYPALEVTELAPGRSTG
FT                   VVTLKSTVFNQRKELVLEGIQKFLIRRRPL"
FT   CDS_pept        457458..458498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cgtA"
FT                   /product="GTP-binding protein"
FT                   /note="ORF_ID:blr0425"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45690"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45690"
FT                   /db_xref="GOA:Q89X89"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X89"
FT                   /protein_id="BAC45690.1"
FT                   /translation="MKFLDEAKVYIRSGDGGNGCVAFRREKFIEFGGPSGGNGGRGGNV
FT                   IIEVADGLNTLIDYRYQQHFKAQKGENGAGSDRHGANGKNIVLKVPMGTQIFDEDRETL
FT                   IHDFTNVGEKFVLAEGGNGGFGNAHFKSSTNRAPRNANPGQPGEERWIWLRLKLIADAG
FT                   LVGLPNAGKSTFLSKVSAAKPKIADYPFTTLHPQLGVVNADGREFVLADIPGLIEGAHE
FT                   GAGLGDRFLGHVERCRVLLHLVDATCEHAGKAYKTVRTELDAYGGLLTDKIEIVALNKI
FT                   DAVEPDELKKQKDRLKRAAKKTPLLLSAATGEGVKEALRALVAVIGEAPVSAKAKSAAE
FT                   AEPWSA"
FT   CDS_pept        458732..460366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0426"
FT                   /note="ORF_ID:blr0426"
FT                   /note="putative phosphonate monoester hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45691"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45691"
FT                   /db_xref="GOA:Q89X88"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X88"
FT                   /protein_id="BAC45691.1"
FT                   /translation="MARAKNVLWIMCDQLRYDYLGCTGHPTLKTPNIDAMAKRGVLFSK
FT                   AYVQSPICGPSRMSFYTGRYMRSHGSHWNGWPLRVGEPTLGDHLKKIGVRNVLVGKTHM
FT                   APDLEGMKALGIPPESMIGVHVAECGFEPYERDDGLHPTGRPRPKYDEYLRKQGFEATN
FT                   PWEHWANSGAAEDGSLQNGWLLVHADKAARVPEEHSETPYMTRRAMDFISEAETDGKPW
FT                   CLHLSYIKPHWPYIAPEPYASMYSTDDMIPVIRSERERQNPHPVFGAYMDMRYSRNMAR
FT                   DDAREKVIPTYMGLITQIDDQMGALMKFLEERGLLDTTMIVFTSDHGDYLGDHWMGEKD
FT                   LFHEQSAKIPLIIIDPSREADATRGTRSDALVEGIDLAPTFVDYFGGKVPGHILEGRSL
FT                   LPLLRGPTPPDWRKVAFSEYDYAMQDVRLKLNQPIERCRLFMVFDGRWKYIHASGFRPM
FT                   LYDLETDPEEFLDRGDDPDCAGIIARLQAELFDWALHPNDHITTPREKIAAYADNQLQV
FT                   KGGVLIGIWDEAELAAIKDGIAQRAKL"
FT   CDS_pept        complement(460411..461475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0427"
FT                   /note="ORF_ID:bll0427"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45692"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45692"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X87"
FT                   /protein_id="BAC45692.1"
FT                   /translation="MQRGLVFGLVLSAGAVLMPATNNGLEGKRMDRRKFMAGCLGGGLG
FT                   LPLLAQAGGAQAQAGLSKIIFPFAAGAGGDTLCRLIAQEMAPVLQRTIVVENRTGGDGL
FT                   IGIKAVKGASPDGSMVLVTTGPTMYLLPMVETTPSFDTAKDFMPVSLLARFEFAVVIGP
FT                   AIDAADFKSFVAWLKAHPDKTSFGVPSNGTIPHFMGSKLEKDLGIPLTRVPYRGSAPIL
FT                   NDLIGGHLSFGIVTLADALPQHRAKGVKIIAVSSAERSPFAPEVPTLKESGIALVADAW
FT                   YGMWLPVGSPPEFASKLGAAASAALAKAEVKEKLTAIGLIPVGSSPDELTKELAANTAF
FT                   WQPIVKATGYKIEN"
FT   CDS_pept        461604..462725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /product="glutamate 5-kinase"
FT                   /note="ORF_ID:blr0428"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45693"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45693"
FT                   /db_xref="GOA:Q89X86"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X86"
FT                   /protein_id="BAC45693.1"
FT                   /translation="MASPELSQFRRIVVKVGSALLVDSDKGEVRTSWLAALADDMAKLH
FT                   KEGRDVLVVSSGSIALGRSRLKLPRGPLKLEESQAAAAVGQIALARIWSEVLGAHGIDA
FT                   GQILVTLQDTEERRRYLNARSTIGKLLEWRAIPVINENDTVATTEIRYGDNDRLAARVA
FT                   TMASADLLVLLSDIDGLYDAPPKNNPNAKLIPVVDSISSEIEAVAGDAESELSRGGMRT
FT                   KVEAAKIATTGGTHMLIASGKIEHPLQAIANGGRCTWFLTPANPITSRKRWIAGTLEPK
FT                   GTLTIDAGAVTALRAGASLLPAGVIKVEGQFARGDAVIVRGPDTSEIGRGLIAYDADDA
FT                   ERIKGRSSPDVMTILGISGRAEMIHRDDLVVGG"
FT   CDS_pept        462974..464281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /note="ORF_ID:blr0429"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45694"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45694"
FT                   /db_xref="GOA:Q89X85"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X85"
FT                   /protein_id="BAC45694.1"
FT                   /translation="MAAPLKAVDGNADRTGDLQALMSDLAARARAAARVLALAPPEQKN
FT                   RALEAMERAIRSNAAAILAANAEDVAEARASSNMTASFIDRLTLTPARVESMAEGIGIV
FT                   RGIADPVGIVTESWQRPNGMTIERVRVPLGVVGVIFESRPNVAADAGVLCLKSGNAVIL
FT                   RGGSDSFRSCRAIHECLVQGLREAGLPEAAITLVPTRDRAAVGMMLSGLNGAIDVIVPR
FT                   GGKSLVARVEQEARVPVFAHLEGVNHVYVDASADLAMAKSIVLNAKMRRTGVCGAAETL
FT                   LVDRAAAATSLKPLVEMLIEAGCEVRGDDVVQKTDARVKPANDDDWDTEYLDAIIAAKV
FT                   VDGVDGAIAHIQNHGSHHTDAIVSENEAAAKKFLSEVDSAIVLHNASTQFADGGEFGFG
FT                   AEIGIATGRFHARGPVGAEQLTSFKYRVHGTGQTRP"
FT   CDS_pept        464323..464949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /note="ORF_ID:blr0430"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45695"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45695"
FT                   /db_xref="GOA:Q89X84"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X84"
FT                   /protein_id="BAC45695.1"
FT                   /translation="MPRFVAQAIPPSTPGMRVGLLGGSFNPPHQAHRAISQFALKRLQL
FT                   DRVWWLVTPGNPLKENGTLHELGARMQAARDVANDPRIEVSCLESVIRTRYTIDTINTL
FT                   RRRLRGLRFVWIMGADNLAQFHRWQDWRRIAGQVPIAVIDRPPQSFRALASPAAKALSR
FT                   YRLPENEAALLADRPAPAWVFLTGLKLNLSSTGLRNPDGSWKGTK"
FT   CDS_pept        465206..465502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0431"
FT                   /note="ORF_ID:bsr0431"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45696"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45696"
FT                   /db_xref="GOA:Q89X83"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X83"
FT                   /protein_id="BAC45696.1"
FT                   /translation="MKAEETVTIDLRGKSAYSDYMIVTTGRANRHVGAIAENVTKSLKE
FT                   TGIKNIHVEGLPNCDWVLIDSGDVIVHVFRPEVREFYNLERLYTQGPGAAKAI"
FT   CDS_pept        465597..466079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0432"
FT                   /note="ORF_ID:blr0432"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45697"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45697"
FT                   /db_xref="GOA:Q89X82"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X82"
FT                   /protein_id="BAC45697.1"
FT                   /translation="MRVAVIAVGRLKQGPERELADRYFERFDEAGRKLGFRELSIHEIP
FT                   ESRARDAATRMAEEAAAIGAYIPDKSILVALDERGQNLDSTVFARHLGRWRDEGAGHTI
FT                   FVIGGADGLSPELRRKAKLAIAFGSATWPHQMVRVMLLEQLYRAATILAGHPYHRA"
FT   CDS_pept        466113..467462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0433"
FT                   /note="ORF_ID:blr0433"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45698"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45698"
FT                   /db_xref="GOA:Q89X81"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X81"
FT                   /protein_id="BAC45698.1"
FT                   /translation="MRAPVLNLLLIASVSGATVLDASVLGASLAQAQTPAPQTAAVSPD
FT                   AIKQREQELEAARARQKSAEEAQAKLKAEISSLGQDRTQLNQQLIDTAANVRSVETKID
FT                   EAEARLKTLNGREQAMRTSLDSRRADIVEVLAALQRAGRRTPPALLVRPEDALQSLRTA
FT                   MLLGAVVPELRGRAEKIASELGELVALRKNIATERDQLASDRDRVRNDQSRLAALVDER
FT                   QRQQAAREKDLDAENSRAIMLSRQVGDLQGLIAKMEQDLQSAAKAAEKAAEAARQAEAK
FT                   AAAGAKSGPGAFKDRSRTSPAIAFASAKGLLPLPVNGNKIRDFGGSDGVGGVQKGISLA
FT                   TKPGSQVTTPCDGWVVYAGPFRSYGQLLILNAGGGYHVLIAGMERISVNIGQFVLTGEP
FT                   VATMGSTSQVASILATNASQPVLYVEFRKDGTPIDPGPWWAANEGEKVRG"
FT   CDS_pept        467459..468814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /product="carboxy-terminal protease"
FT                   /note="ORF_ID:blr0434"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45699"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45699"
FT                   /db_xref="GOA:Q89X80"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X80"
FT                   /protein_id="BAC45699.1"
FT                   /translation="MMRKTSVILLSAATGAALTLFVTQPRAVFMGSSARAATADTYRQL
FT                   NLFGDVFERVRSDYVEKPDDTKLIESAISGMLTGLDPHSSYMDAKSFRDMQVQTRGEFG
FT                   GLGIEVTMEDGLIKVVSPIDDTPASRAGIMANDIITNLDDEAVQGLTLNQAVEKMRGPV
FT                   NTKIKLKIIRKGQDNPLDVTLVRDNIRVRSVRARIEADDIAYIRITTFNEQTTEGLKRE
FT                   VANLSNQIGDKLKGYIIDLRNNPGGLLEEAVTVSDSFLEKGEIVSTRGRNAEETQRRTA
FT                   HAGDLTKGKPVIVLVNGGSASASEIVAGALQDHKRATIVGTRSFGKGSVQTIIPLGSGN
FT                   GALRLTTARYYTPSGKSIQAKGIVPDIEVLQDVPDELKSRTDTKGEASLRGHLKNDGDE
FT                   KTGSQSYVPPDAKDDKALKLADDLLHGIKNSASAAPTPGTDKAATDKPKAAN"
FT   CDS_pept        468963..470186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0435"
FT                   /note="ORF_ID:blr0435"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45700"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45700"
FT                   /db_xref="GOA:Q89X79"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X79"
FT                   /protein_id="BAC45700.1"
FT                   /translation="MTETADDLSAPLGQDKLRRKRRLRLPFTAMQALAMLLGLFLVTFA
FT                   GFAIFNKDPLGGEPMTRIAIREPKATDEKPAASGHGQDSKQESKHETREAPKQAAPGEQ
FT                   KTVTMIDGSTGARHDVVIGAGEADDKGEAASAPPPVMAGIDPKLLEKSRYGMIPVVADG
FT                   SKPFNVYAADADRAKAAKMPVVAIVIGGLGVGAAKTTDAIMKLPAAVTLAFTPYGSDPG
FT                   KIAERARTQRHEIFLQIPMEPYDFPDNDPGPQTLLTSLSADQNMDRLYWHLSRMQGYAG
FT                   ITNFMGARFVATDAAMQPIIREAAKRGLGFFDDGSSPRSIAPQAAASQAMPFGKGDIAI
FT                   DVVPTPAEIDRALNKLESAARERGTAIGTASALPVSIERIGAWTKTLGDRGILLVPLTT
FT                   AMLKSKSS"
FT   CDS_pept        470261..470764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0436"
FT                   /product="invasion protein A"
FT                   /note="ORF_ID:blr0436"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45701"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45701"
FT                   /db_xref="GOA:Q89X78"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X78"
FT                   /protein_id="BAC45701.1"
FT                   /translation="MARYEDLPYRTCVGVMLINAKGLVFIGRRAGGIEHIDDTHVWQMP
FT                   QGGVDPGEDTWAAAKRELYEETSVRSVERLGEVPDWLIYDIPRTVAGRAWKGRYRGQRQ
FT                   KWFAVRFTGKDSEINVENPGGGHKAEFVSWRWEPMKNLPGLIIPFKRPVYERVVKEFSA
FT                   LAEE"
FT   CDS_pept        470869..471372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0437"
FT                   /product="invasion protein A"
FT                   /note="ORF_ID:blr0437"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45702"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45702"
FT                   /db_xref="GOA:Q89X77"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X77"
FT                   /protein_id="BAC45702.1"
FT                   /translation="MSNDNKPYRPNVGIALFNAEGRVLIGHRFKGDGPEIILPGLDWQM
FT                   PQGGVDEGEDLRDAAMRELWEETNVVSASYLGETDWLTYEFPPYDGPQTHRLAKFRGQR
FT                   QKWFALRFTGKDDEIDPLTPQNGQPAEFDAWRWEQLDRVADLVVPFRREVYRAVAQQFA
FT                   PFAS"
FT   CDS_pept        complement(471539..473185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0438"
FT                   /note="ORF_ID:bll0438"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45703"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45703"
FT                   /db_xref="GOA:Q89X76"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X76"
FT                   /protein_id="BAC45703.1"
FT                   /translation="MKRKIAAIFAADIAGYSRLVAEDEEETLRRLASYREVIDDFIAKA
FT                   TGRIFNTAGDAVLAEFPSAVDAVRCAIDIQESLRTRNMAYPPSRQMSFRIGITIGDVVE
FT                   RNGDLLGDGVNIAARLEGLAEVGGICVSRAVHEQVANKLSVQFADIGAQEVKNIPTPVH
FT                   AYMVAMRREDGTYSKPQLKKPASRLAAAPVWMWPLVVAVVSVVAIVVTGFLYNTKLKQT
FT                   ATAVVTPAATPSAAPSATPTQLAKAQVAPTAPPNAGAAMAPMPAPSPSASPMTGKFAAD
FT                   SVPFINERIRNYLAGDYSAAGDYKAFALNIGGFTGSALNQPNEEAARNAALDQCQKRAD
FT                   AAQSPRRCELYAVGNNVVYTHGKPPMPPSPYFRHDAMTERTFASKDFPMVRDPQKVRLE
FT                   NMFVPAAKSRSVALGPGGQYFMVLGSSSPEESARRALESCGAIAGVACMIVAVDDNFVV
FT                   PIPTLLRITGFFHAASNASIVADARDEVVRKLADGMGWNAVAVGTAGRPGLGLKAADEQ
FT                   TAVNSALADCARRDSDCHVIAIGPFTVGPTN"
FT   CDS_pept        complement(473348..473755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /product="ATP synthase epsilon chain"
FT                   /note="ORF_ID:bll0439"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45704"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45704"
FT                   /db_xref="GOA:Q89X75"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X75"
FT                   /protein_id="BAC45704.1"
FT                   /translation="MATFHFDLVSPEKLAFSGEVDQVDIPGVEGDFGVLAGHAPVVAAI
FT                   RPGILTVTTAGRHEKIIVLGGLAEVSEKGLTVLADVATSLDELDRAQFAETIAEMEEGL
FT                   KEHEGGELDLAIERLDHYKSIQQQLSSTAMH"
FT   CDS_pept        complement(473842..475275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /product="ATP synthase beta chain"
FT                   /note="ORF_ID:bll0440"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45705"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45705"
FT                   /db_xref="GOA:Q89X74"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X74"
FT                   /protein_id="BAC45705.1"
FT                   /translation="MAAQSGRVTQVIGAVVDVQFEGHLPAILNSLETKNGGNRLVLEVA
FT                   QHLGESTVRTIAMDTTEGLVRGQEVTDTGSPIRVPVGEGTLGRIINVIGEPIDEAGPVK
FT                   SEGLRAIHQEAPTYTDQSTEAEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIQE
FT                   LINNVAKAHGGYSVFAGVGERTREGNDLYHEFIESKVNADPHNPDPSVKSKCALVFGQM
FT                   NEPPGARARVALTGLTIAEDFRDKGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQ
FT                   PTLATDMGALQERITTTQKGSITSVQAIYVPADDLTDPAPATSFAHLDATTTLSRSIAE
FT                   KGIYPAVDPLDSTSRMLSPLVVGEEHYAVARQVQQVLQRYKALQDIIAILGMDELSEED
FT                   KLTVARARKVERFMSQPFHVAEIFTGSPGKFVDLADTIKGFKGLVEGKYDHLPEAAFYM
FT                   VGTIEEAVEKGKKLAAEAA"
FT   CDS_pept        complement(475358..476230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /product="ATP synthase gamma chain"
FT                   /note="ORF_ID:bll0441"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45706"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45706"
FT                   /db_xref="GOA:Q89X73"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X73"
FT                   /protein_id="BAC45706.1"
FT                   /translation="MASLKDMRVRIASTKATQKITKAMQMVAASKLRRAQTAAEAARPY
FT                   ADKMSAVISNIAGAAAGSPGAPALLAGTGRDQVHLLLVCTGERGLSGAFNSSIVRLARE
FT                   RALALMAQGKEVKFFCVGRKGYEQLRRQFDKQIVEHLDLRSVRQLGFVNAEDIAKKVLA
FT                   RFEAGEFDVCTLFYSRFRSVIAQIPTAQQIIPLVVEEGTAASTTSYEYEPEEDEILTRL
FT                   LPRNLAVQIFRALLENNASFYGAQMSAMDNATRNAGEMIRKQTLVYNRTRQAQITKELI
FT                   EIISGAEAV"
FT   CDS_pept        complement(476405..477934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /product="ATP synthase alpha chain"
FT                   /note="ORF_ID:bll0442"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45707"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45707"
FT                   /db_xref="GOA:Q89X72"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X72"
FT                   /protein_id="BAC45707.1"
FT                   /translation="MDIRAAEISAILKDQIKNFGQEAEVSEVGQVLSVGDGIARVYGLD
FT                   NVQAGEMVEFENGTRGMALNLETDNVGVVIFGADREIKEGQTVKRTRAIVDAPVGKGLL
FT                   GRVVDALGNPIDGKGPIQADKRMRVDVKAPGIIPRKSVSEPMATGLKAIDALIPIGRGQ
FT                   RELIIGDRQTGKTAIALDTILNQKPLNAQPDENIKLYCVYVAVGQKRSTVAQFVKVLEE
FT                   QGALEYSIIVAATASDPAPMQYIAPFTACTMGEFFRDNGMHAVIIYDDLSKQAVAYRQM
FT                   SLLLRRPPGREAYPGDVFYLHSRLLERAAKLSKDHGSGSLTALPIIETQANDVSAYIPT
FT                   NVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKATKKVAGKIKGELAQYRE
FT                   MAAFAQFGSDLDASTQRLLNRGSRLTELLKQPQFSPLKMEEQVCVIWAGTNGYLDPLPV
FT                   NKVRAFEDGLLSLLRGKNVEILNSIRDSRDLSDDTAAKLKSVVEGFAKSFA"
FT   CDS_pept        complement(477934..478494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /product="ATP synthase delta chain"
FT                   /note="ORF_ID:bll0443"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45708"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45708"
FT                   /db_xref="GOA:Q89X71"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X71"
FT                   /protein_id="BAC45708.1"
FT                   /translation="MAAEDTSVSGVSGRYATALFELARDQKAVDEVKADLDRFEALLGE
FT                   SADLKRLVRSPVFAADAQSRALTAVLDKVGIAGISANFLKVLTANRRLFVVADVIRAYR
FT                   ALVAKFKGEATADVTVAEALSDKNLDALKVALKSVTGKDVALNVKVDPSIIGGLVVKLG
FT                   SRMVDGSLRTKLNSIKHAMKEAG"
FT   CDS_pept        479153..479650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0444"
FT                   /note="ORF_ID:blr0444"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45709"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45709"
FT                   /db_xref="GOA:Q89X70"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X70"
FT                   /protein_id="BAC45709.1"
FT                   /translation="MLSFKTLGTVTRPRTAIAFIAATLFIGGTATEASAKSRHHRHHHR
FT                   HHAQTDANAGSDWRNANAAMTPSSGTGHSFSGMASYYGNESGSRTASGQRFNQNAMTAA
FT                   HRSLPFGTKLRVTHGGSSVIVTINDRGPFIRGRVLDLSTGAARAIGLTGAGVGRVTAEV
FT                   IS"
FT   CDS_pept        complement(479883..482093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /product="primosomal protein N'"
FT                   /note="ORF_ID:bll0445"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45710"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45710"
FT                   /db_xref="GOA:Q89X69"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037274"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X69"
FT                   /protein_id="BAC45710.1"
FT                   /translation="MDHTSRSSTASANATRMVDVLVPVALDQTYSYKVPRGMELKAGDL
FT                   VGVPLGPREVLAVVWAENANPDPRLHNRLKEVSEKLDLQPLKPELRSVVDWVANYTLSP
FT                   RGMVLRMCLRMGENLGPERVRPGVRLIGDPPRRLTPARQRVIAVLSDRLLHGKSEAAKE
FT                   AGVSAGVIDGLVDEGTLTVEPMPPPPPPPAPDPDFGRPDFTPLQRTAVDTMRALAANGT
FT                   FHVALLDGVTGSGKTEVYFEAVAEAIRRGRQSLILMPEIALTGQFLDRFAQRFGVRPIE
FT                   WHSELTPRTRARNWAAISEGSAPVVVGARSALFLPYANLGLIVVDEEHDQAYKQDEGVH
FT                   YHARDMAVVRAHIAKIPIVLASATPSVESEVNARKNRYQRIALPSRFGGQHMPHIEAID
FT                   MRREPPARGRFISPRLAGEIRTAIERREQALLFLNRRGYAPLTLCRACGHRFACTICDA
FT                   WLVDHRFRQRLVCHHCGFSMPRPHVCPNCSAEESLVAVGPGVERLQEEAAALFPEARTM
FT                   VLSSDLITSIETMRSELAEIAEGRVDIIIGTQLVAKGHNFPRLNLVGVVDADLGLSNGD
FT                   PRAAERTWQLLNQVIGRAGREQGRGVGYLQTHQPDHPVMKALIACDREAFYDSEIDLRE
FT                   RTLYPPFGRLASLIISAGDRPSAEGFGRRLVALAPRDERVVVLGPAEAPLAVIKGRYRF
FT                   RILVKSARGFDLSDYLRNWLAVCPKPKGNQKLEVDVDPQSFL"
FT   CDS_pept        482206..483171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /note="ORF_ID:blr0446"
FT                   /note="probable site-specific integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45711"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45711"
FT                   /db_xref="GOA:Q89X68"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X68"
FT                   /protein_id="BAC45711.1"
FT                   /translation="MSKAAAPQIELASADPSIAQEMTRWLSHLGAERRLSPKTLEAYGR
FT                   DLRQCLDFLCNHWGERVTLKRFAALEATDVRAFMAMRRADDIAGRSLMRALAGLRSFGR
FT                   FLEREGKGKVGALSAIRAPKVAKSLPKPLPMASAKRLADADERAGEERETWILARDAAV
FT                   MALLYGSGLRISEALGLKRREVPKPGEGDVLVVTGKGNKTRMVPVLQNVLALVQEYVSM
FT                   CPYPLPAEGPIFVGARGGPLSPRIIQLAMERLRGALGLPDSATPHALRHSFATHLLSRG
FT                   GDLRAIQELLGHSSLSTTQIYTGIDSERLLEVYASAHPRR"
FT   CDS_pept        483272..483862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0447"
FT                   /note="ORF_ID:blr0447"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45712"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45712"
FT                   /db_xref="GOA:Q89X67"
FT                   /db_xref="InterPro:IPR025570"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X67"
FT                   /protein_id="BAC45712.1"
FT                   /translation="MSAHESMEHAEHAEHASGSNKKIALLIAVLALFLAISETLGKGAQ
FT                   TESISKNVEAANLWAFFQAKSIRRTVVLTAAEQGKLTVVGATDDAMKAAVQKQVDDWTK
FT                   TAQRYRSEPETGEGTEQLAEKAKHAEHERDEATAKYHHFELASAAFQIGIVLASATIIT
FT                   GIFALAYVGGLLTLAGLLMTALGLWWPHLLHLH"
FT   CDS_pept        complement(484059..484589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0448"
FT                   /note="ORF_ID:bll0448"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45713"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45713"
FT                   /db_xref="GOA:Q89X66"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X66"
FT                   /protein_id="BAC45713.1"
FT                   /translation="MLRRLLQPVWVLLAIIFLIEAWLWDHLEPIVARVVAAIPLARFKQ
FT                   WLTERVDALSPAMTLIVFAVPIIPLFPLKLVGLWLLTHEYWTSAVFTILFAKLVGVGVT
FT                   AFVFDVTRDKLLEMHWFERIYDLVMKVRAKAHLLVDPIKQRIRELITGNGEGWSARTLR
FT                   LIQRFRKSVHQAR"
FT   CDS_pept        complement(484624..486024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="ORF_ID:bll0449"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45714"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45714"
FT                   /db_xref="GOA:Q89X65"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X65"
FT                   /protein_id="BAC45714.1"
FT                   /translation="MATYDLVVIGTGPGGYVCAVRAAQLGMKVAVVEKNATLGGTCLNV
FT                   GCMPSKALLHASEMFEEAAHSFAKMGVSVSEPKLELPAMMNFKQQGIDGNVKGVEFLMK
FT                   KNKIDVLKGTGKILGTGKVEVSADGKSQVVETKSIVIATGSDIARLKGIEIDEKRIVSS
FT                   TGALSLDKVPGKLLVVGAGVIGLELGSVWKRLGAEVVVVEFLDRIMPGMDGEIAKQFQR
FT                   ILEKQGFAFKLGAKVTAVDTSGKTLKATIEPAAGGAAETLEADVVLVCIGRVPYTDGLG
FT                   LKEAGVALDNRGRVQIDPHFATSLKGVYAIGDVVAGPMLAHKAEDEGVAVAEIIAGQAG
FT                   HVNYDVIPGVVYTTPEVSSVGKTEEELKQAGVAYTVGKFPFTANGRSKVNQTTDGFVKI
FT                   LADAKTDRVLGVHIIGREAGEMIHEACVLMEFGGSAEDLARTCHAHPTRSEAIKEAALA
FT                   VGKRAIHM"
FT   CDS_pept        complement(486081..486842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scdh1"
FT                   /note="ORF_ID:bll0450"
FT                   /note="putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45715"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45715"
FT                   /db_xref="GOA:Q938Q0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q938Q0"
FT                   /protein_id="BAC45715.1"
FT                   /translation="MEARMTDKVVVITGGSRGIGRATAIAAAARGFRVVVGYASNKQAA
FT                   DEVVAQIAASNGKAIAVKCDVAEESDILELFKQADKFGTLGALVNNGGIVGKSGVRVDE
FT                   MSAERIQRVMAVNVTGSILCAREAVKRMSTKHGGKGGVIVNLSSVAARLGAPNTYVDYA
FT                   ASKGAVDSFTVGLGYEVAGEGIRVAAIRPGLIDTEIHAAGGEPDRAHRLAHLVPMKRVG
FT                   TAEEIANAIVWLMSDDASYVTSAILDVSGGR"
FT   CDS_pept        complement(486896..488140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /product="dihydrolipoamide S-succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="ORF_ID:bll0451"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45716"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45716"
FT                   /db_xref="GOA:Q89X64"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X64"
FT                   /protein_id="BAC45716.1"
FT                   /translation="MTEIRVPTLGESVTEATIGRWFKKAGDPVAVDEPLVELETDKVTI
FT                   EVPAPSAGTLSEIIAADGATVAVGALLGQITEGAAGAAKPAAAPAKPAAAPAAAAAAAA
FT                   PAPAAKAPPADAPLAPSVRKLSAETGIDASTVPGSGKDGRVTKGDMLAAIERAASAPTP
FT                   VNQPAAAVQVRALSPADDAAREERVKMTRLRQTIARRLKDVQNTAAMLTTFNEVDMTNV
FT                   MALRAHYKDAFEKKHGSKLGFMGFFTKAVVQALKDIPAVNAEIDGTDLIYKNYYHIGVA
FT                   VGTDKGLVVPVVRDCDHKSIADIEKGIADFGRRARDGQLKIDEMQGGTFTITNGGIYGS
FT                   LMSTPILNAPQSGILGMHKIQERPMVVAGKIEVRPMMYLALSYDHRVIDGKEAVTFLVR
FT                   VKESLEDPARLVLDL"
FT   CDS_pept        complement(488300..491257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /product="alpha-ketoglutarate dehydrogenase"
FT                   /note="ORF_ID:bll0452"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45717"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45717"
FT                   /db_xref="GOA:Q89X63"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X63"
FT                   /protein_id="BAC45717.1"
FT                   /translation="MSRQDANAAFALSSFLQGTNATYIDEIYARYEKDPSSVDAEWQEF
FT                   FKSLKDQPDDVRRNAEGPSWERANWPLTPQDDLTSALDGNWAEVEKAVGGKIAAKAQAK
FT                   GADISSADLLQATRDSVRALMLIRSYRMRGHFHAKLDPLGIEAPRNREELDPRTYGFSE
FT                   ADFDRKIFLDHVLGLEYGTLREITAICERTYCQTLGVEFMHISNAAQKAWIQERIEGPD
FT                   KEISFTREGRRAILTKLVEAEGFEKFCDTKFTGTKRFGLDGAESLIPALEQIIKRGGNL
FT                   GVKEIVLGMPHRGRLNVLTQVMGKAHRALFHEFKGGSANPDAVEGSGDVKYHLGASSDR
FT                   EFDGNRIHLSLTANPSHLEIVDPVVLGKVRAKQDQHGDPPDMRISVMPLLMHGDAAFAG
FT                   QGVVAECFGLSDLKGYRTGGSVHFIVNNQIGFTTYPRYSRSSPYPSDVAKMIDAPIFHV
FT                   NGDDPEAVVFAAKVATEFRQKFHKPVVIDMFCYRRHGHNEGDEPAFTQPVMYKKIAAHP
FT                   STLELYARRLISEGVMTEGEVDKAKADWRARLDAEFEAGTSYKPNKADWLDGKWAGFKI
FT                   ADQEEDARRGVTGVDITALKDIGRKITKVPDGFRVHRTIQRFLENRSKAIDSGAGIDWA
FT                   TGEALAFCSLLNENHHVRLSGQDSERGTFSQRHSVLIDQEDESRYTPFNHLGHEQGHYE
FT                   VINSLLSEEAVLGFEYGYSLAEPNTLTLWEAQFGDFANGAQVVFDQFISSGERKWLRMS
FT                   GLVCLLPHGYEGQGPEHSSARLERYLQMCAEDNMQVVYPTTPANYFHVLRRQLHREIRK
FT                   PLILMTPKSLLRHKRAVSRLEELAKGTTFHRILYDDAQMLPTDAIKLVPDEKIRRIVLC
FT                   SGKVYYDLYEEREKRGIDDIYLMRVEQLYPVPLKALVAELSRFKKAEVVWCQEEPRNMG
FT                   AWHFIEPYLEWVLNQVNGVSRRPRYVGRAASAATATGLMSKHQAQLKAFLDEALS"
FT   CDS_pept        complement(491395..492279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /product="succinyl-CoA synthetase alpha chain"
FT                   /note="ORF_ID:bll0453"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45718"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45718"
FT                   /db_xref="GOA:Q89X62"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X62"
FT                   /protein_id="BAC45718.1"
FT                   /translation="MSILIDKNTKVICQGFTGKNGTFHSEAAIAYGTKMVGGTSPGKGG
FT                   STHLGLPVFDTVRDAREKTGADASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVID
FT                   MVRVKRSLAGSKSRLIGPNCPGVMTAGECKIGIMPANIFKTGSVGIVSRSGTLTYEAVF
FT                   QTSQEGLGQTTAVGIGGDPVKGTEFIDVLEMLLADPKTESIIMIGEIGGSAEEDAAQFL
FT                   KDEAKRGRKKPMVGFIAGVTAPPGRRMGHAGAIISGGKGDAGSKTDAMKSAGITVSPSP
FT                   ARLGHTLAEKLKG"
FT   CDS_pept        complement(492314..492793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0454"
FT                   /note="ORF_ID:bll0454"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45719"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45719"
FT                   /db_xref="InterPro:IPR011473"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X61"
FT                   /protein_id="BAC45719.1"
FT                   /translation="MAQDHLAASSPLAEHARLAAFAGEWDGEEVVFPSRWTAGGPATSH
FT                   TVARMDLNGFYLIQDSVQMRDGKQIFATHGIFTFDREDRTYKLFWYDSLGYTPPSPASG
FT                   GWVGKTLTLVRGSLRGNARHVYEIIDDNSYSLKIQFSPDAEGWADVLTGVYRRIH"
FT   CDS_pept        complement(492798..493994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /product="succinyl-CoA synthetase beta chain"
FT                   /note="ORF_ID:bll0455"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45720"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45720"
FT                   /db_xref="GOA:Q89X60"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X60"
FT                   /protein_id="BAC45720.1"
FT                   /translation="MNIHEYQAKALLGEFGVPISKGVPVLKAADAEAAAKALPGPVYVV
FT                   KSQIHAGGRGKGKFKEASAGDKGGVRIAKSAAEVSEFAKQMLGATLVTIQTGPAGKQVN
FT                   RLYIEDGSDIDKEFYLSLLVDRETSRVSFVVSTEGGVNIEDVAHNTPEKIVTFSVDPAT
FT                   GIMGHHGRTVANALKLSGDLAKQAEKLTAQLYAAFVAKDMSMLEINPLVVTKQGQLRVL
FT                   DAKVSFDDNALFRHPEVLALRDETEEDAKEIEASKYDLNYVTLDGNIGCMVNGAGLAMA
FT                   TMDIIKLYGMAPANFLDVGGSASKEKVAAAFKIITADPNVKGILVNIFGGIMKCDVIAE
FT                   GVTAAVREVGLSVPLVVRLEGTNVELGKKIILESGLNVVPADNLDDAAQKIVKAVKGG"
FT   CDS_pept        complement(494219..495187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /product="malate dehydrogenase"
FT                   /note="ORF_ID:bll0456"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45721"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45721"
FT                   /db_xref="GOA:Q89X59"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X59"
FT                   /protein_id="BAC45721.1"
FT                   /translation="MARDKIALIGSGQIGGTLAHLIGLKELGDVVMFDIAEGVPQGKAL
FT                   DIAQSSPVDGFDAHYTGANSYEALDNAKVCIVTAGVPRKPGMSRDDLLSINLKVMEQVG
FT                   AGIKKYAPDAFVICITNPLDAMVWALQKASGLPHKKVVGMAGVLDSARFRYFLADEFNV
FT                   SVEDVTAFVLGGHGDTMVPLVKYSTVAGIPLPDLVKMGWTSQARLDEIVDRTRNGGAEI
FT                   VNLLKTGSAFYAPAASAIAMAESYLRDKKRVLPSAAYLNGEYGVKDMYVGVPVVIGSKG
FT                   VERVVEIELAGKDREAFDKSVGAVQGLVDACKKIAPDLLGR"
FT   CDS_pept        complement(495450..496634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0457"
FT                   /note="ORF_ID:bll0457"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45722"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45722"
FT                   /db_xref="GOA:Q89X58"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X58"
FT                   /protein_id="BAC45722.1"
FT                   /translation="MLSTPSSQFREAYQAQIADGAIEPDAAQAEVAEAYAALDQRLGSY
FT                   KPQRKQGLLSRLFSSDKDEAPHGLYIHGEVGRGKTMLMDLFFQHSSVEHKHRAHFHEFM
FT                   ADVHERIYDYRQSIARGEIADGDVIALTANAIFEESWLLCFDEFHVTDIADAMILGRLF
FT                   AKLFELGTVVVATSNVAPEDLYKGGLNRSLFLPFIKQITDHMDVARLDARTDFRLEKLQ
FT                   GVPMWLTPADGDADAVLDRAWSRMSGSAKCKSRDISIKGRILHVPCSAHGVARFSFTDL
FT                   CEKPLGASDYLRLAHDYHTILVDHIPVMDFSQRNAAKRFITLIDTLYDNAVKLMASADA
FT                   NPISLYLADEGNEANEFKRTASRLIEMSSESYLALPHGRKDSTASGSTKGLVET"
FT   CDS_pept        complement(496737..497273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /product="2'-5' RNA ligase"
FT                   /note="ORF_ID:bll0458"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45723"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45723"
FT                   /db_xref="GOA:Q89X57"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X57"
FT                   /protein_id="BAC45723.1"
FT                   /translation="MPRLFTGLEIPAEIGQTLSNLRGGLPGARWIDPENYHVTLRFIGD
FT                   IDGVSANEIASMLFRVNRKPFEVKVQGLTSFGGRKPRAVVATIAPSKPLIELQAELERM
FT                   MQRIGLNPEGRKFIPHVTLARLHDATDRDVADYLSLRGYFPSKAFMAERFVLFSSRAST
FT                   GGGPYVVEDAYELCE"
FT   CDS_pept        complement(497448..498206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0459"
FT                   /product="esterase"
FT                   /note="ORF_ID:bll0459"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45724"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45724"
FT                   /db_xref="GOA:Q89X56"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X56"
FT                   /protein_id="BAC45724.1"
FT                   /translation="MAMVSGVVPASEEDSMRVSMVRSYGNSDSAVERRYGLFMHIAVLM
FT                   LAVMTIATNASAQAQPAAQPIKLVVLGDSLSAGLGLPAQEAFPTKLQKALQTKGIEVGM
FT                   TNAGVSGDTASGGRDRLDWSVPEGTEGVIVELGANDALRGIDPGLTRAALTDIVQRLKA
FT                   RGIPVMLCGMLAPPNYGADYAARFNSIYPDLAKQFDVPLYPFFLDGVAADAKLNQADGI
FT                   HPTAAGVDIIVGNMMPTVEAFLRNISEQRR"
FT   CDS_pept        498148..498870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0460"
FT                   /note="ORF_ID:blr0460"
FT                   /note="probable ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45725"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45725"
FT                   /db_xref="GOA:Q89X55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X55"
FT                   /protein_id="BAC45725.1"
FT                   /translation="MDTRIESSSLAGTTPDTIAISNVNLSLGTGAARVHILKDISLRVA
FT                   SGETIGLIGPSGSGKSTLLMVMAGLERPDSGEVVVNGTPFNALDEDALARFRGRQVGIV
FT                   FQSFHLIPTMTALENVAVPLELAGNPDAAKRAAQELQSVGLGDRLHHYPTQLSGGEQQR
FT                   VALARALAPDPAILVADEPTGNLDEATGKQIVDLLFTKHAERGMTLVLVTHDSSLAHRC
FT                   DRVIRLRSGRIDTQSAPA"
FT   CDS_pept        498867..501437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0461"
FT                   /note="ORF_ID:blr0461"
FT                   /note="probable ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45726"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45726"
FT                   /db_xref="GOA:Q89X54"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X54"
FT                   /protein_id="BAC45726.1"
FT                   /translation="MSAAAEPFVRPNAAALSLRYALRELRGGLRGFYVFIACIALGVMA
FT                   IAGVGSVSASLSDGLAREGRTLLGGDVSFVLFQREAKPEEVAFLRSRGTVSTAATLRGM
FT                   ARSADGQLALVEMKAVDDTYPMLGQLTLAPQLAMSDILAERDGAFGAAADPTLLARLSL
FT                   KTGDRVTIGSATFQIRSTVEAEPDKLAGGIGFGPRFLISEAGLRATGLIQPGSLVRWVY
FT                   RVKLPDTANNERATDAFIADARNAAPQAGWEVRSRSNASPQLERNISRFTQFLTLVGLA
FT                   ALLVGGVGVANAVKSHIDRKLEVIAAFKAVGATGRDVFGIYLAQVILLAAIGSVIGLAL
FT                   GAAMPFAIVGLFGKLLPLPVVPAVHADELALSFVYGLLTALAFGLWPLGRVHDVPVAAL
FT                   FRDTISSEWHRPRWSYLVFMGVVIALLVAVVIGLSFDKRIAAVFVASSVVVFALLRGIA
FT                   ALLMTIARRMPRTRLPMLRLAIANIHRPGALTPSVVLSLGLGLAVLVTITQIDGNLRRQ
FT                   FLAALPDQAPSFFFIDIPSTQAAQFDGYLRQIAPGAKVEDVPMLRGRIVAARGVRAEEL
FT                   KPTTDSEWVLQSDRGLTYTGELPKGSKVVEGEWWSADYSGPPLVSMEKKIADGLGLKLG
FT                   DEVVVNVLGRDIPAKISNLRNIDWQGLGINFVLVFSPNAFKGAPHTHIATLTEAGSNAE
FT                   GDGRIIKQVADTYPMVTSVRVREVMETVGSVVTNLALAIRGASAVTLISAILVLGGALA
FT                   AGHRHRVYDAVILKTLGATRLRLLGAYALEYLLIGLATAVFGVIAGSIAAWMIVTRLMT
FT                   LSFVWQAGSAAGVVVAALVVTVGLGLAGTLLALNKKPATVLRNL"
FT   CDS_pept        501662..502498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0462"
FT                   /note="ORF_ID:blr0462"
FT                   /note="probable ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45727"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45727"
FT                   /db_xref="GOA:Q89X53"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X53"
FT                   /protein_id="BAC45727.1"
FT                   /translation="MATLMPDRPTNGNSTMSDLDRNYASPFGRAAGRVDAATVDAGLRA
FT                   YMLRIYNYMSIGLAITGLAALGVYMAAVTDVPTPEAVRVGKLFLTPFGYAMFVSPLKWL
FT                   FMLAPLAMVFVISAGINRLAPSTAQILFWVFSALMGISLSSIFLVFTHTSIVRVFFITA
FT                   ATFGALSLYGYTTKRDLTGMGSFLFMGLIGIIIASLVNLFLASSMLQFIVSVVGVLVFA
FT                   GLTAWDTQRLKNDYIYGYAAAGGDIAERAAITGALSLYLNFINLFTLLLQLLGQRD"
FT   CDS_pept        502727..503257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0463"
FT                   /product="acetyltransferase"
FT                   /note="ORF_ID:blr0463"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45728"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45728"
FT                   /db_xref="GOA:Q89X52"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X52"
FT                   /protein_id="BAC45728.1"
FT                   /translation="MSAPEIRPTLEADLPAITAIYQQAVRVGTATFELEPPDLAEMTRR
FT                   YRALVDGGYPYFVAILDGRVAGYAYAGVYRPRPAYRFTVENSIYLDPSFHRRGVGSLLL
FT                   ERLIAECEARGFRQMIAVIGDSANAGSIGVHTKGGFRMIGTHPNVGLKFGRWLDTVMMQ
FT                   RELGEGASTVPGK"
FT   CDS_pept        complement(503377..503748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0464"
FT                   /note="ORF_ID:bll0464"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45729"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45729"
FT                   /db_xref="InterPro:IPR021252"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X51"
FT                   /protein_id="BAC45729.1"
FT                   /translation="MSLTSEDADPSEQRAAARPPAANAQPNQVTFNRLELRRILNLYGR
FT                   MVADGEWRDYAIDFLKDRAVFSVYRRASEVPIYRIEKDPRLARKQGMYSVISATGLILR
FT                   RGHELERVLLVIDRKLAVV"
FT   CDS_pept        complement(504497..505273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0465"
FT                   /note="ORF_ID:bll0465"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45730"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45730"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X50"
FT                   /protein_id="BAC45730.1"
FT                   /translation="MTAMTASHLISRWSGAFWSGALGICAIVAVIRPAEADPRAVVELF
FT                   TSQGCSSCPPADKIIGDLSSDPSIIALSMPIDYWDYLGWKDTLADSRFSARQRAYSRMR
FT                   GDREVYTPQVVVNGSTHVVGSDRAGIESAIGKTDKGMGVMSVPVTMSLSGKQINVSVAA
FT                   SKEPAISHGEVWICSIAKSVPIAIAKGENRGQQITYHNVVRNLLKVGDWNGRPESWTVP
FT                   IENLTRDGVDGAVVYVQDGSREKPGPMLGAAYTSLH"
FT   CDS_pept        complement(505494..508214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /product="aconitase"
FT                   /note="ORF_ID:bll0466"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45731"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45731"
FT                   /db_xref="GOA:P70920"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70920"
FT                   /protein_id="BAC45731.1"
FT                   /translation="MTSLDSFKCKKTLKVGAKTYVYYSLPTAEKNGLKGISKLPYSMKV
FT                   LLENLLRNEDGRSVKKADIVAVSKWLRKKSLEHEIAFRPARVLMQDFTGVPAVVDLAAM
FT                   RNAMQKLGGDAEKINPLVPVDLVIDHSVIVNFFGDNKAFAKNVTEEYKQNQERYEFLKW
FT                   GQAAFSNFSVVPPGTGICHQVNLEYLSQTVWTKKEKMTVGKKTGTFEVAYPDSLVGTDS
FT                   HTTMVNGLAVLGWGVGGIEAEACMLGQPLSMLLPNVVGFKLKGAMKEGVTATDLVLTVT
FT                   QMLRKLGVVGKFVEFFGPGLDHLSVADKATIANMAPEYGATCGFFPVDAAAIDYLKTSG
FT                   RAAPRVALVQAYAKAQGLFRTAKSADPVFTETLTLDLADVVPSMAGPKRPEGRIALPSV
FT                   AEGFSVALANEYKKTEEPAKRFAVEGKKYEIGHGDVVIAAITSCTNTSNPSVLIGAGLL
FT                   ARNAAAKGLKAKPWVKTSLAPGSQVVAAYLADSGLQAHLDKVGFNLVGFGCTTCIGNSG
FT                   PLPEEISKSINDNGIVAAAVLSGNRNFEGRVSPDVQANYLASPPLVVAHALAGSVTKNL
FT                   AVEPLGEGKDGKPVYLKDIWPTSKEINAFMKKFVTASIFKKKYADVFKGDTNWRKIKTV
FT                   ESETYRWNMSSTYVQNPPYFEGMKKEPEPVTDIVEARILAMFGDKITTDHISPAGSIKL
FT                   TSPAGKYLSEHQVRPADFNQYGTRRGNHEVMMRGTFANIRIKNFMLKGADGNIPEGGLT
FT                   KHWPDGEQMSIYDAAMKYQQEQVPLVVFAGAEYGNGSSRDWAAKGTRLLGVRAVICQSF
FT                   ERIHRSNLVGMGVLPLTFEEGTSWSSLGLKGDEKVTLRGLVGDLKPRQKLTAEIVSGDG
FT                   SLQRVSLLCRIDTLDELDYYRNGGILHYVLRKLAA"
FT   CDS_pept        508457..509059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /product="heme exporter protein A"
FT                   /note="ORF_ID:blr0467"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45732"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45732"
FT                   /db_xref="GOA:P30963"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30963"
FT                   /protein_id="BAC45732.1"
FT                   /translation="MQLSGRRVICVRGGREVFAGLDFEAVSGEAVAVVGRNGSGKTSLL
FT                   RLIAGLLIPAGGTIALDGGDAELTLPEQCHYLGHRDALKPALSVAENLSFWADFLGGER
FT                   LDAHESLATVGLDHATHLPAAFLSAGQRRRLSLARLLTVRRPIWLLDEPTTALDVAGQD
FT                   MFGGLMRDHLARGGLIIAATHMALGIDSRELRIGGVA"
FT   CDS_pept        509370..510038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmB"
FT                   /product="heme exporter protein B"
FT                   /note="ORF_ID:blr0468"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45733"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45733"
FT                   /db_xref="GOA:P30964"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30964"
FT                   /protein_id="BAC45733.1"
FT                   /translation="MTALSALIRRDIRIALRVGGGALIGVLFFLTVVVLMPFAVGPDLA
FT                   LLSRLGPAILWLGALLASLLTLDRLFMADHEDGSLDLITMSRTPLELACAAKALAHWLA
FT                   AGLPLIVATPVLGLLLNLDMVATGAVALTLLAGTPALTFTGMIGAALAVTLHRGGLLMA
FT                   VLVLPLSIPVLIFGVAASQAVIVGPMSFGAPFSILCALSLVSLVIGPFAAAASLRHGLD
FT                   "
FT   CDS_pept        510130..510921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmC"
FT                   /product="heme exporter protein C"
FT                   /note="ORF_ID:blr0469"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45734"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45734"
FT                   /db_xref="GOA:P30962"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30962"
FT                   /protein_id="BAC45734.1"
FT                   /translation="MTLIDLANPTRFLALTARVLPWLAAATVILLAIGLYQSALAPDDY
FT                   QQGATVKIMFIHVPNAWLSMFVWGVMSIASLGTLVWRHPLADVAAKAAAPIGAAFTFLA
FT                   LLTGSLWGRPMWGTYWEWDARLTSVLILFLMYLGLMALWRAVDDPSRAARAAAVLTLVG
FT                   AINLPIIKFSVDWWNTLHQPASVMRMGGSSLDKSFLIPLLVMAIAFTLLFVTLHLAAMR
FT                   NEILRRRVRSLQMMQASRMAFSSEMGAGSRQNNASNEVGAA"
FT   CDS_pept        510918..511103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmD"
FT                   /product="heme exporter protein D"
FT                   /note="ORF_ID:bsr0470"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45735"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45735"
FT                   /db_xref="GOA:P30959"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30959"
FT                   /protein_id="BAC45735.1"
FT                   /translation="MIMSLGPYASFIVTSYAAAALVVAILIGWIATDYRSQTRRLRDLD
FT                   RSGITRRSGRSAMDRP"
FT   CDS_pept        511100..511684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmG"
FT                   /product="thiol:disulfide interchange protein"
FT                   /note="ORF_ID:blr0471"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45736"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45736"
FT                   /db_xref="GOA:P30960"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:1KNG"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30960"
FT                   /protein_id="BAC45736.1"
FT                   /translation="MSEQSTSANPQRRTFLMVLPLIAFIGLALLFWFRLGSGDPSRIPS
FT                   ALIGRPAPQTALPPLEGLQADNVQVPGLDPAAFKGKVSLVNVWASWCVPCHDEAPLLTE
FT                   LGKDKRFQLVGINYKDAADNARRFLGRYGNPFGRVGVDANGRASIEWGVYGVPETFVVG
FT                   REGTIVYKLVGPITPDNLRSVLLPQMEKALK"
FT   CDS_pept        complement(511798..512553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0472"
FT                   /note="ORF_ID:bll0472"
FT                   /note="probable intracellular septation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45737"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45737"
FT                   /db_xref="GOA:P30961"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30961"
FT                   /protein_id="BAC45737.1"
FT                   /translation="MRSPESSHRFLSSCPAQAGHPVRRAAGCRSQVPRNTGSPAFAGDD
FT                   INESQGMDKTQPHPLFKLATELGPLLVFFFVNAKFNLFAATGAFMVAIVAAMIASYVVT
FT                   RHIPIMAIVTGVIVLVFGTLTLVLHDETFIKVKPTIIYGLFAAILGGGLLFGRSFIAVM
FT                   FDQMFNLTPQGWRILTLRWALFFAGMAVLNEIVWRTQSTDFWVNFKVFGVTPITMIFAI
FT                   AQMPLTKRYHLEPVSLEASEADAGDVRKG"
FT   CDS_pept        complement(512528..513475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0473"
FT                   /note="ORF_ID:bll0473"
FT                   /note="probable cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45738"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45738"
FT                   /db_xref="GOA:Q89X49"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X49"
FT                   /protein_id="BAC45738.1"
FT                   /translation="MNDTTSDPPKLSWWRRLSNGLKRTSSSLGTAVADLVTKRKLDRAM
FT                   LDDIEDVLLRADLGTSVAVRIADAVGTGRYDKAISADEVKDVVATEVEKVLAPVAKPLE
FT                   IDAARKPFVILVVGVNGSGKTTTIGKLSQKFASEGRKVMLAAGDTFRAAAIEQLKVWGE
FT                   RTKTPVIAGTQGSDSASLAFNALTAAKEQKTDVLLIDTAGRLQNKAELMNELEKVVRVI
FT                   RKVDDTAPHAVLLVLDATVGQNALSQVEAFHRTAGVTGLVMTKLDGTARGGILVALAEK
FT                   FKLPVHFIGVGEGVDDLAPFTARDFARAIAGIES"
FT   CDS_pept        513743..514399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0474"
FT                   /note="ORF_ID:blr0474"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45739"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45739"
FT                   /db_xref="GOA:Q89X48"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X48"
FT                   /protein_id="BAC45739.1"
FT                   /translation="MLHRDGLMLVIDKPAGLPVHRGPKGGANLEASFDALRFGLPRPPV
FT                   LAHRLDKDTSGCLILGRHRKATASLGLLFKHGKIGKTYWTVVEGGPAEDEGTIDMPLGR
FT                   LNAERGWWQKPDPEGQKAITNWKVMGRGDGFTWLAMEPVTGRTHQLRVHSAATGWPIFG
FT                   DNIYGNGPRFGEPKLHLHSREIVVPISRNKEPVRVVAPAPPHMHEKLRACGWNGE"
FT   CDS_pept        514563..515672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0475"
FT                   /note="ORF_ID:blr0475"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45740"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45740"
FT                   /db_xref="InterPro:IPR019285"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X47"
FT                   /protein_id="BAC45740.1"
FT                   /translation="MSKAELSIIDEVESALRIGSAEKGLETARRVTDLFLSSAGSFDDE
FT                   QIALFDEVLERLIGTIELRAIADMGARVALAEISAQLAPIAQAPPSVIRRLANNDEIRI
FT                   AGPVLQESARLDDGELVKIASSKGEPHLLAVAGRWWLKEIVTDALLARRYPSVSRRLAA
FT                   NPGARVSGNGFAVIVGQAEGDPELAVSVGVRVDLPSELRRQLLRSATDTVRTRLLSRAP
FT                   PHLFEEIQGAIAAVTAGVTREMSGVRDFEGAKRAIAGLKASGQLNEATLFSFAKQRRYE
FT                   ETVAALAVLSQSTVEVIRPLMQSLREDGLLVPCKAAQLSWETTAAVLESRFATGAMKPA
FT                   DLARAQGHYARMTPENARRTLRFWQVRAS"
FT   CDS_pept        complement(515845..517098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0476"
FT                   /note="ORF_ID:bll0476"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45741"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45741"
FT                   /db_xref="GOA:Q89X46"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X46"
FT                   /protein_id="BAC45741.1"
FT                   /translation="MSVEIVTFGCRLNAFEAEVIRSKAEGAGLVDTIVINSCAVTNEAV
FT                   AQARQSIRKLKRERPGARIVVTGCAAQTQSRMFADMAEVDRVVGNDDKMRSDAWREARD
FT                   AFDIGAREKIAVSDIMAVKEMAPHLVDGFASGLPRVFVQVQNGCDHRCTFCIIPFGRGN
FT                   SRSVPMGAVVEQVRALAERGHAEIVLTGVDLTSYGADLPGAPKLGMLTKQILRHVPELK
FT                   RLRISSIDSIEADNDLLDAIADDARLMPHLHLSLQSGDDMILKRMKRRHLRGDAIAFCD
FT                   QVRRLRPDVAFGADIIAGFPTETEAMFSRSLDLVEECGLTFLHVFPYSPRPGTPAARMP
FT                   QVAGPEIKERARRLRAAGEAALRQRLQAEIGATRDVLIESESQGRTEHYLPVAIAGARV
FT                   GSVVPRMIVGSDGERLTT"
FT   CDS_pept        complement(517098..517973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /product="diaminopimelate epimerase"
FT                   /note="ORF_ID:bll0477"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45742"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45742"
FT                   /db_xref="GOA:Q89X45"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X45"
FT                   /protein_id="BAC45742.1"
FT                   /translation="MSALANHAFAKMNGIGNEIVVVDMRDSTAKVTPDDARAVASAQGG
FT                   VPYDQLMVLQKPRLDGTEAFISIYNNDGSEAGACGNGMRCVVRRIFEKTGQATATFETA
FT                   AGLLNAWQGPAPDLYTVDMGVPKFGWQDIPLAEEFRDTRYIELQIGPIDNPILHSPSVV
FT                   SMGNPHAIFWVDDVNAYDLARFGPLLENHPIFPERANITLAHIVDRDHITIRTWERGAG
FT                   LTRACGSAACATAVAAARLKRAERNVEITLPGGKLGIEWRERDDHVLMTGTATFEYEGN
FT                   FDPALFAPAG"
FT   CDS_pept        518209..518964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0478"
FT                   /note="ORF_ID:blr0478"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45743"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45743"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X44"
FT                   /protein_id="BAC45743.1"
FT                   /translation="MNTFRRLALAALIPAAALSLGLSGALAQSPAPAASASPSPAPSAS
FT                   PAPAASASPAPVATPSPAASASPAPAASPAPAASTSPSPTAPAVAATPAPVQTADPFGL
FT                   ETTLESRKVVMVKGTANWDSAFDTLVDAFKALNTLLDKQGIKHAGNSMIVYTSTDDTGF
FT                   TFLAEIPVEQDPKNLPKDMSVGKSPEGKALKFVHRGSYDNMDNTYEAITNHLDDKRLEA
FT                   KDTFIEEYLTDPLKTAEDKLVINVFVPLK"
FT   CDS_pept        518961..519671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0479"
FT                   /note="ORF_ID:blr0479"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45744"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45744"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X43"
FT                   /protein_id="BAC45744.1"
FT                   /translation="MRPMKKPAVLAAVFAATLLATPVLADDFPSAISVSGEATVSVAPD
FT                   LAQIDAGVANDAKTAKEASDANNAAMGKVLLALKGAGIAEKDYQTSRLSLQPQYGQNKS
FT                   TGASPVVGFRASNRVTVKIRDVTKIAGIIDTLVSAGANDIGNISFEVTQASKLLDDARE
FT                   QAVADARRKAEIYAKATGVTLGAPLSVSEGGAPVPLFKARMATAPMAAPAAVAPGEETL
FT                   SVTVNVSWAIKQGQ"
FT   CDS_pept        complement(519895..520884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0480"
FT                   /note="ORF_ID:bll0480"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45745"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45745"
FT                   /db_xref="GOA:Q89X42"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X42"
FT                   /protein_id="BAC45745.1"
FT                   /translation="MSRMKTYDGPASDHFNGLHFFDPDGAPPKPLREVLRWQFSGKRQR
FT                   AAWPDWAPSPHADTPPERVDGGKARLSFVGHASWLIQAGGLNILVDPVWSSRVSPVGFA
FT                   GPKRHNDPGIAFEKLPKIDVVLVSHGHYDHLDIATLSRLAKNFAPRVVTPLGNDVTMRS
FT                   TDSSIKAEAFDWHDRVELGGGIAVHLVPTRHWTARGLFDRNKALWASFVLETPAGKIYV
FT                   VCDSGYGDGRHFRRVAEKHGPLRLAILPIGAYEPRWFMRDQHMNPEDAVKALLDCGAQD
FT                   ALGHHHGTFQLTDEAIDAPAKALVEALDAAQIPQQRFVAMKPGQVVEI"
FT   CDS_pept        521006..522898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /product="signal recognition particle protein"
FT                   /note="ORF_ID:blr0481"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45746"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45746"
FT                   /db_xref="GOA:Q89X41"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X41"
FT                   /protein_id="BAC45746.1"
FT                   /translation="MGGAARKGTHRQKGHNFRALPYQGRSGALTFLDFWAGAAFNPATF
FT                   SERLSFRPADWPWRPEVNARQRYAPSGAKVFGRSLPGFRPRTENWSSPAKAGHDRGECG
FT                   NPAQAGQGTTALFDNLSERLGGILDRLTGRGALTEKDVDAAMREVRRALLEADVALEVV
FT                   RSFTERVREQAIGATVVKSVTPGQMVVKIVHDELINTLGAEGQTIDINSVPPVPIMMVG
FT                   LQGSGKTTTTAKLARRMVQRDRRKVLMASLDVYRPAAMEQLAVLGRDLDIPTLPIVAGQ
FT                   QPAQIAKRALEAGKLGGYDVVLLDTAGRTTLDEDMMAEAAAIKAAANPHEVLLVADSLT
FT                   GQDAVNLARAFDERVGLTGIVLTRVDGDGRGGAALSMRAVTGKPIKLIGTGEKTDALED
FT                   FHPDRIAGRILGMGDVVSLVERAAANIDAEKAARTAERMRKGQFDLNDMREQLSQMANM
FT                   GGISGLMGMMPGISKMKNQIAAAGIDDKILKRQVAIIDSMTRDERRHPDLLKASRKKRI
FT                   AAGSGQSVEHVNKLLKMHRNMADVMKAMGSGKRGPLAGIAQAMGFGGGMKMPSPEEMKA
FT                   MQEKMQSGGGQGLPNLPKDLPPGLRTGLPNLPGLTGLSGKPTLPGLGGFPGKKK"
FT   CDS_pept        522984..523316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /product="30S ribosomal protein S16"
FT                   /note="ORF_ID:blr0482"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45747"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45747"
FT                   /db_xref="GOA:Q89X40"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X40"
FT                   /protein_id="BAC45747.1"
FT                   /translation="MSVVIRLARAGTKKRPVYHVVVADSRFPRDGRFIERLGYFNPLLP
FT                   KDNEARLKLDMEKVKAWVAKGAQPSDRVSRFLDAAGVKKREARNNPQKAVPRKERKAQA
FT                   EAAAKG"
FT   CDS_pept        523326..523847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /product="16S rRNA processing protein"
FT                   /note="ORF_ID:blr0483"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45748"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45748"
FT                   /db_xref="GOA:Q89X39"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X39"
FT                   /protein_id="BAC45748.1"
FT                   /translation="MSALVCVARIGAAHGVRGAVKLWTFTEDPFAIKRYGPLLSKDGKR
FT                   QFEVAQAREAKDHLVATFKGVTTRDEAERLNGIELYVAREKLPATDEDEYYHTDLIGLA
FT                   AVTTDGEPLGRVLAIHNFGAGDIIEIAPPKGASLLLPFSNAVVPEVDVAGGRVVVALPQ
FT                   EIAGDEAEER"
FT   CDS_pept        complement(523854..524771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0484"
FT                   /product="transcriptional regulatory protein"
FT                   /note="LysR family"
FT                   /note="ORF_ID:bll0484"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45749"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45749"
FT                   /db_xref="GOA:Q89X38"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X38"
FT                   /protein_id="BAC45749.1"
FT                   /translation="MAMFVPRRSLPPLNAVRAFEAAARLGSFKEAAGELGVTHGAVSQQ
FT                   IRLLETWLGPPALFRRSVRRVVLTPAGAALLAEFAPALDRVSAAVQQHRKRRGEAPAAV
FT                   LRVNALATFSLRWLLPRMTRFRAEHPDIEVRLSTSNDPVDALPELFDVVIRGGPDTFHG
FT                   FASRFLLSEQRLPVCSPALLAKLPLTEVADLSRHTLLHVTSMPRLWRDWLTDAGESALE
FT                   GAASLTFDHFYLTLQAALDGLGVAMGPTALIADDLAAGRLVTPFPNISLPARSYFAYFP
FT                   EGRDDDPHRAVFCDWLEQQGRQTV"
FT   CDS_pept        524894..526117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0485"
FT                   /note="ORF_ID:blr0485"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45750"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45750"
FT                   /db_xref="GOA:Q89X37"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X37"
FT                   /protein_id="BAC45750.1"
FT                   /translation="MAILPSGFLSQSQTAPPGEETLSKPRRTLAATGINHALHDGYTDL
FT                   IYVLLPVWQAEFALSYGLLAVMRGLYSGAMAGLQIPVGRLAERIDGKILLALGTLLAAL
FT                   GYVLAGLSGGVMGLGLALLISGAGSSTQHPLASAAVSRAYGKAARGPLGIYNFSGDLGK
FT                   AALPALTAVLLVIMSWRHALLLVALMGLVVALCLAVLMPAVGKGFAHKSAVTTQGTHAG
FT                   RGGFSWLLAIGILDSAVRMGFLTFLPFLLRDKGASLPTSGFALAMVFIGGAAGKFTCGW
FT                   LGERVGTIRTVLLTEGGTAALILAVLALPLIPAIIVLPLLGVMLNGTSSVLYGTVPELT
FT                   SPHRTERAFALFYTGTIGSGAIAPVLYGLLGDAVGPTLATAATAVTALAICPLALVLAS
FT                   HLPNDRRA"
FT   CDS_pept        526166..526933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="ORF_ID:blr0486"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45751"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45751"
FT                   /db_xref="GOA:Q89X36"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X36"
FT                   /protein_id="BAC45751.1"
FT                   /translation="MTTSSPWRATVLTLFPEMFPGPLGVSLAGRALASGLWQLEARDIR
FT                   ASATDRHRSVDDTPAGGGPGMVLRADVLAAAIDAAEIGQGSSKERPRLLMSPRGRPLTQ
FT                   ARVVELARGPGPLIVCGRFEGIDQRVIDGRGLEEVSIGDYVLSGGEIAALALIDACVRL
FT                   LPGVMGKEASGTEESFSDGLLEYPQYTRPQLFEGVPIPEILTSGDHAKVAAWRRAEAEA
FT                   LTAARRPDLWAQIPVKAPNRAGRQKTPKNKTDG"
FT   CDS_pept        527044..527424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /product="50S ribosomal protein L19"
FT                   /note="ORF_ID:blr0487"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45752"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45752"
FT                   /db_xref="GOA:Q89X35"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X35"
FT                   /protein_id="BAC45752.1"
FT                   /translation="MNLIKQLEQEQFDKLSAGKDIPEFGPGDTVIVNVKVVEGDRTRVQ
FT                   AYEGVCIGRSGGGLNESFTVRKISYGEGVERVFPVMSPMIDSIKVVRRGKVRRAKLYYL
FT                   RNLRGKSARIVEKQDRQAAVGE"
FT   CDS_pept        527752..529158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /note="ORF_ID:blr0488"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45753"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45753"
FT                   /db_xref="GOA:Q89X34"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X34"
FT                   /protein_id="BAC45753.1"
FT                   /translation="MSKPTTLYDKIWNDHLVHEADDGTCLLYIDRHLVHEVTSPQAFEG
FT                   LRATGRKVHAPEKTLAVVDHNVPTTDRTKPNPDPESIEQIKALADNAREFGIEYYNEFD
FT                   KRQGIVHVIGPEQGFTLPGTTIVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQTLIQK
FT                   KAKNMRVTVDGKLPDGVTGKDIILAIIGEIGTAGGTGYVLEYAGEAIRALSMEGRMTVC
FT                   NMSIEGGARAGLVAPDQKAYDFLRDRPKAPKGAAWDAAMRYWEKLRSDDGAHFDHELRL
FT                   DAAKLPPIVTWGTSPEDVISVTGIVPDPDKIADEAKRLSKHRALKYMGLTAGTKITDIK
FT                   LDRVFIGSCTNGRIEDLRAAAKIAEGKQVSASVNAMVVPGSGIVKEQAEAEGLDKIFIK
FT                   AGFEWREPGCSMCLAMNPDKLKPEERCASTSNRNFEGRQGFKGRTHLVSPAMAAAAAIA
FT                   GHFVDVREWR"
FT   CDS_pept        complement(529579..530112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0489"
FT                   /note="ORF_ID:bll0489"
FT                   /note="putative glicine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45754"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45754"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X33"
FT                   /protein_id="BAC45754.1"
FT                   /translation="MLRILGVGTGSIRLLGLAAVATLMLSAGTARRAEAMTPINPAALP
FT                   AAKAASDDLVTQVRHGGGGHGGGGHFHGSGGGFRGGGGHFGGFHGGGFRAAPAFHGGGI
FT                   RYGGIHHYGGYHRYGIYRPHYGYRHFHRRYYYGGYYPYYHYPRRCRIIWTYYGPRRICR
FT                   WHHWHRWHYPYRYW"
FT   CDS_pept        530239..530598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0490"
FT                   /note="ORF_ID:blr0490"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45755"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45755"
FT                   /db_xref="GOA:Q89X32"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X32"
FT                   /protein_id="BAC45755.1"
FT                   /translation="MNDVAGNAPRRSAAMGGILAMTVYAIAQLKMTDRAAYDRYQARFF
FT                   DVFRKYSGRLLAADEQPRVLEGTWPYDKLVMMSFPDEAAFVAFSNSADYEDISRDRKAG
FT                   AQATVLLVKGFAPAG"
FT   CDS_pept        complement(530603..530908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0491"
FT                   /note="ORF_ID:bll0491"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45756"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45756"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X31"
FT                   /protein_id="BAC45756.1"
FT                   /translation="MHRKNEARMLGAEVVMTRWIALAVIVGLAAAMPCASAVQRMTKPD
FT                   ASAGIAVFDARRHARHDDIARHSASRDPRYYARPVYYRPYPYGVPAPFVLGFGPWW"
FT   CDS_pept        531000..531320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0492"
FT                   /note="ORF_ID:blr0492"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45757"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45757"
FT                   /db_xref="GOA:Q89X30"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X30"
FT                   /protein_id="BAC45757.1"
FT                   /translation="MQRARQVPESRRNISGAAKTGRQRRTYLLVERMQEMVMPNSSGLR
FT                   ISRLVIAASLALGASSAIAAQGPGVEAGAASPLTQLVMTILVYGASAAVVGAGLIGALR
FT                   GN"
FT   CDS_pept        complement(531328..531654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0493"
FT                   /note="ORF_ID:bll0493"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45758"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45758"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X29"
FT                   /protein_id="BAC45758.1"
FT                   /translation="MRAGTAVLVLLCMGLFSTFFVGGGANAQTRTAAPEIRLAQAVSPD
FT                   APPPRRRPPARLRVTPYYSPDGVYPRYNPGPDAVRECNATYVQEYRPSGTVIVPHMSCY
FT                   WRRG"
FT   CDS_pept        531686..532189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0494"
FT                   /note="ORF_ID:blr0494"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45759"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45759"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X28"
FT                   /protein_id="BAC45759.1"
FT                   /translation="MRRTLPVFARGVNAPSWPDPIKRDATPRNPRYEGLMWTELKAPSL
FT                   AEMEATAHDIFERLPAEFRGLCEGVILRVDDFPTEDVMDEMECESEFDLLGLFQGVGLP
FT                   QQSFGDVARLPNMVWLYRRPILDYWAEHDESLGHIVRHVLIHEIGHHFGLSDDDMAAIE
FT                   AKAD"
FT   CDS_pept        532271..532876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /note="ORF_ID:blr0495"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45760"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45760"
FT                   /db_xref="GOA:Q89X27"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X27"
FT                   /protein_id="BAC45760.1"
FT                   /translation="MDKFTTLEGVAAPLKIINVDTDMIIPKQYLKTIKRTGLGKGLFSE
FT                   QRYKDDGSENPDFVLNQPAYRNTKVLVAGDNFGCGSSREHAPWALLDFGIRCVISTSFG
FT                   DIFYNNCFKNGILPIRVSQEDLDKLFDDAERGANATLTIDLPNQEIRGPDGGKVKFEID
FT                   PFRKHCLINGLDDIGLTMEKKASIDTYEDKLKRERAWA"
FT   CDS_pept        532958..533743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0496"
FT                   /note="ORF_ID:blr0496"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45761"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45761"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X26"
FT                   /protein_id="BAC45761.1"
FT                   /translation="MLPDIVTFWHGPMDALRQTCLRSQLAAGHKVTVYSFDTIPGLPAG
FT                   IENAEAEAILPHAFSERLRPPQPDGSWRDWTTLQFSDFFRMKLMAKGLGLWLDADVLLL
FT                   RPVEIDPAKPYFAWERPRQLGNSVIYLPPGHGIVAAFEELMEQEELTPNWLSVRHRITF
FT                   MMRRLRGGSNRLSDIRVAIFGPAALTALARRTGELQNALPKQSFYAVHAEPKLFFDPSS
FT                   YLGLVTNPEIIGLHISPKGRGSEKPIPGSLYAWAAERFG"
FT   CDS_pept        533941..534405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0497"
FT                   /note="ORF_ID:blr0497"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45762"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45762"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X25"
FT                   /protein_id="BAC45762.1"
FT                   /translation="MPNLVPISRPQEEPRMSTASRPYPIVQDLIDSFASWLKHRREMNE
FT                   MRQLDRADFDRIASDLRIAPDDLEELVRHGKHAADELPKMLEQLGISAEGLGRAQPLLL
FT                   RDMERVCSLCGHKGQCDRDLADGTAAENYHGYCGNAATLESLDRADLAPR"
FT   CDS_pept        complement(534428..535087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0498"
FT                   /note="ORF_ID:bll0498"
FT                   /note="putative phosphoglycolate phosphatase (EC 3.1.3.18)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45763"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45763"
FT                   /db_xref="GOA:Q89X24"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X24"
FT                   /protein_id="BAC45763.1"
FT                   /translation="MSPARSVFLDLDGTLVDSQPGIAASCSAALRVLGHDPGKAPDIAI
FT                   GPPLEDILRTLLQAYGDDRIDEAVVAYRQHYGESGLLGSEPYPGISGALQELRQAGLRI
FT                   YLATSKREVFARRILENLNLAAYFDGIHGSVPGGKLDHKPELLAHILSECGIAASHSIM
FT                   IGDRHHDIAGAHAVKMRGLGVLWGYGNRDELEAAGADQLVERPADLARTVLSMLIG"
FT   CDS_pept        complement(535091..535972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /product="citrate lyase beta subunit"
FT                   /note="ORF_ID:bll0499"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45764"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45764"
FT                   /db_xref="GOA:Q89X23"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X23"
FT                   /protein_id="BAC45764.1"
FT                   /translation="MTRPRRSHLFMPGSNPRALEKARNLAADGLILDLEDSVAPDAKAA
FT                   ARDGIAAAIAAKGFGKREILIRTNGLDTPWWADDVAMAAKASPDGILVPKVSSVEDLDA
FT                   IGRRLAELGAAPTVKVWAMIETARAVLHAEELAAAGRNPTSRLSGFVFGPNDISRETRI
FT                   KMLPGRAAMIPMITHCILATRAHGLEILDGPYSDINNSDGFATECAQGRDLGFDGKTLI
FT                   HPSQIEACNAIFTPPEEEVARARKIIAAFELPENVSRGAIRLDGAMVERLHADMARRTI
FT                   AIADAIAAMGKG"
FT   CDS_pept        536084..536728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cah"
FT                   /product="carbonate dehydratase"
FT                   /note="ORF_ID:blr0500"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45765"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45765"
FT                   /db_xref="GOA:Q89X22"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X22"
FT                   /protein_id="BAC45765.1"
FT                   /translation="MVTFPKHLLEGYQAFATQRLPTEQTRYRELSVKGQFPEVMVIGCC
FT                   DSRVSPEVIFDVGPGELFVVRNIANLVPVYQPDGNAHGVSAALEYAVTVLKVKHIVVLG
FT                   HAQCGGIRAFVDKIEPLTPGDFIGKWMQMFIKPGEVVEQRDHESMAQFVERIEKAAVFR
FT                   SLENLMTFPFVQKAVDAGQMQTHGAYFGVAEGSLFVLDKVAKEFRSVKDAA"
FT   CDS_pept        complement(536968..538002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /note="ORF_ID:bll0501"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45766"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45766"
FT                   /db_xref="GOA:Q89X21"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X21"
FT                   /protein_id="BAC45766.1"
FT                   /translation="MGYKVAVVGATGNVGREMLNILDERKFPADEVVALASRRSVGVEV
FT                   SYGDRTLKVKALEHYDFSDVDICLMSAGGSVSKEWSPKIGAAGTVVIDNSSAWRMDPDV
FT                   PLIVPEVNADAAAGFKTKNIIANPNCSTAQLVVALKPLHDKATIKRVVVSTYQSVSGAG
FT                   KDAMDELFSQTKAVYTNSEIVNKKFPARIAFNIIPQIDVFMEDGYTKEEWKMMMETKKI
FT                   LDPKIKLSATCVRVPVFVGHSEAVNIEFENPISADEARNILRTAPGCLVIDKHEPGGYA
FT                   TPYEAAGEDATYISRIREDATVENGLVLWCVSDNLRKGAALNAIQIAEVLINRKLISAK
FT                   KKAA"
FT   CDS_pept        538119..538898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0502"
FT                   /note="ORF_ID:blr0502"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45767"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45767"
FT                   /db_xref="GOA:Q89X20"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X20"
FT                   /protein_id="BAC45767.1"
FT                   /translation="MQSPEAGTAATPTQIHLALANFADEVVGTLARLFAYVGTLVLFAI
FT                   LGLAALGQLPSLRDDDPALKPGWSVTDHSHPAFAISRLNSSDKTATYTILRHPEGGRRD
FT                   VMRWTGEADRPVAELDIYREGGEFDVARPATADLAVQMGLGAAAPLEQAGLIDTKFGPV
FT                   ALYRPTGTAQACLGYLKRSEEPALQISGFSCQGETLPAQRAAIACTLNRLTLLTSGNEP
FT                   KLAELFARAELKRRGCAPQGSPDWLLGAANAQLRGAL"
FT   CDS_pept        complement(539559..540671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /note="ORF_ID:bll0504"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45768"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45768"
FT                   /db_xref="GOA:Q89X19"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X19"
FT                   /protein_id="BAC45768.1"
FT                   /translation="MATHKLLLLPGDGIGPEVMGEVKRLIDWLNSAGIAKFETDTGLVG
FT                   GSAYDAHKVSISEGDMAKALAADAIIFGAVGGPKWDAVPYEVRPEAGLLRLRKDLGLFA
FT                   NLRPAVCYPALADASSLKREAVEGLDIMIVRELTGGVYFGEPKTITDLGNGQKRAIDTQ
FT                   VYDTYEIERIARVAFDLAKKRKNKVTSMEKRNVMKSGVLWNEVVTQVHKREYPDVTLEH
FT                   QLADSGGMMLVKWPKQFDVIVTDNLFGDMLSDIAAMLTGSLGMLPSASLGEVDVKSKKR
FT                   KALYEPVHGSAPDIAGKGLANPIAMISSFGMALRYSFDMGALADKVDAAIAAVLASGLR
FT                   TADIKSEGTTAASTTQMGEAILKELQKLHA"
FT   CDS_pept        540795..542099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0503"
FT                   /note="ORF_ID:blr0503"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45769"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45769"
FT                   /db_xref="GOA:Q89X18"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X18"
FT                   /protein_id="BAC45769.1"
FT                   /translation="MTAGRSARAALRAWQDTIAAPRLCKTGRACHSAGRRSTPLHAPDR
FT                   PPPDAHPARLILILSLAATVGLGIGRFAYALVLPDMRETLGWSYSAAGFMNTINAVGYL
FT                   VGALVASRLIQRVGWSAAIRGGTLACVAALATCALTGNFVALSLARLVLGLGAAAGFVA
FT                   GGALAASIAQSQPARANFLLSLFYAGPGIGILASGLIAPFTLQHFGPGSWWLVWWAMTL
FT                   LSAAMTVPLFLVRIESRVRFTEGSHASFAILPVLIYLAGYFLFGAGYIAYMTFMIAYVR
FT                   DGGGGAAAQAAFWSLIGLSAFVTPWVWRGVLALDRGGLATAIILGTNALGAALPMLGHS
FT                   PAWLAVSAVVFGVAFFAVVGSTTAFVRFNYPPEVWPTAIAAMTISFGVGQTLGPIVVGA
FT                   ITDALGSLSYALNVSAALLALGAVAALCQRKVGSS"
FT   CDS_pept        complement(542199..542981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0505"
FT                   /note="ORF_ID:bll0505"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45770"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45770"
FT                   /db_xref="GOA:Q89X17"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X17"
FT                   /protein_id="BAC45770.1"
FT                   /translation="MAKRSFLIPGVDKRLLIKDAIKTMPDFTRRRFIAGGASLGALTLL
FT                   TGCDVVDSSSADTLLAQVSKFNDAVQAFIFNPDALAPTFPESAITKPFPFNAYYDLDDA
FT                   PEVSAADWKLEVRGLVDNKKSWTLDELYKLPQVTQITRHICVEGWSAIGSWTGTPLRDF
FT                   LKLIGADTRAKYVWFQCADKDGYNSPLDMRSALHPQTQMTFKYANEILPRAYGFPMKIR
FT                   VPTKLGFKNPKYVISMEVTNDYKGGYWEDQGYNSFSGS"
FT   CDS_pept        complement(542994..543623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0506"
FT                   /note="ORF_ID:bll0506"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45771"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45771"
FT                   /db_xref="GOA:Q89X16"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X16"
FT                   /protein_id="BAC45771.1"
FT                   /translation="MASLTVTDEQVRSSPAKVIQPAWVRLMHWINALAMILMILSGWQI
FT                   YNASPLFGFSFPREYTLGGWLGGGLLWHFAAMWLLMINGLAYLVTGFATGRFRKKLLPI
FT                   TPSGVLHDVRAALTFKLGHDDLTVYNYVQRLLYAGIIVVGVLIVLSGLGMWKPVQLHWL
FT                   VTLFGDYPTARYVHFFCMAAICAFLVIHVLLALLVPKSLRAMIIGR"
FT   CDS_pept        complement(543806..544360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0507"
FT                   /note="ORF_ID:bll0507"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45772"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45772"
FT                   /db_xref="GOA:Q89X15"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X15"
FT                   /protein_id="BAC45772.1"
FT                   /translation="MSKRIAYLAAAAFSALAITATVVAPARAEEKTVMVGGAAMFPSKN
FT                   IVQNAVNSKDHTTLVAAVKAAGLVPTLESKGPFTVFAPTNAAFGKLPAGTVDNLVKPEN
FT                   KATLTKILTYHVVPGKLEASDLTDGKKLKTAEGEELTVKKMDGKTWIVDAKGGTSMVTI
FT                   SNVNQSNGVIHVVDTVLMPAT"
FT   CDS_pept        complement(544674..545435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0508"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="ORF_ID:bll0508"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45773"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45773"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X14"
FT                   /protein_id="BAC45773.1"
FT                   /translation="MTKNGKRVAWVTGGGSGIGEAGAEALAADGWTVVVSGRRKDALDT
FT                   VVAKIIGAGGAAEAIALDVSNAAEAQKAADQIVAKHGRIDLLVNNAGINVPKRSWKDME
FT                   LEGWDKLVQVNLNGVLYCMRAVLPTMRKQKDGAIINVSSWAGRHVSKMPGPAYTTTKHA
FT                   VLALTHSFNMDECVNGLRACCLMPGEVATPILKQRPVVPSEEEQARMLQSEDLGRTIAF
FT                   IASMPARVCINELLISPTHNRGFIQTPNNRD"
FT   CDS_pept        545536..547065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0509"
FT                   /product="malonyl CoA synthetase"
FT                   /note="ORF_ID:blr0509"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45774"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45774"
FT                   /db_xref="GOA:H7C6M2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:H7C6M2"
FT                   /protein_id="BAC45774.1"
FT                   /translation="MNRAANANLFSRLFDGLDDPKRLAIETHDGARISYGDLIARAGQM
FT                   ANVLVARGVKPGDRVAVQVEKSVANIVLYLATVRAGAVYLPLNTAYTLNELDYFIGDAE
FT                   PSLVVCDPSKAEGLAPIAAKVKAGVETLGPDGKGSLTEAADKASSAFTTVPRENDDLAA
FT                   ILYTSGTTGRSKGAMLTHDNLASNSLSLVGYWRFTDKDVLIHALPIYHTHGLFVATNVT
FT                   LFSRASMIFLPKLDPDLIIKLMARATVLMGVPTFYTRLLQNAALSRETTRHMRLFISGS
FT                   APLLAETHREWSARTGHAVLERYGMTETNMNTSNPYDGERVPGAVGFPLPGVSLRVTDP
FT                   ETGKELPREEIGMIEVKGPNVFKGYWRMPEKTKAEFRPDGFFITGDLGKIDGKGYVHIL
FT                   GRGKDLVISGGFNVYPKEIESEIDAMPGVVESAVIGVPHADFGEGVTAVLVCNKGAEVS
FT                   EASVLKALDGRLAKFKMPKRVFVVDELPRNTMGKVQKNVLRDTYKDIYAKK"
FT   CDS_pept        complement(547369..548232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0510"
FT                   /note="ORF_ID:bll0510"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45775"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45775"
FT                   /db_xref="GOA:Q89X13"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X13"
FT                   /protein_id="BAC45775.1"
FT                   /translation="MLMAGLDIKEIVELALLLIATGALSGFLAGVFGIGGGAILVPVFY
FT                   ECFRIAGVPLEVRMPLCVGTSLAVIIPTSIRSFQAHYKRGAVDMAILRVWWLPIVIGVV
FT                   AGSVVARHAPERLFKIVFVCVAWSAAVRLIFARETWKLGDDLPKGPVMRIYGFCVGILS
FT                   TLMGIGGGLFSNLLMTFYGRPIHQAVATSSALAVLISIPGALGYIYAGWPAAASYPAVA
FT                   ALQVPFALGYVSLIGAVLVMPMSLVTAPLGVRAAHAMSKRTLETAFGCYLFIVGSRFVV
FT                   SLVGGQ"
FT   CDS_pept        548326..549237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gstR"
FT                   /product="transcriptional regulatory protein"
FT                   /note="LysR family"
FT                   /note="ORF_ID:blr0511"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45776"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45776"
FT                   /db_xref="GOA:Q89X12"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X12"
FT                   /protein_id="BAC45776.1"
FT                   /translation="MAMDQLAAMATFVRAVDSGSLSAAARSLPSSLTAVSRQISALEQH
FT                   FGTRLLVRTTRQLALTDDGRMLYERAKSILGEVKEIEEALAGSRREPSGRLRVSAPTLM
FT                   GRLLIAPLLGDFLHACPSLSVDLLLVDRNVNLIEEDVHLALRVGRIPDSQLVTRKLAEV
FT                   QMIHCASPGYLARRGEPQSPSDLPRHDCLVFSDAPGAATWRFGRDAKGGSRIRIAGRLW
FT                   VNSLDALASAAENGAGIVRVPSWQVERQLAEGRLRRLLREHEPAPAPLHALYQPSRLGS
FT                   AKIRAFIDFLVERWRGSDPLGR"
FT   CDS_pept        549655..550053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /product="succinate dehydrogenase cytochrome B-556 subunit"
FT                   /note="ORF_ID:blr0512"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45777"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45777"
FT                   /db_xref="GOA:H7C7T8"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:H7C7T8"
FT                   /protein_id="BAC45777.1"
FT                   /translation="MTARIERPLSPHMQVYRWTLTMALSIVHRATGIALYAGTLLLAWW
FT                   LIAAASGPAAYSHVQAFTGSIIGRLIVFGYTWALMHHMLSGIRHFVWDLGYGFKANERE
FT                   ALTWGALIGGIVLTVLIWIVAYAIGGGR"
FT   CDS_pept        550050..550454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /product="succinate dehydrogenase hydrophobic membrane
FT                   anchor protein subunit"
FT                   /note="ORF_ID:blr0513"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45778"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45778"
FT                   /db_xref="GOA:H7C6D9"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:H7C6D9"
FT                   /protein_id="BAC45778.1"
FT                   /translation="MSATDTPKRSMRTPLGRVRNLGAAHSGTSDFWRQRITGVAMVLMM
FT                   IPVIVIIVMLFGRNQAFVAQTIGSLPIAIIMLLFIFASAWHMKIGMQVVIEDYVHNEKL
FT                   KLTAIMLNNFFSIAVALASTYAILKLSSGV"
FT   CDS_pept        550458..552293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /product="succinate dehydrogenase flavoprotein subunit"
FT                   /note="ORF_ID:blr0514"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45779"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45779"
FT                   /db_xref="GOA:H7C6R5"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:H7C6R5"
FT                   /protein_id="BAC45779.1"
FT                   /translation="MANETNGKGNGAPATNGKAYPIEDHTYDVVVVGAGGAGLRAVVGC
FT                   SEAGLRTACITKVFPTRSHTVAAQGGISASLGNMHKDDWRWHMYDTVKGSDWLGDQDAI
FT                   EYMVRNAPDAVYELEHWGVPFSRTEDGKIYQRPFGGMTLDFGKGQAQRTCAAADRTGHA
FT                   MLHTMYGQSLRHAAEFFIEFFAIDLIMDDQGTCRGVIALKLDDGTLHRFRAQTVILATG
FT                   GYGRAYASCTSAHTCTGDGGGMVLRAGLPMQDMEFVQFHPTGIYGSGCLVTEGARGEGG
FT                   YLVNSEGERFMERYAPSAKDLASRDVVSRAMTIEIREGRGVGKKKDHIFLHLDHLDPAV
FT                   LAERLPGISESAKIFANVDVTREPIPIVPTVHYNMGGIPTNYHGEVLTKKDGDDNAVIP
FT                   GLMAIGEAACVSVHGANRLGSNSLIDLVVFGRAAALRLAEKLTPNAKQPELPANSAELA
FT                   LGRLDHYRYASGGTPTAKLREGMQHVMQSNCAVFRTGEVLSEGQNLIEKVHSGITDIAV
FT                   SDRSLVWNSDLVETLEFDNLIAQAVVTMNSAANRTESRGAHAREDFSERDDKNWMKHTL
FT                   AWLDDAGKVKIEYRPVHDYTMTNDVQYIPPKARVY"
FT   CDS_pept        552396..553178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /product="succinate dehydrogenase iron-sulfur protein
FT                   subunit"
FT                   /note="ORF_ID:blr0515"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45780"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45780"
FT                   /db_xref="GOA:H7C6L4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:H7C6L4"
FT                   /protein_id="BAC45780.1"
FT                   /translation="MVEFALPKNSKITGGKTWPKPAGATDVREFRVYRWNPDDGKNPSV
FT                   DTYYVDTNDCGPMVLDGLIWIKNNIDPSLTFRRSCREGVCGSCAMNIDGQNTLACTRSM
FT                   HDVKDGAVKINPLPHQPVVKDLVPDLTNFYAQYASVEPWLKTTSPTPQKEWRQSHEDRE
FT                   KLDGLYECILCACCSTSCPSYWWNSDRYLGPAALLQANRWVSDSRDEATGERLDNLEDP
FT                   FRLYRCHTIMNCAKACPKGLNPAEAIAELKLKMVERQI"
FT   CDS_pept        553370..555523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0516"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /note="ORF_ID:blr0516"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45781"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45781"
FT                   /db_xref="GOA:Q89X11"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X11"
FT                   /protein_id="BAC45781.1"
FT                   /translation="MQGAQRNSLKLLQWMMAASLALPIALFAIAATISYTSTKDIADRE
FT                   IERTLDVAHEHALKVFETIDRSLAELNEVVRGLPDDLIRAREPALHRRLKRLADSLPQL
FT                   KSAWIFDANGKALVNSLASPPPELSFADRDYFYAHVDQAIGTFIGMPLTPRPPYQGARF
FT                   FGMSRRRDSDDGSFIGVIQASVLPEYFESFYARIGSDPGSFFAMGRADGVVLAHFPRLD
FT                   RDLRLDPGGPVGRQIAAHPAHGLMTIAWPSDGIERRLGYRRIAEYPIYVSAGLETSAIR
FT                   ARWLATMGQHLVFGVPATALLFLLLAFAFRRTQHLQTEAAKRREAEEALKHSQRLEALG
FT                   QLTGGVAHDFNNLLTVIRASVDLLNRPQLTEERRQRYMTAIADAVARAARLTSQLLAFA
FT                   RRQTLKPEVFDVGERMQSLHDMLATLLGPAIEIATQLPAEPCLVNADASQFETALINMA
FT                   TNARDAMQGKGRISFKVEVATTVPDTLAHLPGGHIPDSNGFVCVVVSDTGIGIPAARLG
FT                   RIFEPFFTTKQVGHGTGLGLSQVFGFARQSGGEVTVTSEVGQGSTFSLYLPRVPADLLP
FT                   QQQAPNTAPALPGSGMSVLVVEDNIELANFAADGLTELGYSITLVDNAADALAELVVDT
FT                   DRFDVVFSDVVMPGMTGLELARAIRDRGIGAPVVLTTGYSEALAQDGSDGFELVQKPYS
FT                   IEELSQILHRAARRRRVRGGAAE"
FT   CDS_pept        555576..557534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0517"
FT                   /note="ORF_ID:blr0517"
FT                   /note="probable ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45782"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45782"
FT                   /db_xref="GOA:Q89X10"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X10"
FT                   /protein_id="BAC45782.1"
FT                   /translation="MQKPAGKREQGKKPPIIEIEGETGEDVAPPPPEELEPDPELSPEE
FT                   AEQARKDYLLTRFWISARGFWGRNGDRLAWPFSIGLGMLIVLTVAFQYGINVWNRAIFD
FT                   AIEKRDATSVFHLTAVFVPLAIGSIVLGVAQVFARMGIQRRWRAWLTASVLTRWLANGR
FT                   YYQLNLVGGDHKNPEYRIAEDLRIATDSPVDFLAGVTSALLSAVTFIVVLWTIGGALTI
FT                   ALGGSTITIPGFLVIAAILYAAIASSSIVVIGRRFVQISEDKNQAEADFRYTLTRVREN
FT                   GESIALLGGEEEERGGIDRNFTNVLRQWARLAGQHMRTTLVSQGSNLVAPVVPLLLCAP
FT                   KFLDGSMTLGQVMQAASAFTIVQGAFGWLVDNYPRLADWNACARRIASLMMSLDGLERA
FT                   EQGDGIGRIKRGETSNEAMLELNDLSVTLDDGTAVVGETEVVIEPGERLLVAGESGTGK
FT                   STLVRAIAGLWPWGGGSVNFHPDRRLFMLPQRPYVPSGSLRRAVAYPGAEDDWTVDEIG
FT                   EALHKVGLDHLKEKIEEEGPWDQTLSGGEKQRLAFARLLLHNPDIVVLDEATSALDEKS
FT                   QDKMMKMVTDALPKATIVSVAHRVELEAFHSRKIVLERRKGGAKLVSDIDLIPRKGRRR
FT                   LLGRFLRPRRPAPTRAA"
FT   CDS_pept        557742..558599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0518"
FT                   /note="ORF_ID:blr0518"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45783"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45783"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X09"
FT                   /protein_id="BAC45783.1"
FT                   /translation="MHAPLATRTTCLTTDNAPSSAPFGTFAPNAAQAAIIRLATQSGLK
FT                   RGAFRPWLSRLVNLLRGGPVDVQYQGASFRFYHQGSATERGALFNPDYNLDELDFLRQH
FT                   TPAGGVFVDVGANVGTFALVMARQVGPAGKVIAIEPHPLTFGRLSFNHAASKATQVRLV
FT                   QAAAGDSDGELMIESGGGNLGATHVVTGTASADAIKVPSLRLMRILDEAGVTQVDALKI
FT                   DVEGFEDRVLTGFFRDAPQALWPRAVVIEHLSQKEWQQDCIADMVARGFAIARKTRSNT
FT                   FLSR"
FT   CDS_pept        558624..559010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0519"
FT                   /note="ORF_ID:blr0519"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45784"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45784"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X08"
FT                   /protein_id="BAC45784.1"
FT                   /translation="MIDHLGFSVSDYERAKAFYAKALAPLGYSLIMEVTAEQTGHDPAA
FT                   GFGADGKPDFWIGGEGAMNKPVHVAIAAKDRATVDAFYKAAIAAGGRDNGPPGIRPHYH
FT                   PNYYGAFVRDPDGHNIEAVCHAPE"
FT   CDS_pept        559085..559336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0520"
FT                   /note="ORF_ID:bsr0520"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45785"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45785"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X07"
FT                   /protein_id="BAC45785.1"
FT                   /translation="MMPMPIEPPEIPPATPGTPTEPPPGIPPGNPQPEITPPVHEPGES
FT                   PRPDELPGRMPEEIPTRGPNGPLTPGPATDATPRRDHI"
FT   CDS_pept        559523..561760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0521"
FT                   /note="ORF_ID:blr0521"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45786"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45786"
FT                   /db_xref="GOA:Q89X06"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X06"
FT                   /protein_id="BAC45786.1"
FT                   /translation="MTNLRFVLLATTALTAMQLANTASHAQGASPLVVAQAQPQETGPD
FT                   GKPKQPPKGPPGAAPPAAPARPAAPPPAAAPPHPPAAPPPAAAPPRPAAPPPPPPPPAA
FT                   RPAPPPPPPPPAAPKQPSPPPAAAPQQHAPTPPPPAPPAARPAPTPPAPPPAAAPQHAP
FT                   PPPPPPAARPTPTPPPPPPAGPAARPTPAPTATPTPVAPPPAAPTARPGSPAPAATPAP
FT                   TPTPAPTATPAPTATPAPGSTPGAPPAGRPGAPPPGVRPGSPPAAGSPPAPGATPAPTT
FT                   TPAPGGTATPPSGRPGPASTPAPGAATPAPTATPAPGGALTPPPGRPGAGPTPGPQGGT
FT                   PPAGAPAAGTPAAPPQAGGLPARPAAPAGAAAPSTVPGSAAATPPPNRAQFAPPTVTPA
FT                   FQAAPTVVAPLPPPPRPPQRDLTPLAIGAGVVAGAVIGATIADLHNQRRESIEGGRTVY
FT                   TEPDRIIIRDPGGQAYVRGNDLYRFRYGARDIRTDTVGGDTRTVVIRPDGSEIITVVAP
FT                   DGRLLRRIRRDPGGRELIIIDNSYRDPQSVGGFYVDAPPPVVNIPYDRYIVDAEEASPD
FT                   VIYQTMEAPPVQRINRRYTLDEIRYSPNIRMQMPSIDVNTITFETGSWTIPPDQAAKLQ
FT                   VIADGLNRAIQANPRVVFLIEGHTDAVGNEVDNLSLSDRRAQSAAELLTQQFGVPAENL
FT                   TSQGYGEQYLKEQTQGPSAINRRVTVRNITPLLNGGQASLPPPPPGTAPPR"
FT   CDS_pept        complement(561952..563289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="ORF_ID:bll0522"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45787"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45787"
FT                   /db_xref="GOA:P59607"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59607"
FT                   /protein_id="BAC45787.1"
FT                   /translation="MTTILKSLPKGEKVGIAFSGGLDTSAALLWMKQKGARCYAYTANL
FT                   GQPDEADYNEIPRKAQEFGAEKAVLVDCRTQLVHEGIAAIQSGAFHISTGGITYFNTTP
FT                   LGRAVTGTMLVAAMKEDGVNIWGDGSTFKGNDIERFYRYGLLTNPSLRIYKPWLDQQFI
FT                   DELGGRAEMSAFMTAQGFAYKMSAEKAYSTDSNLLGATHEAKDLESLDSGIKIVNPIMG
FT                   VPFWREDCNVKAEKVVVRFEEGQPTALNGQTFTDPVALFLEANAIGGRHGLGMSDQIEN
FT                   RIIEAKSRGIYEAPGMALLHIAYERLVTGIHNEDTIEQYRISGMRLGRLLYQGRWFDSQ
FT                   ALMLRETAQRWVARAVTGEVTLELRRGNDYSILNTESPNLTYAPERLSMEKVEDAAFTP
FT                   ADRIGQLTMRNLDIADTRTKLKLYTDTGLLSGSEGSQIFRLENDKG"
FT   CDS_pept        complement(563383..564210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0523"
FT                   /note="ORF_ID:bll0523"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45788"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45788"
FT                   /db_xref="GOA:Q89X05"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X05"
FT                   /protein_id="BAC45788.1"
FT                   /translation="MTVKGFSSPPHSAKPRGMNRTGLFIALALWLVIGVVFGLYPELDL
FT                   KLAALFFDPETKTFPLKSSGWAGVARDAAMWIAWAFVLPSLVALVVKMIRPDRPLMVSG
FT                   RAIVFLLVTIILSAGILTNLTFKTYWGRPRPVVVTQFAGDQQFVPWWDPRGGCVRNCSF
FT                   FSGEGATAFWTLAPAALAPPAWRPLAYAGAVVFGLVTSGLRMAFGGHFFTDVSIAALVT
FT                   FVVIWFAYAMIYRWPRTRFSDQAVDAALTRLNMPAYRLRQRLFGRKTGAEPSV"
FT   CDS_pept        complement(564316..564810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0524"
FT                   /note="ORF_ID:bll0524"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45789"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45789"
FT                   /db_xref="GOA:Q89X04"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X04"
FT                   /protein_id="BAC45789.1"
FT                   /translation="MSLIGRLVVIFMGFLAACFVGGMIVVVALLFPEFADLGAGPVDEG
FT                   AIDILLGFGFIFVSGFALVPAAVIVAITEALYIRSALAYAVGGGVVGLACYLGLVPFHS
FT                   DTLQFEGVVRRHLEIMTGAGIVAGVVYWLIAGRNAGAWRNPPPPRKPPPPLPSQSRPDA
FT                   R"
FT   CDS_pept        complement(564977..566179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0525"
FT                   /note="ORF_ID:bll0525"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45790"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45790"
FT                   /db_xref="GOA:Q89X03"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89X03"
FT                   /protein_id="BAC45790.1"
FT                   /translation="MQPTTEPHNAILVEKTPLETYVPPAKPSLIGLSRNELADRLGEIG
FT                   VAPAQRKMRVQQLWHWMYFRGAQNFDEMTSISKGIRAELAQHFTVDRPEVVAEQISNDG
FT                   TRKWLLRLPSGDNVEKAHEVECVYIPETDRGTLCVSSQVGCTLNCSFCHTGTQRLVRNL
FT                   TAGEIVGQVMVARDRLNDWADREDGTRRVTNIVMMGMGEPLYNFDAVRDALLIVGDNEG
FT                   IGISRRRITLSTSGVVPNIVRAGEEIGVMLAISLHAVRDELRNELVPLNRKYPIKELLQ
FT                   ACRDYPGASNARRITFEYVMLKGVNDSLDDAKLLVKLLKGIHAKINLIPFNPWPGTAYE
FT                   CSDWDQIEKFSEYIFNAGYSSPVRTPRGRDILAACGQLKSETEKLSARERQTLRAMAMT
FT                   D"
FT   CDS_pept        complement(566374..567036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0526"
FT                   /note="ORF_ID:bll0526"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45791"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45791"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X02"
FT                   /protein_id="BAC45791.1"
FT                   /translation="MWRVLFLALTAGVTAWGITDSARAQTAQPAPKSAPKEAAPKAAAP
FT                   AANTTAKTAAKPESKPAGPAAAVAGGAEPTLIGQFGTWGAYSATPNGKKVCFALAKPSS
FT                   SKTNPPNRPRDPAYAFVSTRPAEKVNNEVSVMIGYALKPGSESSVEVGGAAFAMYTQGD
FT                   GLWIKNAAEEERMVEAMRKSADLVVKGISAKGTETTDTFSLKGLAQALDKIAQDCRR"
FT   CDS_pept        complement(567153..567992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0527"
FT                   /product="hypothetical oxidoreductase"
FT                   /note="ORF_ID:bll0527"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45792"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45792"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X01"
FT                   /protein_id="BAC45792.1"
FT                   /translation="MFETGLLRGKRILVTGGGSGLGAAMGRRFLALGAELVICGRKFDR
FT                   LETTAAEMRAQSGGKVTTIACDIRDGAAVESMMDAIWREAPLDILVNNAAATFIAQSER
FT                   LSFRAADAILAPTLHGAMYCTLAAGKRWIDGRHGGVVLSILSTSTITGRAFTVPSAMAK
FT                   SALLAMTKSLAVEWGPKGIRTVAIAPGPFPTAGASGQLRPEGRDDGWTARNPLGRTGDH
FT                   SELADLASFLVSDRAGYINGEMVVIDGGAHLRSSGAEDLLGWTDAQWADQRAARSRG"
FT   CDS_pept        568234..569208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0528"
FT                   /note="ORF_ID:blr0528"
FT                   /note="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45793"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45793"
FT                   /db_xref="GOA:Q89X00"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89X00"
FT                   /protein_id="BAC45793.1"
FT                   /translation="MKAILCTQYCQPDDLVLAEVPDAVAGPGEAVIAIKAAALNFFDIL
FT                   MIQGKYQIKPPFPFSPAAEVAGVIESIGPGVTDLKVGDRVVASCGHNGAREKIALPAAS
FT                   IVKIPDNLDYDRAAGIIIIYGTALHALEDRASPKPGETLAVLGAAGGTGLAACELGKLM
FT                   GLKVIACASSDEKLEFAKAHGAELTLNYGKEDLKEGLRKLTGGKGVDIIFDPVGGAYAE
FT                   QALRSIAWEGRFLVIGFAAGDIPKMPLNLALLKGCDIRGVFWGAWTRLNPAKNRANLEK
FT                   LVKWTAEGKISSHVDRTFPLAQTADALKVLAGRQAMGKVILHP"
FT   CDS_pept        569473..570561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0529"
FT                   /note="ORF_ID:blr0529"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45794"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45794"
FT                   /db_xref="GOA:Q89WZ9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WZ9"
FT                   /protein_id="BAC45794.1"
FT                   /translation="MPPHGSAFSTTIAKIAVHSAAPPESNLNFSRFAPTVVAFWADSNC
FT                   DLPVPVCRALLDKNKKTKTGTAPRCVSIGGSITMETTAFRPSWGSRALDSEQAASHTST
FT                   ASYIRARAERTDPSSHDPMPLFLSDPLSAPDPREFAPLAVRTRTRIVRRILAAVLAASV
FT                   IAVPIALFWSDINRLLTVNGASWIGAAANEAAAPANPPAARQGPVKDAARVTNTMLASG
FT                   DAQDIAAPATPSREAIATAYQSALQAQAPAPVPTQVAAQPAPPPPAKSLDADTLAGLMA
FT                   RAKSLMTIGDIAAARLLLERAANAQDATAAFLLAQTYDPAVLGTKDTRSITADAGAARD
FT                   WYQRAASLGSAEARRRLTQLSN"
FT   CDS_pept        570580..571740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0530"
FT                   /note="ORF_ID:blr0530"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45795"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45795"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WZ8"
FT                   /protein_id="BAC45795.1"
FT                   /translation="MRNVLGMALAAIMTICAFAARADQTEYDPAKVSDSLKAIFQFGST
FT                   STKQALNANTVTLITGTIGGTYVQFGADLASVLDDGNKIRVLPIVGRGSVQSVADILFL
FT                   QGVDLGVVRADTLDYLERKGFAKDIKKQFTYVTKLYNEEMQVIAPRSIATLKDLEGKKV
FT                   SVDLPNGGTFVTALTVFERLGIKANFVYVEQRIAMEKLKAGEIDAVIVVGGKPYKSVST
FT                   FGNDGRFHLAKVDYAKPLQSDYLPATLTAKDYPNLIKEGESVDTIAVPAVLAAYNWAPN
FT                   TERYRKLALFVDAFFTKFPSLQNPPFHPKWKEVSLAAPLSGWSRLPVAQQWLDKHGVEP
FT                   VTRQRFEAFLKQSPAAAQVSDADKETLFKQFQAWDAEKARAQAEKK"
FT   CDS_pept        complement(571810..572250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0531"
FT                   /note="ORF_ID:bll0531"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45796"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45796"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WZ7"
FT                   /protein_id="BAC45796.1"
FT                   /translation="MIVISRGCGDPPLRAERGVWTMAAEHSVGFEPADRLAEDRESVRR
FT                   SFWRKLKGVAAHLPFAEDLLAAYYCAFDRQTPRHVQASLLGAIAYFILPFDFVPDVMPI
FT                   LGFTDDAAVLATAIRMVASHITTEHREAARAALKRGVDEAGE"
FT   CDS_pept        complement(572283..572585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0532"
FT                   /product="4a-hydroxytetrahydrobiopterin dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /note="ORF_ID:bll0532"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45797"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45797"
FT                   /db_xref="GOA:Q89WZ6"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WZ6"
FT                   /protein_id="BAC45797.1"
FT                   /translation="MAERLTTEARKQALGGIPDWTEVSGRDAIGKTFVFKDFNEAFGFM
FT                   TRAALVAEKMDHHPEWRNVYKTVEVVLSTHDAGGVTALDIELARAMNAIAKLTPG"
FT   CDS_pept        572737..574182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0533"
FT                   /note="ORF_ID:blr0533"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45798"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45798"
FT                   /db_xref="GOA:Q89WZ5"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WZ5"
FT                   /protein_id="BAC45798.1"
FT                   /translation="MKLSLKRLFGRSMTGGLDLAETPSPPSPRSAARKTALVSLALVLA
FT                   IVGALAGGYYFAMRPVALKIAVGPPNSDDIKVVQALTQAFSQNKSYVRLRPIQTDGATA
FT                   SAEALAEGKVDLAIVRGDVDVPKNAQAVATLRKNVVVLWSVPGKGKKKGAKITKIAQLV
FT                   GHRVGVVGRTQANVNLLKVILQQYGVDPAKVEIIQFPANEAAEAIKAQKADAYLAAGPV
FT                   NSKITSDAIAASAKDFGTPTFLAIDSADAIAQNHPVYEAAEIPAGTYGGSPDRPEDEVK
FT                   TISFAHHIVARKGVSETTIAAFTRQLFAVRQQLVTEFPLAAKIETPDTDKDAVIPVHPG
FT                   AAAFVDGEEKTFLDRYSDYIWWTLMALSAMGSIGAWFAGYLKKDERDNNSHLRDRLLDM
FT                   IAAARKSETMDELDQMQTEADEILRDTLHCYDHGAIEEGALTAFNIVLDQFHAAIADRK
FT                   AVLFSMPQNPPRAGAQFRAAGNA"
FT   CDS_pept        574307..575890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0534"
FT                   /note="ORF_ID:blr0534"
FT                   /note="putative alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45799"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45799"
FT                   /db_xref="GOA:Q89WZ4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WZ4"
FT                   /protein_id="BAC45799.1"
FT                   /translation="MTAPDAPKTTSESTMNIKFSRRHFLATSTGALGAIAMPYLSRAAD
FT                   RPAVTHGVQSGDVTVDGGVVWARADRPSQMLVEVATTESFKDARALPPIAALPESDFTA
FT                   KMLIENLPGGQDIFYRVRFRDLSHGAIEGEPVVGRFRTAPADRRDVSFVWGGDVAGQGW
FT                   GINPDDGGMFTFSAMRKHRPDFFLHSGDTIYADGPIESEVKLADGKTWKNVTIPEKAKV
FT                   AETLDEYRAAHKYNLTDANLRAVNAEVPIFVQWDDHEVTNNWSLSKELPATYKVRDIAL
FT                   LAARAGRAFHEMYPMRESINEPGRVYRQISYGPHLDVFVLDERSYRGPNGANLETAYGP
FT                   ASYFLGPDQIAWLKRGLLNSRATWKVIASDMPLSLVVSDTPKGGSEAIAQGDGPVRGRE
FT                   FEIADILRFIKTAPISNTVWLTADVHYAAAHYYDPNKAQFQDFEPFWEFVSGPLHAGTF
FT                   GPNALDNTFGPEVRFVKAPGKDSQNLPPSAGMQFFGHVKIDGASGQMTVTLRDRADVAL
FT                   WSTTLDPKLA"
FT   CDS_pept        complement(575914..576348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0535"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:bll0535"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45800"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45800"
FT                   /db_xref="GOA:Q89WZ3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WZ3"
FT                   /protein_id="BAC45800.1"
FT                   /translation="MRLSLIGKNMQPSIARIMIPASPDGSSDVPADVLIVEDDPIIAID
FT                   FEDRLLGFGVRSVRTVGSVAQALAAIAARAPDFALLDVELSRENSFAVAERLAALKIPF
FT                   VFVTGYGAETRIASDFVNRPRLQKPCSSDALEAALRSRGS"
FT   CDS_pept        576456..577250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0536"
FT                   /product="transcriptional regulatory protein"
FT                   /note="Crp family"
FT                   /note="ORF_ID:blr0536"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45801"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45801"
FT                   /db_xref="GOA:Q89WZ2"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WZ2"
FT                   /protein_id="BAC45801.1"
FT                   /translation="MLKGEQGFTMDARIGKATEVGSRPANNLLRRLSPADYALLAPHVI
FT                   VDDAAANELLYSPGDDVQVVHFPCGPSLATFLVPNEDGRDVETILVGREGAVGGIVSEG
FT                   FLPAYTRICVKFGGPFARIHVGKLEAAKLRSPTLRNIFARYADCMLAQIFQSTACNAIH
FT                   SIEQRTAKWILAAMERTGDESSVPLTHEQLATLLGVGRSYASRVLQSFRADGILDTRRG
FT                   SILVRDRDRLRLRACLCNEAVKNHFEEVLRGVYPTEEASSTG"
FT   CDS_pept        577581..578336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0537"
FT                   /note="ORF_ID:blr0537"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45802"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45802"
FT                   /db_xref="GOA:Q89WZ1"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WZ1"
FT                   /protein_id="BAC45802.1"
FT                   /translation="MRHRTSAVLYPLRMSGAFLHTVFDVAAWLAAGAAVYWLSRQGLRF
FT                   PAQSFELPYIAALVFGAGLGAYLFGSANLWLSGESGIARSVEGALAGGIVAVELYKWTA
FT                   GIALRTGARFALPLALGIAIGRLGCYFAGLDDFTYGTPTALPWGHDFGDGILRHPAQLY
FT                   ESAAMGVFALLYVLAVLNRNAFAITNGFYLVLLYYGAQRFLWEFLKPYGTLIGPLTLFH
FT                   LLSLSILLYAAIMLATAPKARPVHECAVA"
FT   CDS_pept        578317..579762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0538"
FT                   /note="ORF_ID:blr0538"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45803"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45803"
FT                   /db_xref="GOA:Q89WZ0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034474"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WZ0"
FT                   /protein_id="BAC45803.1"
FT                   /translation="MNAPLRKSRPYIFWGQTQSLCETCLKLVPTKIQILDNEVWYEKRC
FT                   KEHGVQSTLVSTDAAYWRLCKDFIKPGDRPLQFQHRTEFGCPYDCGLCPDHEQHSCLAL
FT                   IEITEHCNLTCPVCFAESAPARTKFTPLATVEKMLDALVASEGEPDLVQISGGEPTLHP
FT                   DFFKILDAVRARPIRHVMINTNGLRIARERDFVARLAENKRGLEVYLQFDSLQRDALIN
FT                   LRGADLRKIRQQALENLDHYGVSTTLVATIKRRVNDAEIGDIVRHALTWKCVRGVTLQP
FT                   VQDAGRNENFDEKTDRIMLSEIRNRVVETGVFGDKDMIPLPCNPESISIGYGLRTGEKV
FT                   LPLTSLIPQEQLVAVMPNTISPEKYPMLREKFVDLFSLSSGPLNTSERVCELLCCLPSF
FT                   EVPEGLSYENVFRVTIVQFLDRFNFCVGNVKRSCIHFVTEQGAIIPFDTYNLFYRNGKI
FT                   DGIRAALAGETYREARQSEEVPR"
FT   CDS_pept        580023..580304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0539"
FT                   /note="ORF_ID:bsr0539"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45804"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45804"
FT                   /db_xref="GOA:Q89WY9"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WY9"
FT                   /protein_id="BAC45804.1"
FT                   /translation="MSNIAPPPPPPPAAPPQRGGCLTALMAISGVILLLPGLCALLFGG
FT                   ISISEGGKIDSDIAPLVFLGLVVGIGGVVLIWAAIKGRKAPAHPGTQP"
FT   CDS_pept        580542..582368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /product="GTP-binding tyrosin phosphorylated protein"
FT                   /note="ORF_ID:blr0540"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45805"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45805"
FT                   /db_xref="GOA:Q89WY8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WY8"
FT                   /protein_id="BAC45805.1"
FT                   /translation="MNLRNVAIIAHVDHGKTTLVDKLLQQSGTFRENQKVTDRAMDSND
FT                   LERERGITILAKAASVQWKDTRVNIVDTPGHADFGGEVERILNMVDGALVLVDAAEGPL
FT                   PQTKFVVSKALKVGLKPIVVINKVDRPDARPTEVINEVFDLFAALDASEEQLDFPILYG
FT                   SAKQGWMAETPEGPKDKGMEPLFDLILRHVAPPTVEEGPFRMIGTILEANPYLGRIITG
FT                   RISSGTLKPNQQVKVLNAEGKLVETGRITKILAFRGLERTPLDEAEAGDIVAIAGLTKG
FT                   TVADTFCDPSVEVPLPAQPIDPPTVSMSFIVNNSPLAGTEGDKVTSRMIRDRLLREAEG
FT                   NVALRVVEASDKDAMEVSGRGELQLAILIETMRREGFELSVSRPRVVFQKDEATGATME
FT                   PIEEVVIDVDEEHSGVVVQKMSERKAELIEMKPSGGNRLRLVFYAPTRGLIGYQGELLT
FT                   DTRGTAIMNRLFHGYAPYKGEIQGRRNGVLISNDQGEAVAYAMFKLEDRGPMMIEPGWK
FT                   VYKGMIVGEHTRDNDLEINVLKGKQLTNIRTTSKDEAVRLTPPIRMTLEKALAYIEDDE
FT                   LVEVTPKSIRLRKKHLDPNERKRAEKSKEAVA"
FT   CDS_pept        582605..583852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0541"
FT                   /note="ORF_ID:blr0541"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45806"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45806"
FT                   /db_xref="GOA:Q89WY7"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WY7"
FT                   /protein_id="BAC45806.1"
FT                   /translation="MSSLPSSVDVAIIGAGAAGLGAAHALAGSGLSAIVLEARDRLGGR
FT                   AWTVQASPEVTFDVGCGWLHSADQNSFVAIARQLDFEVNKDLPPWRERAFGNAFPQSQR
FT                   DEFMQAMDAFYERLWQAAQKGKDEPASLSLEPGNRWNPMIDAISTYINGCELKDMSTLD
FT                   WDAYEDTNLNWRIRRGYGALVVAYGAPCPVALNCMVTLIDHSGPRIRIETSQGTLTAGK
FT                   VIVTVPTNLIADEAIRFSPQLPAKVDAAAGLPLGVDDKVTLALSDAEAFPREGNLRGAT
FT                   MRTAMGTYHIRPFGQPCIEGFFGGSFARELEDAGDGAIAAQSIDEIASFLGNDIRHKLK
FT                   PLCESRWAHDPFARGSYSHALPGHAGDRAVLAAPVDGRLFFAGEATSPTFFTTAHGARD
FT                   SGERAAKEVLAALRKH"
FT   CDS_pept        complement(583849..584748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0542"
FT                   /note="ORF_ID:bll0542"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45807"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45807"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WY6"
FT                   /protein_id="BAC45807.1"
FT                   /translation="MSKAVLTTKVTPGYKDLPEVRYHFPRTYLNQVRQAVGDYILYYEP
FT                   RRTTVELSSFGGRQSYFGVARVVDLVEDKDQADHYYALVDDYLDFDRPVPFVEGGHYYE
FT                   SALRKSDGSTNKGAFGRAVRLIPDAEFDQIWKAGFAPILGEETSRHQPRQFEISEPTVP
FT                   FERPIIEMTISRPFRERSFMYNVRAAYENRCAMTGLRLINGGGRPEVQAAHIQPVAEKG
FT                   PDSVRNGLALSGTVHWMFDRGLISIGDDYKILTAENHVPDDALRLLNHSRTINLPNDTA
FT                   FYPNALFLKFHRDKIFKG"
FT   CDS_pept        complement(584804..585211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0543"
FT                   /note="ORF_ID:bll0543"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45808"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45808"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WY5"
FT                   /protein_id="BAC45808.1"
FT                   /translation="MPKWPDDDVILFDGVCIFCSRWVRFVAKRDTAKRFRFTPIQSDYG
FT                   ARLARTFGIDAGDPDTNAVVHGGEVFMKSDAALTVLSLLPGWSWVSVLFAVPRPLRDPI
FT                   YSLIARNRYRIFGKYNTCFVPDADLRARVIE"
FT   CDS_pept        complement(585211..586527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0544"
FT                   /note="ORF_ID:bll0544"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45809"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45809"
FT                   /db_xref="GOA:Q89WY4"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR025695"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WY4"
FT                   /protein_id="BAC45809.1"
FT                   /translation="MMNQRTILVLGASGLIGRFVTDDLRARGFRAVGVARSLSPAQKMG
FT                   ALDIELPILSLDAAALTRLLREQAVDVVVNCLGVLQDGPGSDTSAVHRDFVARLLQAIG
FT                   DSAIRLVHISIPGMAEADRTAFATTKREAERLIAASGIAHAILRPGFVVAPSAYGGSAM
FT                   LRALAAFPLDLPGAEMATPFQPVAVEDISATIAWLAARDIDDASVISVCWDLMLSEPVT
FT                   MAGIIKQFRFAFGTAGWPRIAMPTLMLDLGAKIGDLANYLGWMPPMRSTAIAELRRGVS
FT                   GDPSAWIAATGIVPKTLAEVIGRHPATIQDKWFARLFLVKALIFASLAAFWVVSGFIAL
FT                   FVSYRAAAGILSAHNFAPALVDPITIGTSLMDMSIGVLIAFRRTAAVGLVAGIVASLGY
FT                   MLGAAILTPDLWIEPLGALVKTGPAIVLMLVALLMLDNR"
FT   CDS_pept        complement(586532..586999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0545"
FT                   /note="ORF_ID:bll0545"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45810"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45810"
FT                   /db_xref="GOA:Q89WY3"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WY3"
FT                   /protein_id="BAC45810.1"
FT                   /translation="MTLYFLVKYLHVLGAIVILGTGTGIAFFMLMAHRTHDADFIARTA
FT                   SVVVIADAIFTLSAVILQPVSGGLLMMLSATSFTERWLLASLALYAIAGLFWIPVVFMQ
FT                   IEMRDLARKASEQRAALPERYFVLFRRWFAFGFPGFGATMLILWLMVAKPF"
FT   CDS_pept        complement(586996..587874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0546"
FT                   /note="ORF_ID:bll0546"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45811"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45811"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WY2"
FT                   /protein_id="BAC45811.1"
FT                   /translation="MRLFNIFALLPLLALLTAPPLCAQVTFAASGEEGEPFRRQEWRVP
FT                   SPDTDIAAHALLFRPFGAGPFRLAVIAHASTQNGLRRAQMPQPEYRALTAFLVARGFAV
FT                   LVPERLGHGATGGRYVEDQGGCDEADYARAGRATAEEISLALDHLRKQDFIRKDAAIVI
FT                   GHSAGGWGALALANAEPKTISAITVIAPGRGGHANDEPNRICAPHALLAAAAEFGKAAR
FT                   IPVTWLVASNDSYFPPVFSKSLADAFRGGGGKVDFRALPGVGSEGHWMIETEAGVKAAG
FT                   SELERALKKKP"
FT   CDS_pept        588141..588650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0547"
FT                   /note="ORF_ID:blr0547"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45812"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45812"
FT                   /db_xref="GOA:Q89WY1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WY1"
FT                   /protein_id="BAC45812.1"
FT                   /translation="MSTTLIEVRPAKAADATAVASTHDEAWRSAYQGIIPGAELEKLIN
FT                   RRGPQWWDSAIRKGSRVSVLVFGDKIAGYANYGRNRARSLHFDGEIYELYLRPEFQGLG
FT                   FGRRLFAAARRDLMQSGLKSMVVWALSDNDPATEFYRALGGRMVARSSERFGPKSLDKV
FT                   AFAWTN"
FT   CDS_pept        588829..589365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /product="inorganic pyrophosphatase"
FT                   /note="ORF_ID:blr0548"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45813"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45813"
FT                   /db_xref="GOA:Q89WY0"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WY0"
FT                   /protein_id="BAC45813.1"
FT                   /translation="MRIDAISIGKNVPQDVNVIIEVPVGGEPIKYEMDKEAGTLVVDRF
FT                   LYTPMRYPGNYGFIPHTLSDDGDPCDVLIINTRAIIPGAVMSVRPVGVLFMEDEAGGDE
FT                   KILAVPSSKLTQRYDKVKSYSDLPDITLQQIQHFFEHYKDLEKGKWVKILRWGGPEDAH
FT                   KLILEGIEREKKKKG"
FT   CDS_pept        complement(589499..590383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /product="bifunctional methylenetetrahydrofolate
FT                   dehydrogenase/cyclohydrolase"
FT                   /note="ORF_ID:bll0549"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45814"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45814"
FT                   /db_xref="GOA:Q89WX9"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WX9"
FT                   /protein_id="BAC45814.1"
FT                   /translation="MTAKIIDGKVIAADLRARVADEVARVKREHNLVPGLAVVLVGNDP
FT                   ASEVYVRSKGTQTQAAGMASFEHKLPADVSQADLLAVVAKLNRDPAVHGILVQLPLPKG
FT                   LNTEAVINAIDPAKDVDGLHPNNAGRLAGGFEALSPCTPLGSIILTKSVHPSLEGLNAI
FT                   VIGRSNLVGRPLVQLLLNENATVTIAHSRSRDLPGLVKRADLVYAAVGKPEMVRGDWLK
FT                   PGATVIDIGISRIPKEDGKTRLVGDVAYQEALGVAGAITPVPGGVGQMTVACLLVNTLR
FT                   AACAIAGLPKPAV"
FT   CDS_pept        complement(590385..590669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0550"
FT                   /note="ORF_ID:bsl0550"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45815"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45815"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WX8"
FT                   /protein_id="BAC45815.1"
FT                   /translation="MTPRGGRDDIDGIEQLADGRSVLKVRVRAIADGGEANKAVLVLLA
FT                   KSLGVPKASVRLLSGATSRLKQIAVDGDPARLGETLRQLASAKSKDRGN"
FT   CDS_pept        complement(590754..591044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0551"
FT                   /note="ORF_ID:bsl0551"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45816"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45816"
FT                   /db_xref="GOA:Q89WX7"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WX7"
FT                   /protein_id="BAC45816.1"
FT                   /translation="MRAVLDIVIIVLDLYVWLLIASAILSWLIAFNVVNTRNQFVSAVA
FT                   EFLYRITEPVLAPIRNFLPSLGGLDISPIILILLIMFIERVILYYIYPNVI"
FT   tRNA            591251..591326
FT                   /product="trnA-CGC"
FT   CDS_pept        complement(591435..592247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0552"
FT                   /note="ORF_ID:bll0552"
FT                   /note="putative enoyl-CoA hydratase (EC 4.2.1.17)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45817"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45817"
FT                   /db_xref="GOA:Q89WX6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WX6"
FT                   /protein_id="BAC45817.1"
FT                   /translation="MAYEHILYEVRDKVATITLNRPDRMNAWTPTMERDVRHAMEASSA
FT                   DDNVRVIVLTGAGRAFCAGADMDALKGLDPDDVRRASSLPPFDMNRRPDWQTRYGFYPS
FT                   IGKPVIAMLNGATAGIGLVHALYCDLRFAADNTVFTTAFARRGLIAEHGISWMLPRIVG
FT                   HANAMDLLLSARRVSSDEALRIGLVNRLCSPEKLREETYAYARDLADFVSPSAMAVIKR
FT                   QLYEVPFQTLAEATIEANREMMVALGGSDFREGVASFMEKRPPRFTGR"
FT   CDS_pept        complement(592347..593150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /product="GMP synthase"
FT                   /note="ORF_ID:bll0553"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45818"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45818"
FT                   /db_xref="GOA:Q89WX5"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WX5"
FT                   /protein_id="BAC45818.1"
FT                   /translation="MSFRTDRFGGAELVPFPKRRALGASAARPEARLPVLIVLHQESST
FT                   PGRVGNALRALGHRLDIRRPRFGDPLPETLDQHAGAVVFGGPMSANDPDDYIRREIDWI
FT                   EIPLREQRPFLGICLGAQMLAMQLGARVAPHAEALTQIGYYPIRPTAAGHALCPAWPAQ
FT                   VYHWHREGFELPAGTELLAEGDDFPVQAFRAGHAFGVQFHPDVTYAMMHRWTTRGYDGF
FT                   SAPGARERHHHFADRAVYDAAERAWLDHFINGWLARRPLLAQAAE"
FT   CDS_pept        complement(593280..594059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0554"
FT                   /product="short-chain dehydrogenase"
FT                   /note="ORF_ID:bll0554"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45819"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45819"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WX4"
FT                   /protein_id="BAC45819.1"
FT                   /translation="MTERVTLITGASAGIGTELARVFAANGHRLALTARRADRLEALAN
FT                   ELAAKGGKKPIVIACDLQEADAGEKIAAALAAEDVELDHLVNNAGFGVFGDAIECDRDE
FT                   QVGIVDVNVRALTDLSLRFADQLIRNKGGLLNVGSVAGFLPGPGMAVYYASKAYVISLT
FT                   EALRAELAPRGVRVTVLCPGPVPTEFQARAGVGSGHNTALLNVPASDVAREAYRGLMAN
FT                   KRAVLPGLGIKIVPFALRFFPRGFILSATSRFQRQRR"
FT   CDS_pept        complement(594287..594775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0555"
FT                   /note="ORF_ID:bll0555"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45820"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45820"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WX3"
FT                   /protein_id="BAC45820.1"
FT                   /translation="MLDGLRQFIADIVAPHAGDRAFGDSDYRLAATALLVHVVSLDGQP
FT                   TATEQRKLHSLIESHFGLDRGTADRLIADATQVEGEAVDLYHFTSVIMRSLDEAGRKRI
FT                   VQMMWELVYADGQVSEFEDNVVWRASDLLGISQRDRIDLKHAVADRAGNQVKDGAVGG"
FT   CDS_pept        complement(595000..596409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0556"
FT                   /note="ORF_ID:bll0556"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45821"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45821"
FT                   /db_xref="GOA:Q89WX2"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WX2"
FT                   /protein_id="BAC45821.1"
FT                   /translation="MSDIQAQFSVLKQTADPKAVDEIARLIEDGEDHELNRVNVLDFAR
FT                   QHGVDEERAISAFLHSARLGLFDLGWNVLCPGCGGVLGAHATLKALKPDDYHCALCACG
FT                   YKASVDDQVEVSFTVNPRVRRIAAHDPDTLPVWEYFKQVFWSSGVDFNKESFATLANEV
FT                   TLDTMELPAGEKATMSLQLPNDFIIIFEPVTHAAHFIDVQGEPTKDRQQLAIMYNRVQA
FT                   PTGTTTMRPGPLRLSLENQAGVRVLPSVFIAAEALHHLIGKRKPFLTAKRMLSNQTFRD
FT                   VFKADNLSVDQRLQITSLTFLFTDLKGSTALYERVGDLAAFDLVRAHFHALLEIISSEK
FT                   GAVVKTIGDAVMATFVRPEHAIVAGLRMRAAMDVLNKQRGTADLIVKIGIHEGPCLAVM
FT                   LNERQDYFGQTVNIAARVQSLSTAQEMHITGSVLDAPAVAEVLKQREIKPIQKQAALRG
FT                   IADKMVVYEIP"
FT   CDS_pept        complement(596460..597827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0557"
FT                   /note="ORF_ID:bll0557"
FT                   /note="putative cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45822"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45822"
FT                   /db_xref="GOA:Q89WX1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WX1"
FT                   /protein_id="BAC45822.1"
FT                   /translation="MNIASVRRPIVPPTPPRAPDDMSFLGRVAVIRQNMIATWGQRAYE
FT                   EDVLEGRFFLHKSFILNRPDAIRHVLLSNYENYTRTPAGIRMLRPVLGEGLLIAEGHAW
FT                   TFQRRTLAPAFTPRATANLVPHMTAVLDETIAKLDARSGETVDLRETMQRMTLEIAGRT
FT                   MFSFGMDRHGPTLRNFVVEYGERLGRPYFLDMLLPVSWPSPMDFARARFRKRWTEFVAM
FT                   LIAERRAAGKKDGAPPRDLFDLMDEARDPETGKGFSDEQLIDEVATMILAGHETTATAL
FT                   FWALYLLALDPDTQEEVASETRGEHLDSMADIDRQKFTRAVIEETMRLYPPAFLIARAA
FT                   RAKDNAAGIEIGRGDIIMIAPWLLHRHEKLWDQPNAFVPKRFMSTEAPDRFAYLPFGAG
FT                   PRVCVGAPFAQAESVLALARLIGAFRVELVDTVPVIPHGVVTTQPDRSPMFRITRR"
FT   CDS_pept        complement(597862..599265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0558"
FT                   /note="ORF_ID:bll0558"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45823"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45823"
FT                   /db_xref="GOA:Q89WX0"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR040664"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WX0"
FT                   /protein_id="BAC45823.1"
FT                   /translation="MQRGGFAGEEQMKLSRRTILQGAGTLPFALASVRMDAFAQTAPAA
FT                   QGAEVPPILFVHGNGDYDALWMTTMWRMESNGIARDRMLAINFTDPNARSDDTVEQANR
FT                   SSTEDQRRELAAAIAELKRRTGAARVALVGSSRGGYAIRNVVRNGGVADVSHAVLCGTP
FT                   NHGVFASDDQPNNEFNGRGVFLRGLNGGESEVTPGTAFLTLRSDGMDKYAQADGRFIGK
FT                   PGTPTGVTAEGPELRGATNLVLGALDHREVAFHPRAFREIYKFIAGREPARIAIVPEPS
FT                   VRLSGLVTGTPGGVSTNRPVAGATVDIFRVDPDTGERNGNAVHSAKTGADGRWGPAQVE
FT                   PSWPLEFVLASPDAPTTHIYRSPFPRSSDVVHLRAARPLGPADKDAGAVVIMSRPRGYF
FT                   GLPRDVVLLDGKEPADVKPGVPTDATATLRLPAGEIGRNIVAQFGEERIVARLWPAAEN
FT                   RIAVAELTY"
FT   CDS_pept        599370..601058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0559"
FT                   /product="MFS permease"
FT                   /note="ORF_ID:blr0559"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45824"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45824"
FT                   /db_xref="GOA:Q89WW9"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WW9"
FT                   /protein_id="BAC45824.1"
FT                   /translation="MTEQPNRQRIAADGIAAPLRYTVFRRIWLASLLSNLGLLIQGVGA
FT                   AWAMTQMAASADKVALVQTALMLPIMLISMPAGAIADMYDRRIVTLVSLMIALTGATAL
FT                   TILAGLKLITPEALLAFCFVVGSGNALFGPAWQSSVSEQVPPEALPSAVALNGISYNIA
FT                   RSFGPAVGGVIVAALGAVAAFACNAILYLPLLVVLLLWRRSTEPSRLPREKLNRAMVSG
FT                   FRYITNSPPIKIVLLRTLVMGLIGGAIMALMPLVARDLLHGGAQTYGIMLGAFGMGAVI
FT                   GALNIHELRKRMSGESAIRACTISMAFAMAALAVSTEPVLTATALVLAGAVWMAAVALF
FT                   NIGVQLSAPRWVAGRSLAAFQASISGGIAIGAWGWGHLTDYAGVEVALLVAAGLMLISP
FT                   LLGIWLTMPRVGARNEDAEVLADPEVRLSLTGRSGPLVVEIEYRVSQENARAFHNVMQD
FT                   VQLSRQRNGAYGWSIARDIADPELWTERYHCPTWFDYLRQRNRSTLSERALHQQAIDFH
FT                   IGPEPVRVRRMLERPFGSVRWKEETPDQGASEVLPVVATAAGSST"
FT   CDS_pept        complement(601214..601429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0560"
FT                   /note="ORF_ID:bsl0560"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45825"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45825"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WW8"
FT                   /protein_id="BAC45825.1"
FT                   /translation="MTRFLFVISLLLCASGASAQQQPGHDACARDVTRFCRPVMNNGDQ
FT                   AVLACLKQNRTRLSKGCDKVLTEHGQ"
FT   CDS_pept        complement(601595..601918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0561"
FT                   /note="ORF_ID:bll0561"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45826"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45826"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WW7"
FT                   /protein_id="BAC45826.1"
FT                   /translation="MTKSFTAKSLTSKSLSSKIRDTSLALGFAAIVSIVSTTSSFAFSA
FT                   EAQQQCTGDAFRLCSSEIPNIPKITACMMKHRSDLSAGCRAVMDKDLAKGASRKVADAQ
FT                   GNQ"
FT   CDS_pept        602173..603228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0562"
FT                   /note="ORF_ID:blr0562"
FT                   /note="putative polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45827"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45827"
FT                   /db_xref="GOA:Q89WW6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WW6"
FT                   /protein_id="BAC45827.1"
FT                   /translation="MRNALGLMLASVVAAVVIAAGGWFYYSASADPGAPKTVAARAADP
FT                   LPAQTKIAAKDDVATTAAIAAKPTAVAQASAPTPAPVAPVQPKQACANPNALGVARVVE
FT                   IDTTGGPGFGFEHFKQFDFLTDKEVVLTFDDGPWPVNTPAVLKALADECTKGLFFSVGK
FT                   HATYHPEILRQVLAQGHTVGTHTWSHVNLNSKKMTEQQVKDEVEKGFSAVRFALGTNPA
FT                   PFFRFPQLQHNPAMVTYFGTRNVAMFSTDIDSFDFRKGATPEKIVETVMGRLDKLGKGI
FT                   ILMHDFQKHTGEAMPALLARLKAGGYKVVQMKAKTTFQTLPEYDEALLKDLKVPTSSAR
FT                   PIGSVVQTVSQ"
FT   CDS_pept        complement(603394..603762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0563"
FT                   /note="ORF_ID:bll0563"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45828"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45828"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WW5"
FT                   /protein_id="BAC45828.1"
FT                   /translation="MRKIILVAAMVLASASAQAAGPRSLSLATASEQASAPQATATIAV
FT                   TTQVSEAAPVTEAPKYVDRPPAISAPAPAAAPAVATTTSAPAATATKTTAKVNKPKHKR
FT                   TWTEGRIISELHRHGIYW"
FT   tRNA            complement(603930..604005)
FT                   /product="trnT-CGU"
FT   CDS_pept        complement(604105..605847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0564"
FT                   /note="ORF_ID:bll0564"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45829"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45829"
FT                   /db_xref="GOA:Q89WW4"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016982"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WW4"
FT                   /protein_id="BAC45829.1"
FT                   /translation="MLRIVLFLVLIALAAAGAAWVADQPGDLVLTAGGFRASTTLPRFV
FT                   FLLGLFAAAVVLVWSILTTIWRTPGRLRRRSHEKRHARGRHAITHGLLAIGHGDTALAR
FT                   RHAETARRHAPNDPLALLLHAQSAQLEGNRDEAQRAFRAMAEREDTRLLGLRGLFIEAQ
FT                   RADDAVGAVMIAEEAIKLSPSSTWASHAVLGFRCARGDWSGALAILDSNLSAGLIDKPA
FT                   YRRQRGVLLTARALELQTMDRDVARESVMEAIKLAPTLVPAAVLAAKFESEAHQVRRAM
FT                   KLVEAAWLANPHPDLAEAYAHVKLGDSARQRLQRVETLAAKTPADKAGHIEGQLALARA
FT                   AIDASEFSRARAVLAPYVNDPTQRVALLMAEIERTEHGDGGRARAWTLRAVRARHDPAW
FT                   TADGYVSDRWRPVSPVTGRLDAFQWQTPVASLPSDKGDLIESSAFEEAMLAAPPPKRVT
FT                   APANDTLMEPAPAASVPAEQDNSPPAAKEEPKEEPAMTSAEPVTPAPEPAESSPAAATP
FT                   VFRTRADLGKPAPVPIPAVIPIVRAPDDPGIDDEGPSDEFTEQIGTPKAQAGGWRGFWS
FT                   RWGA"
FT   CDS_pept        complement(605884..607095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0565"
FT                   /note="ORF_ID:bll0565"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45830"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45830"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WW3"
FT                   /protein_id="BAC45830.1"
FT                   /translation="MADDKPEDAGLAPESGRAKRPPPTIDLEATDVSTQPQEVAGEPEA
FT                   PPVSEHTEPEQAKSEQADAEPERAEAQAAVAPAPASPPVSPWVIAPLSGAVAAAVVIAV
FT                   GWMLGWPAVQAPPAAPQVTSATVDALGGRVAAVEAKAGKPAADPAMVARIDALEKSVGS
FT                   LRSDIANLRAQSDKTASALNDAKSAPGAASPDLAALYDRIAQLERAGKTERAELAQQGE
FT                   KIADARTMDDKPLRHVVAAALLDVAVRHGDPYEAQLAAARSLAAKPEMLKPLDTFASSG
FT                   IPTPVALSRELLNIVSKLSPPADAQSSGGGIVERLQAGASKLVRIERTDGVGNDRGAIV
FT                   ARVTAAALRNDFVEARRELKTLPDADRAPAQAWLDKANARDAALAASRKFADDAMADLV
FT                   KPAQ"
FT   CDS_pept        complement(607185..607931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0566"
FT                   /note="ORF_ID:bll0566"
FT                   /note="putative uroporphyrinogen III synthase (EC 4.3.1.8)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45831"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45831"
FT                   /db_xref="GOA:Q89WW2"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WW2"
FT                   /protein_id="BAC45831.1"
FT                   /translation="MSILVTRPHPDNEATADNLRARGHVVLLAPVLKFEPVAFHDESEA
FT                   NYSAIIVTSANAIRAVAPQLQDLGLLKLPLFAVGEHTATAARDAGFAEVIIAGGDSAAL
FT                   RDTVVRSARDKVLKKKSTLLYLAGADLSRDLGGELGTEGFNVVTQTTYRMAPVKVLPRD
FT                   VCEGFAAHGIEAVLHYSRRSARAFLDAARDEGVEISALAIPQCCLSETVASVLRDAGAS
FT                   QVLVAAKPDENALFDTLERALQTRLA"
FT   CDS_pept        608083..609156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /note="ORF_ID:blr0567"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45832"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45832"
FT                   /db_xref="GOA:Q89WW1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WW1"
FT                   /protein_id="BAC45832.1"
FT                   /translation="MLVLGIETTCDETAAAVIERAPDGIGKILSNIVRSQVDEHAPFGG
FT                   VVPEIAARAHVDLLDGIIDRAMREAGIGFAQLNGVAAAAGPGLIGGVIVGLTTAKAIAL
FT                   VHDTPLVAVNHLEAHALTPRLTDGIEFPYCLFLASGGHTQIVAVTGVGQYVRLGTTVDD
FT                   AIGEAFDKVAKMLGLPYPGGPQVERAAAGGDAARFAFPRPMQGRPDANFSLSGLKTAVR
FT                   NEASRIAEITPQDISDLCASFQAAVLEATADRLNVGLRLFREQFGAPRALVAAGGVAAN
FT                   QAIRGALHDVARQAKTQLIMPPPALCTDNGAMIAWAGAERLALGMTDTMEAQPRARWLL
FT                   DANATAPAGYGKTRAGF"
FT   CDS_pept        609345..610325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /product="glycerol-3-phosphate dehydrogenase [NAD(P)+]"
FT                   /EC_number="1.1.1.94"
FT                   /note="ORF_ID:blr0568"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45833"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45833"
FT                   /db_xref="GOA:Q89WW0"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WW0"
FT                   /protein_id="BAC45833.1"
FT                   /translation="MTAFHSVAVIGAGAWGTALAMVAARAGRSVTLWARNAEHATRIAS
FT                   TRDNPRLPGVRLAPDIVVTSELALAARADMLLIATPAQHLRGAVNMLASHIARPTPVVA
FT                   CAKGIEHGTHKFMTEVIAEAALHAQPAILSGPSFADDVARGLPTAVTLAAKEEELASSL
FT                   VQALGSPTFRPYHSTDVRGVEIGGAAKNVLAIAAGIVVGRNLGASALAALTTRGFSELA
FT                   RLGRACGARPETLSGLSGLGDLLLSCSTAQSRNFALGIALGRGEAAPAGKLAEGAFTAP
FT                   VLVELAAARNVDMPVSQAVAAILDNKLTIDAAIEGLLTRPFKAEE"
FT   CDS_pept        610444..610890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0569"
FT                   /note="ORF_ID:blr0569"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45834"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45834"
FT                   /db_xref="GOA:Q89WV9"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WV9"
FT                   /protein_id="BAC45834.1"
FT                   /translation="MPGHDERIGRAMNYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNY
FT                   TARQNLVAMKKGDKAFFYHSNEGKEIVGIAEIVKEAYPDPTDKTEKFVCVDIKADKPLK
FT                   TPVTMAAIKAEKKLADMALVKYSRLSVQPVTAEEWKLVCKMGGM"
FT   CDS_pept        complement(610917..612032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0570"
FT                   /product="adenylate cyclase"
FT                   /note="ORF_ID:bll0570"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45835"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45835"
FT                   /db_xref="GOA:Q89WV8"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WV8"
FT                   /protein_id="BAC45835.1"
FT                   /translation="MTKTGLLRHHRAMHLAPTLAWLVDAASDSQGADRLLADLGAHLVA
FT                   DGVPLAAGALTLEVPHPLIAKRTWLWRAGTGTVIEALGFAPGGLAPDPPNDAGRRWLRG
FT                   IADGEVHEDIVGRPDGPVLGWIGPRPFTADEIEQLRQAARFAATPLAVLAARATLRATL
FT                   DAYLGKRSAERVLAAPLRRDLGETIQAALLYADLRNFTILSETTPSAQVIAALDAWFDR
FT                   IAGAVHAFGGEVLKFIGDGVLAIFPVVEASPRRACDAALRAAGAARAGMAHLNDERRNQ
FT                   GLPPLSFGAALHLGEMLWGNIGAANRLDFTAIGPAVNLASRLEGLCKPLRETVLVSGAL
FT                   AAETDMALVALGSHPLRGIAAPCEVFALPET"
FT   CDS_pept        612119..612574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0571"
FT                   /note="ORF_ID:blr0571"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45836"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45836"
FT                   /db_xref="GOA:Q89WV7"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR039981"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WV7"
FT                   /protein_id="BAC45836.1"
FT                   /translation="MTEPFIVRRETQIAAPRATVFAYLTDPEKILSWMGSDATTEPHPG
FT                   GLYLLKGIGPRGAAARGAFREVVPVHRLAYTFGWEGGQEVPPGSSLIEIDLIERDGGTL
FT                   LRMTHSGLPTEEQAAAHAKGWAHYLERLTTAAAGNDPGPDNGVSTKS"
FT   CDS_pept        complement(612589..613758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0572"
FT                   /note="ORF_ID:bll0572"
FT                   /note="putative DNA topoisomerase I (EC 5.99.1.2)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45837"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45837"
FT                   /db_xref="GOA:Q89WV6"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WV6"
FT                   /protein_id="BAC45837.1"
FT                   /translation="MMDQQNLGTMRPASADPAAVALAKALGQWPKPAVSGRLSPKKVFD
FT                   TAPAATVEALARELGLRLGDQNELTIRRIKRGKGYSFVRPNGAHIRDARTIRRLHAMAV
FT                   PPAYREVRYSADPSTHLQAVGRDAAGRLQYRYHADWEKVREHRKAHRLEKLVGALPKIR
FT                   RKVSAFLSGDEPTREFALSAVIELIARTAIRPGNESYARLNGTRGATTLLKSNVTLEDD
FT                   CFVLTFKAKGGKAVRKECDAAKLVRAIGILRGVPGKRMFQYRDAYGIVRAVNTTQVNAF
FT                   LREIAGIKISLKDFRTLMASAVVVESLSRITPATSQRGRKKQVLDAIRAAADKLSNTPA
FT                   ICRKSYVHDTIVTAFEDGILERFAATMKGQRSQARREQLLAQVVATAAV"
FT   CDS_pept        614137..616095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0573"
FT                   /product="acetyl-CoA synthetase"
FT                   /note="ORF_ID:blr0573"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45838"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45838"
FT                   /db_xref="GOA:Q89WV5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WV5"
FT                   /protein_id="BAC45838.1"
FT                   /translation="MEGNMSEKIYDVPAEWAKRAWVDQAKYKEMYARSISDPNGFWAEQ
FT                   AKRIDWMKAPTKIENVSFAPGNVSIKWFEDGVLNVAHNCIDRHLHKRANQTAIIWEGDD
FT                   PSQSRHITYKELHDEVCRMANILRTRNVKKGDRVTIYLPMIPEAAYAMLACARIGAIHS
FT                   VVFAGFSPDSLAQRINDCQSKVIITADEGLRGGKKVPLKANVDAALAKADGVDWVVVVK
FT                   RTGGKIDMNPTRDLWYHEAAAMVTTECPVEHMHAEDPLFILYTSGSTGQPKGVLHTSAG
FT                   YLVYAAMTHQYVFDYHDGDIYWCTADVGWVTGHSYILYGPLANGATTLMFEGVPNYPDN
FT                   SRFWNVIDKHKVNTFYTAPTAIRALMQGGDEPVKKTSRASLRLLGSVGEPINPEAWEWY
FT                   HRVVGEDRCPIVDTWWQTETGGILITPLPGATKLKPGSATQPFFGVVPEIVDADGKVLE
FT                   GETTGNLCLTRAWPGMMRTVYGDHARFEQTYFSTYKGKYFTGDGCRRDADGYYWITGRV
FT                   DDVINVSGHRMGTAEVESALVAHEKVSEAAVVGFPHDIKGQGIYAYVTLMAGVQPTEDL
FT                   RKELVTWVRKEIGPIASPDQIQFAPGLPKTRSGKIMRRILRKIAEDEPGSLGDTSTLAD
FT                   PAVVDDLVKNRQNKKSA"
FT   CDS_pept        616528..617043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0574"
FT                   /note="ORF_ID:blr0574"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45839"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45839"
FT                   /db_xref="GOA:Q89WV4"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WV4"
FT                   /protein_id="BAC45839.1"
FT                   /translation="MAMRIAVALAATIGAGILMSTAAEARPEMVGTHLADYSPGTIVVK
FT                   TNERRLYLILDDGHAVRYPVGVGKSGKQWAGTTRIDGKYRNPAWSPPAEVKRDKPQLPD
FT                   VIPGGSPRNPMGVAAMTLAGGEYAIHGTNVPGSVGGFVSYGCIRMLNDDITDLYSRVSV
FT                   GTTVVVTR"
FT   CDS_pept        complement(617097..617681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0575"
FT                   /note="ORF_ID:bll0575"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45840"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45840"
FT                   /db_xref="GOA:Q89WV3"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WV3"
FT                   /protein_id="BAC45840.1"
FT                   /translation="MRFHDRPNAYRPQFGGSPFGRRFAGLLPWMFVVGVAAAIVLTFRH
FT                   GVPVPHGADGRSQDTEIILQQSGNSASRQPVDVIRTIDGDTFLARVHQQGGRDLVVRVR
FT                   LRGIDAPEMKASCQEELDKAEAATDALRNLLGQGGVTITNLGPDKYGRVLADVATKRAA
FT                   NVSAVLLAGGYARSYNGGHRDGWCARGWRFW"
FT   CDS_pept        617897..619945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0576"
FT                   /note="ORF_ID:blr0576"
FT                   /note="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45841"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45841"
FT                   /db_xref="GOA:Q89WV2"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WV2"
FT                   /protein_id="BAC45841.1"
FT                   /translation="MWGAVSMASFKVRIGTKLGLTASAGVLLVGGMLANQLIRNEQIAD
FT                   LSRLVVINTANKANAQGAELAVTRARLAIAEIGSASSADGLAKHLETLRGSIAGATTEI
FT                   DAALERSKRAEAKELCREVKILLDASLKAGNDLGEARGTAVAEFAAASQIEEAWNKALE
FT                   TLLASSAIAASQNRLNIEVALREADALFKAVSAADWHFTATGDAVQKDRIAERADAMIR
FT                   ALKQVRQSADDKKIADGVDALAALAGRYKAVTGVAIKAEEAKRSIFDERVLPAAKEITT
FT                   RVDKLVAANNEYMALRQSQLVTALEQATQVSLAVGVLVILVLAGSALFSVLSIARPIRR
FT                   IGDVLLQLAGGNKAVEIPYTARGDEVGDNARAARTFRDNLIRIEQMEADQKDQEAAAAA
FT                   QRKQEMIRLAGAFEDAVGGIINSVSVASQQLESAAGTLSGTAEETEQLSGMVAAASEEA
FT                   SANVGAVASAAEEMSASVVEIGRQVHDSSRIAGEAVKQAERTDVRINELLKAAGRIGDV
FT                   VKLITAIAEQTNLLALNATIEAARAGESGRGFAVVASEVKALAAQTARATDEIGAQIAD
FT                   MQTATEDSVGAIKEIGTTISRISDISTTIAATIEEQGAATAEIARNVSEAAKGTVEVAD
FT                   KIAQVSHGAGATGSASTQVLASARSLSTESGRLKHEVAKFLDTVRAA"
FT   CDS_pept        620087..621517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0577"
FT                   /note="ORF_ID:blr0577"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45842"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45842"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WV1"
FT                   /protein_id="BAC45842.1"
FT                   /translation="MIISIVGGGATGITILRHLAELVASGRDNGAISGIQLFDKSGFDG
FT                   GVAYRTQSDRHLLNMKASTMSIRPGDADEFLRWLRARGLSCHGNRHLPRMVYRDYLDAV
FT                   RLAAIAQCRGAGVPVHVEHAEIVRMRFSPDRDVLLTTDLNITHISSVLILCTGHNAPDD
FT                   HYGLAAIPNYIRDPYAQFAFADRDGVEVGILGSGLSAVDTAAALAKTHQSVRMTCFSRS
FT                   GLFPTVQPVTLPATADDFRDALHRYVASRERIEADAFAARLSGLLLETTGIRCDLSCRN
FT                   VGGDALADLEHNIGRAESGEPSVYSYLVSVIDVMCDAWSRMRDVEKMRFMDVYNSGWLR
FT                   NRSAMPLENAIRIRDLMRSGRLSARARLRNVTGIGGRFRAILGDGDRHDVDYVIDATGP
FT                   SYRLDSSPLYQDMQRQGLIAFDALGGIRCGYDDSRVHDRHGTAHPNVYAVGGPTKGTHF
FT                   YAAAVDINLRRAQEHHYL"
FT   CDS_pept        complement(621566..621775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0578"
FT                   /note="ORF_ID:bsl0578"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45843"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45843"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WV0"
FT                   /protein_id="BAC45843.1"
FT                   /translation="MSDQPPVSDRKPLSPAAQRALAEAEARRQAAAIQAEDDAKATPKE
FT                   LQGPKGPEPTRYGDWERKGIASDF"
FT   CDS_pept        621965..623311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /product="SUN protein"
FT                   /note="ORF_ID:blr0579"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45844"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45844"
FT                   /db_xref="GOA:Q89WU9"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WU9"
FT                   /protein_id="BAC45844.1"
FT                   /translation="MPSQRFAPPSEVPGLAARRIAADIVDGVLHKHRTLDDQLDGSGAH
FT                   PGLKTLADRDRALMRRLVATVLRRLGTLGHVLSRLLDKGIPSEAPRAQSALLIGAAQIL
FT                   WMDVPDHAAVDLSVRLVQSDRRAARYAGLVNAVLRRCAREGQALVEEVATQSLDLPPWL
FT                   LARWRAHYGEATARDMALALGHEPSLDLTVKSDAEQWASRLHGETLPTGTVRMLLHGSV
FT                   TMLPGFAEGQWWVQDAAAALPARLFGDIKGKSIADLCAAPGGKTAQLAHAGAHVTAIDR
FT                   SPARVARLRENLARLSLQAETVVADAAEWAGPAEGFDGILIDAPCTSTGTIRRHPDVAW
FT                   LRQESDIAALTALQQRLLRKSVSLLKPGGTLVYCTCSLEPEEGEQAIATLLAAEPALRR
FT                   VPIEASEVSGLSEIITAEGDLRTLPSHLPNADPKLGGLDGFFAARLVKS"
FT   CDS_pept        623432..625189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0580"
FT                   /note="ORF_ID:blr0580"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45845"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45845"
FT                   /db_xref="GOA:Q89WU8"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WU8"
FT                   /protein_id="BAC45845.1"
FT                   /translation="MSVAQRRRISTLVMNRFARNMLARASGGSVALSRVWPGRTDRLII
FT                   APHDLRTADATRAAEIYAGRFVFAGKIVNCHGRSIFDLEPPSEDWEVALLGFGWLRHLR
FT                   AADTALTRANARALVEDWIANPANKRRPVARRADVLARRVISLLSQAPLVLNDTDNKFY
FT                   RRYLRALAREIRFLRYTMVNIPDGVPKLQVLIALCYTTLCLANQARHIRSASKKLSDEL
FT                   QRQILPDGGHISRNPGALIELLIDLLPLRQTFAARNIAPPPALLNAIDRMMPMLRFFRH
FT                   GDGNFALFNGMSATPSDLLATLLAYDDTHGAPMANMPHTGFQRLDAGQTTLIIDTGPPP
FT                   PAGVSHDAHAGCLSFELSSGISRIVTNCGMPTTGRDNWRPFARSTAAHSTLTYHDTSSC
FT                   QFVEMSAMKRLLHGSPVTSGPVEVESYREVVQNGTLLTTSHDGYLAKFGAIHRRVLMIA
FT                   NDGARIDGEDTLSPPQGGRFKGADADFAVRFHLHPAVKASRLSDARGVMLVLPNRDVWT
FT                   FEALDDKVDLEDSVFLAGNDGPRRTAQIVIRQDARQAPSLRWSFVRSTASPAVTNARRN
FT                   ARREPELPL"
FT   CDS_pept        625357..626949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /product="bifunctional purine biosynthesis protein"
FT                   /note="ORF_ID:blr0581"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45846"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45846"
FT                   /db_xref="GOA:Q89WU7"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WU7"
FT                   /protein_id="BAC45846.1"
FT                   /translation="MTDHPRRVTRALLSVSDKTGLIEFAKALAAHDVELVSTGGTAKAI
FT                   AAAGLKVKDVSELTGFPEMMDGRVKTLHPKVHGGLLAIRDNKDHADAMKAHGIAPIDLL
FT                   VVNLYPFEATVDKGAGFEDCIENIDIGGPAMIRAAAKNHDDVAVVVEAEDYKAVLDELA
FT                   ANKGATTLKLRRRLAAKAYARTAAYDAAISNWFNRQLEIDAPDFRAFGGKLIQSLRYGE
FT                   NPHQTAAFYATPDKRPGVSTARQLQGKELSYNNINDTDAAYECIGEFDAKRTAACVIVK
FT                   HANPCGVAEGSDLVSAYRKALACDSTSAFGGIIAMNRALDADTAREITKIFTEVIIAPD
FT                   ASEEAIAIIGARKNLRLLLAGSLPDPRAPGLTAKTVAGGLLVQSRDNAVVDDMTFKVVT
FT                   KRAPTDAEMRDLKFAFRVAKHVKSNTIIYAKDLATVGIGAGQMSRVDSARIAARKAQDA
FT                   AVELKLAEPLTKGSVVASDAFFPFADGMLACIEAGATAVVQPGGSMRDDEVIKAADEHG
FT                   IAMVFTGTRHFRH"
FT   CDS_pept        complement(627078..628463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0582"
FT                   /note="ORF_ID:bll0582"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45847"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45847"
FT                   /db_xref="GOA:Q89WU6"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WU6"
FT                   /protein_id="BAC45847.1"
FT                   /translation="MTTIASDARMAGVLRTYPPRAAVISWIFFDWAAQPYFTLITTFVF
FT                   APYFATSIAPDAATGQSLWGFAMAAAGLAIALMSPVLGAIADASGRRKPWIAGFGTLLV
FT                   LASCSLWIGKPGDPSVIPPLLTAVALASVGAEFATLFNNAMMPTLVPPERIGRLSGTGW
FT                   ATGYIGGIVSLIIVLGLLAANPETGRTLLGFTPLFGLDPASHQGDRAAGPLTGVWFIIF
FT                   VTPMFLFTPDYPAKRPVREALRKGLSELKQSIRSLPQQKSLAAFLLANMIYTDGLVSLF
FT                   AFGGIYAAGTFGWHTIQIGTFGIMLAIAGAFGAWLGGKLDDHLGPKRVIAGSMLILLLS
FT                   VAAILLVDKDSVLFVKVAAPQPGAPLFSSAAERAYLVLGCLIGAAGGPLQAASRTLLIR
FT                   LAPKDRIAQYFGLFALTGKVTSFIGPLLIGMITAVTASQKAGMAVLVVFFVAGLGLLMR
FT                   VRE"
FT   CDS_pept        628562..630313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /note="ORF_ID:blr0583"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45848"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45848"
FT                   /db_xref="GOA:Q89WU5"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WU5"
FT                   /protein_id="BAC45848.1"
FT                   /translation="MMSSFSTRRTFFAFLATLALGLASATAQDARRGYVPPALDTVHAV
FT                   AAEHGMVVAQEKISVQVGADILRRGGNAVDAAVATGFAMAVTYPRAGNIGGGGFMMIHS
FT                   AERNEDIAIDYRETAPAATTPQIFLGPDGKPDIAKSRDSALGIGVPGTVAGLALALEKY
FT                   GSGQFTLAQLLEPAIALARDGFVVSDDIADTLPGWHRRLTRWPSAARIFSRPDGAPLSD
FT                   GDRLVQGDLADTLAAVAAQGPRGFYEGAVADKLAKAVSEAGGIMTPADLKTYQAVIRTP
FT                   VRGTYRGYDIVSMPLPSSGGVVLVETLNILEGFQLADLKQGSPASLHLLIEAMKRAYAD
FT                   RARYLGDPAFVNAPIETLTAKDYAAKLRAGISTSRATPSKQLVSAAASPREGSNTTHFS
FT                   VVDSRGNAVSNTYTLNFSYGVGLVAEGTGVLLNNELDDFTAAVGASNAYGLVGFEANLP
FT                   GPGKRPLSSMSPTIVLKDGKPVLVTGSPGGSRIISTVLQVIVNVLDYKMDVAAAVATPR
FT                   LHHQWLPDEVRVERGFPDDVLFELKAMDHPIVEPMGQTSANSIAVTPNGPLGAPDPRTR
FT                   GAEAAGQ"
FT   CDS_pept        630412..631707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0584"
FT                   /note="ORF_ID:blr0584"
FT                   /note="probable 4-methylmuconolactone transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45849"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45849"
FT                   /db_xref="GOA:Q89WU4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WU4"
FT                   /protein_id="BAC45849.1"
FT                   /translation="MTTADPNQRIERAEIEDTSLLAFYRDMNAPERRTFWACAAGWALD
FT                   GMDFMIYPLVIGTIIALWKVDAASAGLAGTVTLLASAIGGWLGGHLSDHIGRVRTLQIT
FT                   IIWFSFFSLVCAVVQNFDQLLIARAVLGLGFGGEWAAGAVLMGEAIRPQYRGRAVGSVQ
FT                   SGWAVGWGLAVLSQAILFSLLPAETAWRWMFVIGALPALLVFYIRRSVTEPEIAAEARA
FT                   RHAETGSHPKLWEIFTFPMVKTTILASLMATGCQGGYYAVTFWVPQFLTKERHLSIVGS
FT                   TGYLSTLIIGSFIGYLTGAWLADRIGRRNLFLIFSLGAMAVVLLYTQLPLTNEILWVLG
FT                   FPLGFFASGYFSGIGAFLTELYPTRLRGSGQGFCYNFGRGIGALFPFLVGALSATTSLA
FT                   NAIAMFAVVAYALFFIAAFALPETRGRVLHAD"
FT   CDS_pept        complement(631804..632469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0585"
FT                   /product="glutathione S-transferase family protein"
FT                   /note="ORF_ID:bll0585"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45850"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45850"
FT                   /db_xref="GOA:Q89WU3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WU3"
FT                   /protein_id="BAC45850.1"
FT                   /translation="MLTVHHLNNSRSQRVLWLLEELGVPYEIARYQRQPDMRAPKELRA
FT                   IHPLGKSPVITDNGNTIAESGAIIEYLIATYGNGRLIPPPNTPERLRFTYWLHYAEGSA
FT                   MQPLLLKLLFTLMPKRAPALLRPLVRKVSNQALTALVNPQLKQHMDYWEGELAKSEWFA
FT                   GNEFTAADIQMSFPLEAAQARGGLEQGHPRAMAFLERIHARPAYARALEKGGPYQVGR"
FT   CDS_pept        632619..633215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0586"
FT                   /note="ORF_ID:blr0586"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45851"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45851"
FT                   /db_xref="InterPro:IPR018715"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WU2"
FT                   /protein_id="BAC45851.1"
FT                   /translation="MAMISMQRTFTAFQGQRRLASGSAGEVALVVKRIVPPPDEPIIIF
FT                   EDATGRSIDFDLRGGDREVLARVAKLVPPPVEETAPPSEPRGRGRPKLGVVAREVTLLP
FT                   RHWEWLNAQPGGASVALRKLVDEARRASGDKDRERQARDAAYHFMSTMAGNLPQFEEAS
FT                   RALFADDRRRFTGLIADWPTDIRDHIVKLAYSDRA"
FT   CDS_pept        633291..634655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0587"
FT                   /note="ORF_ID:blr0587"
FT                   /note="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45852"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45852"
FT                   /db_xref="GOA:Q89WU1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WU1"
FT                   /protein_id="BAC45852.1"
FT                   /translation="MKGKSMSAATPLWTTFLRFLAPLMLSNALQSLFGTVSNVYLGQMI
FT                   GVDALAAVSAFFPVMFFLFAFVMGLSTGATVLIGHAFGAGEHGRIKIVVGTTLAVGLLL
FT                   SISIALVGGLFSRPLMMALATPADILDQASAYARVMLLTMPLGFVFLLMTAMIRGVGDG
FT                   LTPLLALALSTAIGLILTPMLIRGAFGLPAAGITSPAWAAAIANIATLIVLALYLLRKK
FT                   HALAPDAALLRHLRLNGAVLGKVLGIGLPSAIGMVVMAIAELVLLGLVNGFGSDATAAY
FT                   GAVNQVMGYTQFTAMSISITVSILGAQAVGGGDRDRLDGIVRTGLAFNLVLTGGLVALI
FT                   YLAPRAVLGIFITDCAVLDLAKELLTIALWSSVPFGLATVFSGAMRAAGVALTPMLLSI
FT                   FAILAIELPAAVILSRTIGLKGVWAAYPIVFCAMFVLQMGYYLLVWRKRTIRRLI"
FT   CDS_pept        634692..635372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0588"
FT                   /note="ORF_ID:blr0588"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45853"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45853"
FT                   /db_xref="GOA:Q89WU0"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WU0"
FT                   /protein_id="BAC45853.1"
FT                   /translation="MDLWRALRQNGRKARSKVRSGRTILTRTAPQFLFDFGSPNAYLSH
FT                   LAIPAIEQRIGVKFEYVPILLGGIFKSTNNKSPAETLAGVKNKREFQAVETERFIKRFK
FT                   VQPYVWNPHFPVNTLNLMRAAIAAQLEGVFEKYVEAAFHHMWREPKKMDDPEIAAKALA
FT                   SSGLDAQKLFARAQEPEVKGKLIKNTEEAVARGAFGSPTFFVGNEMFFGKEQLREVEEM
FT                   VSGK"
FT   CDS_pept        635492..636415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0589"
FT                   /note="ORF_ID:blr0589"
FT                   /note="probable 2-dehydropantoate 2-reductase (EC
FT                   1.1.1.169)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45854"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45854"
FT                   /db_xref="GOA:Q89WT9"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WT9"
FT                   /protein_id="BAC45854.1"
FT                   /translation="MRILVVGAGAIGGYFGGRLLQAGRDVTFLVRPRRAGELASAGLVI
FT                   KSPNGDVTLKAPPTVEADKLKDKFDVVLLSCKAFDLDDAIKSFAAAVGPDTAIIPMLNG
FT                   MKHLDTLDARFGKERVLGGLCAIAATLSEKREVVQLQPMQAISYGERDGKLSDRVRAID
FT                   EAFKSGIVGATASQNIMQDMWEKWVFLSSLAASTSLMRASVGNILAAPGGRDFLLGILD
FT                   ETSEIATASGYPPGGPFFERVKGNLTTEGSPMTASMFRDIKAGLPVEADHVVGDLIARG
FT                   DAAKVPLPKLRIAYTHLKAYEKQRAG"
FT   CDS_pept        complement(636605..637198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0590"
FT                   /note="ORF_ID:bll0590"
FT                   /note="putative cytochrome C4 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45855"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45855"
FT                   /db_xref="GOA:Q89WT8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WT8"
FT                   /protein_id="BAC45855.1"
FT                   /translation="MRRQFISHAISAIALVTLGFCPADAADTAAGKAKAEVCAGCHGEN
FT                   GISQTENIPSLAGQPDQFLQWQLVFFRAGSRKNDQMQPIVEEINNEDIRNLGAYFSQLA
FT                   PPKGPEDQDPDLSKKGTQVAAGRRCASCHTDTYAGTKAVARLAGQREEYLVKALHDYKA
FT                   GQRVGGGVAAMADVAYAMSEEEITAVAHYLAHLQ"
FT   CDS_pept        complement(637388..638680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0591"
FT                   /note="ORF_ID:bll0591"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45856"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45856"
FT                   /db_xref="GOA:Q89WT7"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WT7"
FT                   /protein_id="BAC45856.1"
FT                   /translation="MKFHQSVFQSVFQSVLALAAVALLAGTSAGNAQQQDKNKPLKKYE
FT                   SGTKEFWTHPPDDWFLGDETEAQKGLAPPSGPPTGASEAELAAMMKKIKLPAGFKIEVY
FT                   APGVLAARQMAWGDKGTLFVGSFGLGNVYAIKDNNGKKEVKTILKGLNMPTGLAFKDGA
FT                   LYVIAVDKLIRYDNAETNLDKLGDGKVVYDDMPSYAAHGWKYIAVDKEGWFYLPFGPPF
FT                   NVGVPPTSVSQIRRVDPKTGNAEIYALGVRNSVGGDVDPRTGKYWFTENARDWISDDLP
FT                   SDKLNMISKMGEHFGYPYCHQGDLPDPKFAMGHKCSEFTPPVLNLGAHVAPLGMKFYTG
FT                   DQFPAEYKNNILIAEHGSWNRHKYQGGRIMRVIVGPDGKNAKQEVFASGWIEGDQGYLG
FT                   RPNDIILAKDGSILVADDWAGAIYRISYSKK"
FT   CDS_pept        complement(638705..638980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsl0592"
FT                   /note="ORF_ID:bsl0592"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45857"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45857"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WT6"
FT                   /protein_id="BAC45857.1"
FT                   /translation="MHGVVFAFFVRLPLPLPENQPRAMSMPRCSEAVFVAAFAFGEIPP
FT                   QFLLSATAVHAARFSPLADVLTFLRLSPRQAPNFASRLAKQNNVQP"
FT   CDS_pept        complement(639062..640087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0593"
FT                   /note="ORF_ID:bll0593"
FT                   /note="putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45858"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45858"
FT                   /db_xref="GOA:Q89WT5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WT5"
FT                   /protein_id="BAC45858.1"
FT                   /translation="MVFHAAGGCIGSAMTILITGSAGHLGEALLRTLRGRGSAVRGVDL
FT                   KPSPFTDAVGSIVDPDFVRCQMDGVTAVIHTATLHKPHVATHGRQDFVDTNVTGTLNLL
FT                   EAAVAAGVRSFVFTSTTSAFGSQLRPEAGQAAVWVTEDLSPVPKNIYGTTKLMAESLCE
FT                   LFFRERGLPVVVLRTSRFFPEDDDDPSMRSAYALDNAQANELLYRRLDIADAVSAHLLA
FT                   VQRAPDLGFARYIVSATSPFEPHHLVALARDAAGVVRELYPDCAQLYAANGWRLFPQID
FT                   RVYVNDRARHELGWRPEFDFAHVLHSLRAGQDFRSTLAREIGSKGYHDAVFDDGPYPVA
FT                   S"
FT   tRNA            complement(640125..640199)
FT                   /product="trnG-GCC"
FT   CDS_pept        640456..641397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /product="thioredoxin"
FT                   /note="ORF_ID:blr0594"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45859"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45859"
FT                   /db_xref="GOA:Q89WT4"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WT4"
FT                   /protein_id="BAC45859.1"
FT                   /translation="MRRGNPVTIIDQGNGAAGPAAADLIKDTTTQTFVKDVIEESKRQP
FT                   VLIDFWAEWCGPCKQLTPVLEKAVKAAKGKVKLVKMNIDQHPAIPGQMGIQSIPAVIAF
FT                   VNGQPADGFMGAVPESQLNAFIEKLTKGVTAPGEPNIAEILQEAEAVLAEGDAAAAAQI
FT                   YAEVLSHDSTNIAALAGLAKCYTVSGAMEQAKQTLAMVPESKRNDPAVKAVQTAIDLAE
FT                   QAEQLGPVAELEQKVAANPLDHQARFDLATALNAQGNRAAATEQLLAIIKRDRKWNDDG
FT                   ARKQLVQFFEAWGGTDDATVEGRKRLSTILFS"
FT   CDS_pept        641513..642190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0595"
FT                   /note="ORF_ID:blr0595"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45860"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45860"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WT3"
FT                   /protein_id="BAC45860.1"
FT                   /translation="MPINIEYRGPADLPEIIPVFPLPGALLLPRGQMPLNIFEPRYLAM
FT                   VDDSFRDGHRLIGMIQPDVAHSPKNSDKPALFRVGCVGRITQLAESGDGRYILELTGVS
FT                   RFKVVEELEVLTAYRQCKVDFFTYVDDFTARMGEDEVDREALLAVLADFLKANNLKVDW
FT                   EGVESAPNEALVNALAMMSPYGPAEKQAMLEAPDLKTRAEILIAVTEMDLAKKRTSGDP
FT                   PLQ"
FT   CDS_pept        complement(642203..644704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0596"
FT                   /note="ORF_ID:bll0596"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45861"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45861"
FT                   /db_xref="GOA:Q89WT2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WT2"
FT                   /protein_id="BAC45861.1"
FT                   /translation="MFRVFSCLTAEHDWRLVLLAGLVCFVASIVAVSIFHRAVASRAWA
FT                   RLIWVAIAGAAIGYGIWATHFVAMLAYEPGVPTNYGLVLTVLSLAAAMILTSGGFGVAV
FT                   NNSGQWRAAAGGGIIGAGIASMHYIGMWALEVPGRVTWSPGLVLISIGLGMVLGYAALA
FT                   VALGHKDKWGTFAAALLLTLAIVSHHFTAMGAVQIVPDPTLASDTLSLSPTFLAVAIAG
FT                   VALSVLGMSFVGVLADRRLATRTSRFEQIISELSLARQQVEDSQQEIQEQKLRLDTAIN
FT                   NMVEALCMFDAEKRLVVCNERYARLYQLPPELLRTGTPHADIIRHRVVTGILKSDTSEG
FT                   AAEQFLSKLAALPFDAVSSRIDEFTDGRLICVTRQPMAGGGWVATHLDVTEQRRSEAKI
FT                   AHMAQHDALTDLPNRVLLRERMEHAIAVTRNGGLDLAVLMLDLDRFKEVNDTLGHPTGD
FT                   SLLRAVATRLRECTTETALIARLGGDEFAVIDYVTNPAVEAAALAENIRKALCEPFDLG
FT                   DHRVTVGTSIGIAIAPRDGNDSDVIMKSADLALYSAKSGGRGAFRFFEPELDELMHARR
FT                   NLERDMRDAIVGRQFELHYQPFVSPATGKVNGFEALLRWHHPQQGLVMPSEFIPLAEET
FT                   GLIVPLGEWVLRAACAEAAKWPPHVRIAVNLSPAQFRSKELVPVVIGALASSGVAPHRL
FT                   ELEVTETVIMHDSEAVFAVLGQLRELGVRIALDDFGTGYSSLSFLQKFPFDKIKIDRSF
FT                   VNELSSARAEARHLARAVVRFAVSLGKTTTAEGVETKEQLDILCEEGCLETQGYYFSRP
FT                   MPASDIARMLRRGAGAAVRAA"
FT   CDS_pept        complement(644886..645464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0597"
FT                   /note="ORF_ID:bll0597"
FT                   /note="similar to nickel-dependent hydrogenase, cytochrome
FT                   B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45862"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45862"
FT                   /db_xref="GOA:Q89WT1"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WT1"
FT                   /protein_id="BAC45862.1"
FT                   /translation="MPEARGASDRSPADRTAPRTIAVWDLPLRLWHWALAICVLAAWFT
FT                   PTVFDRLHRIVGYTVLGLLAFRLVWGFWGSRYSRFRMVGVRLRAAPGYLWNLRRGMTGR
FT                   YIGLNPAGTLMLVALLASLAVSTITGAMSVTVTFFGVWWVEDAHHYSSDAVIVLVVLHV
FT                   VGVVLMGILQRENLIRAMITGRKRIGTHL"
FT   CDS_pept        complement(645542..645889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0598"
FT                   /note="ORF_ID:bll0598"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45863"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45863"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WT0"
FT                   /protein_id="BAC45863.1"
FT                   /translation="MLCFLPSRFAASRAALTTKEETFVKVIRVVAMVLTIGIGTGSAAM
FT                   ADGFKNCTKLDKASWKPASEAEAKAKALGYEVRRSKVEGSCYEVYGVKEGKLYELFYSP
FT                   EDLSLKHTIAK"
FT   CDS_pept        complement(646040..646858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0599"
FT                   /note="ORF_ID:bll0599"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45864"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45864"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WS9"
FT                   /protein_id="BAC45864.1"
FT                   /translation="MALTLVTGGTGHLGRDIVDRLVRSGRHVRVLARSPGTRPDVEWAI
FT                   GDLATGAGLRDALHDVDTVINAATYSPIARRGGIRPTDFFTSPSAVDVEGTARLLSSCG
FT                   EARVRHFLHVSIVGLDEATLPYARVKLAGERLVRASALSWSVVRAMPFYYLLDRLLSGL
FT                   AWLPVWPVPTTLFNPVDTSDVADHVVACAFDGTRGERAEIGGPEDIELVSLARRYQDAR
FT                   GLHRKILPMNLSDAKARGMGFVVSQGVRGRLSWADWLQRNYPAARSAIQG"
FT   CDS_pept        complement(646921..647271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0600"
FT                   /note="ORF_ID:bll0600"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45865"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45865"
FT                   /db_xref="GOA:Q89WS8"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WS8"
FT                   /protein_id="BAC45865.1"
FT                   /translation="MRDLLLQCAGVLTIVVALIHGILGETKVFAHASIEPERLRTLIRL
FT                   VWQASTVAWIGGGVLLIAAPWMDSAPARHWIVITMACVFGFSAFANAWATRGRHFGWMA
FT                   LSAVVAMTVAGY"
FT   CDS_pept        647339..647896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0602"
FT                   /product="transcriptional regulatory protein"
FT                   /note="ORF_ID:blr0602"
FT                   /note="TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45866"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45866"
FT                   /db_xref="GOA:Q89WS7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WS7"
FT                   /protein_id="BAC45866.1"
FT                   /translation="MVKFREPGMTEQLSADDWIKQGLKALAKSGFTALKADPLAKAIGV
FT                   SRGSFYWHFADLGAFHAAVLKRWREIAAEQIIADVEAAGDEPLKALLRRSFGARLDLER
FT                   AVRNWAAFDAAAQAAVRAIDRRRLDYIEQLLDKRGLDPATAQARAQILYWTFLGFALSG
FT                   PPVPVARLQGLLDDLLRMISAE"
FT   CDS_pept        647971..648168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0601"
FT                   /note="ORF_ID:bsr0601"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45867"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45867"
FT                   /db_xref="GOA:Q89WS6"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="InterPro:IPR038053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WS6"
FT                   /protein_id="BAC45867.1"
FT                   /translation="MNAPTERPETSVDPKLLEILVCPLTKGPLEFDSAKQELISRSAKL
FT                   AYPIRDGIPIMLPEEARKID"
FT   CDS_pept        complement(648383..649603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0603"
FT                   /note="ORF_ID:bll0603"
FT                   /note="putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45868"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45868"
FT                   /db_xref="GOA:Q89WS5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WS5"
FT                   /protein_id="BAC45868.1"
FT                   /translation="MSVQGSIVIGGGAFAGLALALALRQGLGPEIPVIVADPALSTRPS
FT                   RDPRATAIVAACRRLFEAIGAWDDVRGEAQPILDMVVTDSKLEDATRPVFLNFAGDVAP
FT                   GEPFAHMVENRRLIDALVVRAEAEGIDLRATTVASYDARSDGIDVTLGDGSVIAASLLV
FT                   AADGARSKLRERAGIATNGWEYDQSGIVVTVGHERDHEGRAEEHFLPAGPFAILPLSGK
FT                   RSSLVWTERRAEAARIIALSDEEFHGELEQRFGLHLGEVKALDKPRAFPLSYFVARSFI
FT                   AERLALVGDSAHVIHPIAGQGLNMGLKDVAALAEVVVDAARLGMDLGAADVLERYQRWR
FT                   RFDTMAMGVATNSLNFLFSNQSTLLRTVRDIGLGLVDRAPPLKNLFIRQAAGLTGEVPR
FT                   LLKGEAL"
FT   CDS_pept        649781..650680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /product="acyl-CoA thioesterase II"
FT                   /note="ORF_ID:blr0604"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45869"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45869"
FT                   /db_xref="GOA:Q89WS4"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WS4"
FT                   /protein_id="BAC45869.1"
FT                   /translation="MPRNDEIFESTIMSKSLIDLISILDLEQLEVNLFRGNSPKTSWQR
FT                   VFGGQVIGQAMVAACRTVEGRLPHSLHCYFILPGDPQIPIIYQVERLRDGKSYSTRRVT
FT                   AIQHGNAIFSIMVSFHAEEESAFDHQDKMPDVPPPEKLTAEEVAKQPLFKEMPEFIRRY
FT                   YESDRPIELRPVELGRYFGQKIEDGRIHVWIRTAAKLPDDPALHMCALAYASDFSLLDA
FT                   IMARYGRTLFDKRMMPASLDHAMWFHRPFRADEWLLYAQDSPSARSGRGLTRGSIFKPD
FT                   GTLVASVAQEGSVRERRA"
FT   CDS_pept        complement(650684..651562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0605"
FT                   /note="ORF_ID:bll0605"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45870"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45870"
FT                   /db_xref="GOA:Q89WS3"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WS3"
FT                   /protein_id="BAC45870.1"
FT                   /translation="MASWFYASEGKQQGPFPEGQFRDLIAQGVVRPDTLVWTEGMAGWQ
FT                   KAAEIPGLVGGGAPPMIPAGGPPTMGGRGNGGAAGGSLSVDFGILEFTWRSIVMLIGMC
FT                   FVIPAPWVFVWYTKWIVPCVKVPGRPNLSFTGNAMALVPWFFGFIVLAIAIGFIGSQLL
FT                   SNLLFLVQIVLYWLLIKWIVANLASNGQPLGISFTGSVWAYVGWNLLFAISIITIVGWA
FT                   WVAAAQMRWFCRSIEGTRREIVFKGSGLEILWRGIVAAILFSLIIPIPWVYRWIMNWFA
FT                   SQTELAPRGSL"
FT   CDS_pept        651801..652139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /product="nitrogen regulatory protein PII"
FT                   /note="ORF_ID:blr0606"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45871"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45871"
FT                   /db_xref="GOA:Q89WS2"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WS2"
FT                   /protein_id="BAC45871.1"
FT                   /translation="MKLVVAIIKPFKLDEVRQALTAIGVHGMTVTEVKGYGRQKGHTEI
FT                   YRGAEYVVNFLPKLRIEIAVASDVADKAVAVITATARTGQIGDGKIFVTPIDHALRIRT
FT                   GETDSDAL"
FT   CDS_pept        652211..653227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0607"
FT                   /note="ORF_ID:blr0607"
FT                   /note="similar to ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45872"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45872"
FT                   /db_xref="GOA:Q89WS1"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WS1"
FT                   /protein_id="BAC45872.1"
FT                   /translation="MAGLLRRAAVVAAPAGLMSIVAAPAQAAGSEINTADTAWMIVATA
FT                   LVLMMTIPGLALFYSGMVRKKNVLATMAQSLAAVTMISILWVAFGYSLCFVGDGPWIGT
FT                   LDRWFLAGMTLDSVNPAAKTIPESLFMLYQMTFAIITVALVAGSVADRMRFSAYLLFSV
FT                   AWFIFVYIPLAHWVWGGGFLASMGVLDFAGGLVVHLSAGTAGPRRRQGDGAPPRLRHRK
FT                   SLAVRSVARRDGHWPVVGRLVRLQRRFGRRGQFARGAGDHRDPSGGLLRRADLGRNRMV
FT                   NAAQAFRARHDLRRGRWPRHHHAGFGLRRAVAWHRHRHHRRGGLLLGLHLAEAPLRL"
FT   CDS_pept        652842..653513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0608"
FT                   /note="ORF_ID:blr0608"
FT                   /note="similar to ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45873"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45873"
FT                   /db_xref="GOA:Q89WS0"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WS0"
FT                   /protein_id="BAC45873.1"
FT                   /translation="MMGRRHGYGTENLSPFDLSLAVMGTGLLWVGWFGFNGGSAGAANS
FT                   RAVLAIIATHLAACSGALTWGAIEWSTRRKPSVLGMISGAVAGLGTITPASGFVAPWHG
FT                   IVIGIIAGAVCYWACTWLKHRFDYDDSLDVFGVHGIGGLTGTLLAGVFATSAIGGTAGL
FT                   LEGHPRQLLIQLYGVAVTFVWAAGVSFILLKLVGLFVPLRVSREHELEGLDISQHGEAL
FT                   Q"
FT   CDS_pept        653599..653913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0609"
FT                   /product="transcriptional regulatory protein"
FT                   /note="ArsR family"
FT                   /note="ORF_ID:blr0609"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45874"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45874"
FT                   /db_xref="GOA:Q89WR9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WR9"
FT                   /protein_id="BAC45874.1"
FT                   /translation="MIEADIFKALADPTRRRVFEKLAGGSLNASALRDGLEISQPAMSQ
FT                   HLAVLRAAGLVREQRQGRFVNYEVDPDGIVAIGAWLARYRAYWPKRMEALADLLKDMDQ
FT                   "
FT   CDS_pept        653942..654295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0610"
FT                   /note="ORF_ID:blr0610"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45875"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45875"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WR8"
FT                   /protein_id="BAC45875.1"
FT                   /translation="MSDAAKPDRPDEALVLEYDFDAPPAKVWRAVTIPALRERWSPDCD
FT                   LAGAEPESTIAGEEVRYRLRDSEPPFRESHVIFRIEPNEDGGTRFRIIQQACDDLAKLP
FT                   QPANTNCRLMMAA"
FT   CDS_pept        654336..654938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /product="ATP-dependent protease proteolytic subunit"
FT                   /note="ORF_ID:blr0611"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45876"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45876"
FT                   /db_xref="GOA:Q89WR7"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WR7"
FT                   /protein_id="BAC45876.1"
FT                   /translation="MRDMLQLVPMVVEQSARGERSFDIYSRLLRERIIFLNGEVNDAMS
FT                   GLVCAQLLFLEAENPNRPINLYINSYGGVVTSGLAMYDTMQFIKAPVHTLCMGTARSMG
FT                   SFLLMAGERGHRAALPNASLHVHQPLGGFQGQASDILIHANEMQETKRRITRLYAQHCG
FT                   RTEAEVERTLDRDHFMTAQQGVEWGLIDRVFAERDAT"
FT   CDS_pept        655323..655724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /product="nitrogen regulatory protein PII"
FT                   /note="ORF_ID:blr0612"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45877"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45877"
FT                   /db_xref="GOA:Q89WR6"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WR6"
FT                   /protein_id="BAC45877.1"
FT                   /translation="MANQSRNARPRPDRAQAGIGPMKIVMAIIKPFKLEEVRDALTAIG
FT                   VHGLTVTEVKGYGRQKGHTEIYRGAEYAVSFLPKIKIEVAVASDQVDKTIDAITSAAKT
FT                   GQIGDGKIFVINLDHAVRIRTGEADAAAL"
FT   CDS_pept        655678..657210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /product="ammonium transporter"
FT                   /note="ORF_ID:blr0613"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45878"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45878"
FT                   /db_xref="GOA:Q89WR5"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WR5"
FT                   /protein_id="BAC45878.1"
FT                   /translation="MRFVSAPARPMPRPFDFALNLIQSGVNNMTFKRPYGAGLAALAVG
FT                   LFAATAAYAEPTVNKGDNAWMLTSTVLVLLMTIPGLALFYGGLVRSKNMLSVLMQVFYT
FT                   VCVVTVIWAVYGYSLAFTGGSDFIGGFSKAFMMGVTTDSKAATFSVDANISELIYMCFQ
FT                   MTFAAITPALIVGAFAERMKFSAIALFIPLWVTLIYFPIAHMVWYWPGPDAIQDAAKAL
FT                   AAATDAAAKTAAQAKLDEINADAGWIFKKGAIDFAGGTVVHINAGIAGLVGALLIGKRT
FT                   GYGKELMAPHSLTMSMIGASLLWVGWFGFNAGSNLEANGGAALAMTNSFVATAAAALSW
FT                   MFAEWIVKGHPSVLGVISGAVAGLVAVTPAAGFSGVMGAIVLGLVVGVVCLFFCTVVKN
FT                   AIGYDDSLDVFGVHCIGGIVGALGTGILVNPALGGAGIIDYTAIPPKVADYDFAAQMVS
FT                   QFWGVCTTLVWSGIGSAILYKVVDVIVGLRANVESEREGLDITEHTERAYNM"
FT   CDS_pept        657425..657829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0614"
FT                   /note="ORF_ID:blr0614"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45879"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45879"
FT                   /db_xref="GOA:Q89WR4"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WR4"
FT                   /protein_id="BAC45879.1"
FT                   /translation="MRLEGGCYCGEVRYVAEGDPMMQAQCHCRECQYISGGAPNTFIAM
FT                   PVAGFSYIIGQPKQFTRKDLERAVTREFCPECGTHLVTKVPGLPAAILKVGTLDEPEQF
FT                   HPQMAIYTCDKQEFHAIPAGMTTFEKLPGH"
FT   CDS_pept        658123..659373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0615"
FT                   /note="ORF_ID:blr0615"
FT                   /note="putative aspartate aminotransferase (EC 2.6.1.1)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45880"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45880"
FT                   /db_xref="GOA:Q89WR3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WR3"
FT                   /protein_id="BAC45880.1"
FT                   /translation="MRPAVPRVLASRMAMTASSRAPQASGSSDSERSPFVRLNELLAPH
FT                   QPGKPLITLAVGEPQHPVPDFVGPVLAKHTADFGRYPMNQGTEPFRKAASAWLSSRFKL
FT                   PRPLDPASELLVLNGSREGLFLAAITAARYVSPRPGKPAILMPNPFYPVYGAGARAAAC
FT                   EPVYLPTTVENGFLPDLDAIDEATLARTVAFYLASPANPQGSVAKPDYFERLKQLADRY
FT                   GFVILSDECYSEIYTREAPGSALECAGPDFTRVVAFQSLSKRSNLPGLRVGFAAGDKKF
FT                   IGMFLELRNIAAPQVPVPLQHVATVAYGDEAHVEENRRLYRIKFDLADQIIGNRYGYRR
FT                   PDGGFCVWLNTSELGDDVSITLRLFKEAGVRVVPGSYLARLQPDGFNPGAGYIRLALVQ
FT                   DGETTAQALHRLVETLG"
FT   CDS_pept        659383..661860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /product="cell division protein"
FT                   /note="ORF_ID:blr0616"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45881"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45881"
FT                   /db_xref="GOA:Q89WR2"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WR2"
FT                   /protein_id="BAC45881.1"
FT                   /translation="MSMSAIERVIPLVGHLPPSIREGLARRMRELAGLGLIALSGLASA
FT                   ALMTWSVQDASLSHATSRPIRNILGYAGAIGADLAMQILGLGAIMLVLTVAVWGWRMMT
FT                   HRPFDREALRLGSWILCTVIAAGFVSCWPHGGAWPLPTGLGGVVGDALVRAPAVIFGPP
FT                   GMIYRTVLGVILFAAMAATFLIACGLGAREHDDELAEIEDDDKPLDEDEESDRGSVSLG
FT                   WLFHALMSTKARLIWLCGAAYRSLVSSGPKTRAVGFSRQEPNLGGGRAAPPISPRSEDE
FT                   DYEEEHEEEEDEEEEEEPAARAPRKKAAPKAAAKKSSDKFELPSVSVLAAPKAGDRQPL
FT                   SKAELEANSRALEGVLQDFGVRGEIVKANPGPVVTLYELEPAPGIKSSRVIGLADDIAR
FT                   SMSALSARVAVVPGRNAIGIELPNAHREKVYLRELLVAKETVDTVAKLPLCLGKTIGGD
FT                   PVIIDLARTPHMLIAGTTGSGKSVAINTMILSLVYRLRPDQCRLIMVDPKMLELSVYDG
FT                   IPHLLTPVVTDPKKAVVALKWAVREMEERYKNMAKLGVRNIDGYNTRLLELKAKGEEPT
FT                   RTVHTGFDKETGKAIYEEEKLSLDPLPYIVIIVDEMADLMMVAGKDIEGAVQRLAQMAR
FT                   AAGLHVILATQRPSVDVITGTIKANFPTRIAFQVTSKIDSRTILGEMGAEQLLGQGDML
FT                   YMAGGGRISRVHGPFASDDEVEKVVRHLKTQGQPEYLEAVTAEEPTEDEDGGAVFDASG
FT                   MGADGGGDLFQQAVAIVKRDRKASTSYIQRRLQIGYNRAASLMERMELEGIVGPANHAG
FT                   KREILVEEEDSHM"
FT   CDS_pept        662012..662767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0617"
FT                   /note="ORF_ID:blr0617"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45882"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45882"
FT                   /db_xref="GOA:Q89WR1"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WR1"
FT                   /protein_id="BAC45882.1"
FT                   /translation="MAGVLLVTAAMVTAASSAQNVPVPKPAPKGRDNGAAAGGPAVTGA
FT                   TQTPPNPVIPDPRRNVPSSIFQTFDANQKAQAAKVSAYLSSLSTLVGNFVQVGPDGSKT
FT                   QGDFYIQKPGKVRFEYDAPSPIDIVADGSSLVVRDRKLATQDVYPLSQTPLRFLLSDRI
FT                   DLMKDTNVVNVSADDVFVSVTIEEKQALVGTSRLLLMFGAKDGQLKQWTVTDPQGYDTT
FT                   IAVYNLDATKKLDPGMFKIDFTNYGPSPG"
FT   CDS_pept        662923..663738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0618"
FT                   /product="exodeoxyribonuclease III"
FT                   /note="ORF_ID:blr0618"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45883"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45883"
FT                   /db_xref="GOA:Q89WR0"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WR0"
FT                   /protein_id="BAC45883.1"
FT                   /translation="MRLSLTTWNINSVRLRIDLVAKFLKSARPDVLCLQETKCIDDAFP
FT                   LKRFKRLGYEHVALNGQKGYHGVAIVSRIPFESKDIRTFCDKVDSRHISVSFGTQANIA
FT                   KPLVLHNFYVPAGGDIPDPALNEKFDHKLRFLDEMTACEPLHPRGDDRHILVGDLNVAP
FT                   HENDVWSHKQLLKVVSHTPVETEKLKAALAAGEWVDVARERIPMSEKVYTWWSYRSADW
FT                   TVGDRGRRLDHIWVSRALKDAVQDFKILRDARSWERPSDHVPVTVTLEV"
FT   CDS_pept        complement(663855..664298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0619"
FT                   /note="ORF_ID:bll0619"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45884"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45884"
FT                   /db_xref="GOA:Q89WQ9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WQ9"
FT                   /protein_id="BAC45884.1"
FT                   /translation="MSIDDDVALLERVPTLRLLGDASLRMLAIGSEQRDFVRGDILFNL
FT                   GDDADAGFVVQRGAFRVEDGAGAEMTVGPGALIGELALVVPMKRPSSAIALEHSSVIRV
FT                   ARSLFQRVLESDPAAAVRLRDEFAVRSSQIASDILMAGAKLTT"
FT   CDS_pept        complement(664357..665043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0620"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:bll0620"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45885"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45885"
FT                   /db_xref="GOA:Q89WQ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WQ8"
FT                   /protein_id="BAC45885.1"
FT                   /translation="MANARKILIVDDDTDLRDTLVEQLSLHEEFEASAVDTGAKGASAA
FT                   KANSPDLVLMDVGLPDTDGREVVRSLRKGGFKAPIIMLTGHDTDSDTILGLESGANDYV
FT                   AKPFRFAVLLARIRAQLRQHEASEDAVFSVGPYSFRPGSKMLTAANARKVRLTEKETAI
FT                   LRFLYRAGQMPVSRETLLQEVWGYNSGVTTHTLETHIYRLRQKIEKDAANPEILVTEAG
FT                   GYKLVP"
FT   CDS_pept        665223..665816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0621"
FT                   /note="ORF_ID:blr0621"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45886"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45886"
FT                   /db_xref="GOA:Q89WQ7"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WQ7"
FT                   /protein_id="BAC45886.1"
FT                   /translation="MNATSHGHMKNNAASATYTKNRGAGPLSAIRVKPAAGNPRRGWLT
FT                   AGALTIPVALGRGGILANKREGDGGTPRGSFRPRRLWWRGDRHSRPQTFLPARIITGED
FT                   AWCEDPHDRHYNQGIRLGEGQGGDRLKRADHLYDFIIEIDHNTRPRIAGRGSAVFLHLA
FT                   RDNFGPTAGCVSMTKSAILQLLRRLGPRTRIIIG"
FT   CDS_pept        665823..666608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0622"
FT                   /note="ORF_ID:blr0622"
FT                   /note="putative hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45887"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45887"
FT                   /db_xref="GOA:Q89WQ6"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WQ6"
FT                   /protein_id="BAC45887.1"
FT                   /translation="MLEKDQIAAASRVLVQHWRDDTKLDALEGYLRPQTRAEGYAIQAA
FT                   LEAQSPGKLFGWKIAATSLSGQKHINVTGPLAGRIMSDTVIADGGTASMKGNAMRVGEP
FT                   EFCFRMGRDLAPRAASFAVDEVLGAVDSFHPAIEIPDSRFVDFAGAGEAQLIADNACAH
FT                   LFVLGAATPANWRGMDLVEERPQITLRGERYIGHGKNVLGDPRVALTWLANELRGLGIT
FT                   LRAGEVVTTGTCHPPLPIQAGDHFAVDFGVLGKVSVGFE"
FT   CDS_pept        complement(666752..667441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0623"
FT                   /note="ORF_ID:bll0623"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45888"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45888"
FT                   /db_xref="GOA:Q89WQ5"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WQ5"
FT                   /protein_id="BAC45888.1"
FT                   /translation="MTEANAAPVTGHSPNALAAVEAEIARACKDARRDRASVTLIAVSK
FT                   TFDADAITPVIAAGQRVFGENRVQEAKGKWPALTSVYPDIALHLIGPLQSNKAKEAVAL
FT                   FDAIHSVDRPSICQALAKEIESQKKHPQLFVQINTGEEPQKAGVAPGEADAFLASCRDT
FT                   YGLTISGLMCIPPVDEPPAAHFALTAKIAARNGLTNLSMGMSADFATAIMLGATHVRVG
FT                   SAIFGHR"
FT   CDS_pept        667532..669247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0624"
FT                   /note="ORF_ID:blr0624"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45889"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45889"
FT                   /db_xref="GOA:Q89WQ4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WQ4"
FT                   /protein_id="BAC45889.1"
FT                   /translation="MGWAAKMANVSFNRKRAKLKQVLGIRARLALLAVILVAPLMLERI
FT                   RSLENTRTSQIAQAAAEFNTVARHSADAQREVISSVETILKSEAFIRASAGGISKSCDV
FT                   LRASLPSNLPWIRTLLIAGQDGRIQCATNNMYVGLDLSDRPYFQQAQETGRFVLSDFIL
FT                   SRPVPSPTVMAVYPVSAFSGVADAVVLATVNLDWMSKVMSNLGGRAGITAVLVDSAGTV
FT                   LAAPADQHSAVGRPLDNMPLMSAIADKALRSDQDEGSLSFLAADGSRRAVSYIRIAGTN
FT                   ARLIASIDEDKVSAAVSRDIRTAYLQLAFVVLFVLLGALIAAEKLVIKPIEMLADMAKR
FT                   LGEGDLSARAARNRLPAEFVPLARAFNAMAAQLSQRERELIASNDRLTVMASIDMLSGL
FT                   ANRRGFQSRLDFEWMRAQQYGSDLALLMIDVDHFKLFNDTYGHLEGDSCLTRLGESLSG
FT                   IAADTMGFAARYGGEEFCLLLPNTDVDRAVEIGELVRAAVLRLCLPHITSAHMIVTVSI
FT                   GVAAAKPNEAFRPGDLIEAADAALYAAKHRGRNNVVEHGVQAIETGAADMMMAG"
FT   CDS_pept        complement(669263..669919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0625"
FT                   /note="ORF_ID:bll0625"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45890"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45890"
FT                   /db_xref="GOA:Q89WQ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WQ3"
FT                   /protein_id="BAC45890.1"
FT                   /translation="MNELLSRDVVLLFALCVTYIFWAVVPLVPAVMIYRLFPNAPVDTQ
FT                   WKILGVAVKAGGAAGFYFAILALGFFKFLEPTIEYVRGLQRPYWTVEALVQFVESDDSV
FT                   SRPYTTNSAEQIRIQPYAYDFKQTDDQTYLITMRFAELNSDTDSIRLIFPEGIGFIPLK
FT                   QMMSSDNTNNFLKRVSLTKGPPTKIHPPVKWGQNAPSVSDLSQKLERGLETISSR"
FT   CDS_pept        complement(669961..671331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0626"
FT                   /note="ORF_ID:bll0626"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45891"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45891"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WQ2"
FT                   /protein_id="BAC45891.1"
FT                   /translation="MWYGRRQGGPEVPICALRKHLRPWAWLAALLASGLCAAAADDVET
FT                   CKKIDPLISPDACTAAIKSGSLQGHDLAVLYLNRGFLASRANDFDKAIQDYGEAIKVDP
FT                   QYANAFSNRCAVYVRKREFNRAIEDCDNAINLNANYTSAYVSRGNAYRLKNLHSQAIID
FT                   YERAIALDKNSTAALFGAALSYSSIEHYGRAIEVYGQVLKLDSKSIQALNNRGLIYLRL
FT                   HDLDRAIKDFSAAIDLDPTFVYALNNRCSAYNSLKDADNALKDCDRAIELVPTYVNPYI
FT                   GRGRAHRLKNQTDLALNDYDRAIALDPKSASAFFGRAYVHDQREEYKQAADDYTKASQL
FT                   NPNDPETWNNLCWALGIIDQLKTALYACDRSLSLRPNSAVTSNSRGLVNLKSGNLAQAI
FT                   EDYDRALNMSPKDENSLYGRGISKLKLGDRAGGEEDINAAKAISSTVADDFKKLGIR"
FT   CDS_pept        671621..674245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="ORF_ID:blr0627"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45892"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45892"
FT                   /db_xref="GOA:Q89WQ1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WQ1"
FT                   /protein_id="BAC45892.1"
FT                   /translation="MTSERYNARDSEPRWQAAWDEKAIFVSKNDDSRPKYYVLEMFPYP
FT                   SGRIHIGHVRNYTLGDVLARFMRAKGFNVLHPMGWDAFGLPAENAAIERKVAPKAWTYD
FT                   NIAAMKKQLRSIGLSLDWSREIATCDPSYYKHQQKMFLDFLRAGLAEREKRKVNWDPVD
FT                   MTVLANEQVIDGKGWRSGAIVEQREMNQWVFKITKYSQELLSALDTLDRWPDKVRLMQR
FT                   NWIGRSEGLLVRFALDQATTPAGESELKIFTTRPDTLFGAKFMAISADHPLATAAAAKD
FT                   PKLAEFIAEIKKIGTAQEIIDTAEKQGFDTGIRAIHPFDPSWKLPVYVANFVLMEYGTG
FT                   AIFGCPAHDQRDLDFVNKYNLGNTPVVCPEGQDPKSFVITDTAYDGDGRMINSRFLDGM
FT                   TIEQAKDEVAKRLESELRGNAPVGERQVNFRLRDWGISRQRYWGCPIPVIHCPTCDVVP
FT                   VPDADLPVKLPDDATFDKPGNALDHHPTWKHVTCPQCGGKAQRETDTMDTFVDSSWYFA
FT                   RFTDPWNENAPTTPAVANRMLPIDQYIGGVEHAILHLLYSRFFTRAMKATGHVALDEPF
FT                   AGMFTQGMVVHETYQKADGSYVQPAEVKIELGGNGRRATLLTTGEDIQIGAIEKMSKSK
FT                   KNTVDPDDIIETYGADVARWFMLSDSPPDRDVIWSDERVQGASRFVQRLWRLVNDSVEL
FT                   GKAAPAARPASFGADATALRKAAHGALDKVTTEIERLHFNVCLAHIREFTNAFSEVLQR
FT                   PGQPAADLAWAIREASQILVQLFSPMMPHLAEECWQVLGQKGLVSEANWPQIERDLLVE
FT                   DSVTLVVQVNGKKRGEVTVATAAQNPEIEAAVLALDAVKLALDGKPVRKVIIVPKRIVN
FT                   VVG"
FT   CDS_pept        674232..674783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0628"
FT                   /note="ORF_ID:blr0628"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45893"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45893"
FT                   /db_xref="GOA:Q89WQ0"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WQ0"
FT                   /protein_id="BAC45893.1"
FT                   /translation="MLSARIRIAARLLAVVALAALTAGCFRPMYAEHTDGTPGLREKLM
FT                   GVELPPIPKPNASREARVGVEVRNALAFKLYGTATGMPPTHRLEIRFTSSRSSLIISQA
FT                   TGLPTSENYGIDAQYNLIEVASGKSVMTGTTFSRVSYDNPGSYQRFSRNRAVRDAEDRA
FT                   ANEIAENINTRLASFFTAGS"
FT   CDS_pept        674894..675922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0629"
FT                   /note="ORF_ID:blr0629"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45894"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45894"
FT                   /db_xref="GOA:Q89WP9"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WP9"
FT                   /protein_id="BAC45894.1"
FT                   /translation="MVALRGKEIDAFLARPDAGRPIVLLYGPDAGLVRERADALIASAV
FT                   DDPNDPFSLVRLDGDELSAEPSRLVDEAMTVPLFGGQRAIRVRAGSRSFASGIDTLAEM
FT                   GVKDCRIVIEAGELRPESPLRKACERAKTAVAIGCYPDTERDLAKLMDDELRIANLRIA
FT                   QDARAALMSFLGGDRQASRNELRKLTLYAHGKGEITLEDVMAVVADASELKLDPIVDGA
FT                   FAGRPDIVETEFAKAMIAGTYPGVIISAAQRQAAWLHKSALAIADGQPASAVLDGGFPR
FT                   LHFSRKPAVETALRNFSVARLAAIIEQLATAALDTRKQSTLAAAIAQRTLMAIAANAKR
FT                   RG"
FT   CDS_pept        complement(675971..676879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /product="chromosome partitioning protein B"
FT                   /note="ORF_ID:bll0630"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45895"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45895"
FT                   /db_xref="GOA:Q89WP8"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WP8"
FT                   /protein_id="BAC45895.1"
FT                   /translation="MNPRELAMADEARSRLGRGLASLIGDVGGEAQHVDRPRAQRKVPI
FT                   EFIKPNPRNPRRTFSETELKELSDSIRQHGVIQPIVVRPVKGAQDRYEIIAGERRWRAS
FT                   QMAGLHEVPIVPVDISDSDALEFAIIENVQREDLNPMEEAQGYHALANEFKRSQDDIAK
FT                   VVGKSRSHVANMMRLTKLPAEVQAFIATGQLTAGHARALIGVPDPLAAARRIVEEGLNV
FT                   RQAEALAHEEGVPERKPQKARSTGGKEKDPDTIDLEKRVSDALGLKVTVNHRDPGGSVQ
FT                   INYRNLDQLDEVMKRLAKGAL"
FT   CDS_pept        complement(676996..677850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /product="chromosome partitioning protein A"
FT                   /note="ORF_ID:bll0631"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45896"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45896"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WP7"
FT                   /protein_id="BAC45896.1"
FT                   /translation="MSVIDEPQQEQTDVVPQGHPRILALANQKGGVGKTTTAINLGTAL
FT                   AAIGERVLIVDLDPQGNASTGLGIDRRNRSCSTYDVLVGEAALREAVVSTAVPRLHIAP
FT                   STMDLSGLELELGTTPGRAFKLRDAIGALNNNVSPDADYTYVLIDCPPSLNLLTVNAMA
FT                   ASDAILVPLQCEFFALEGLSQLLQTVEQVRSTLNPNLSIHGIVLTMFDSRNNLSNQVVA
FT                   DVRQFMGEKVYKTMIPRNVRISEAPSYGKPVLVYDLKCVGSEAYLRLATEVIQRERELR
FT                   TTH"
FT   CDS_pept        complement(677880..678662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /note="ORF_ID:bll0632"
FT                   /note="probable Methyltransferase (EC 2.1.-.-)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45897"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45897"
FT                   /db_xref="GOA:Q89WP6"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WP6"
FT                   /protein_id="BAC45897.1"
FT                   /translation="MKQRGPAGGRSSSPKPSAPGSGAGEGPDGRSAPASQKINKASAND
FT                   RSLDSVIAADKIAALKLAPVSRETEARLDRYIALLREWQAKTNLVAPSTLPHLWTRHIA
FT                   DSLQLVDLAPTARRWADLGSGGGFPGVVLACTMAETPGASVHLVERIAKKAAFLREAIR
FT                   ITTSPGVVHLAEIGDNVDRITGPVDCVTARALAPLHQLIGFAEPLMRQGAKALFPKGQD
FT                   VEAELTEAAKYWNIQPQLHQSRTGDGWIVELNAAERRG"
FT   CDS_pept        complement(678672..680552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /product="glucose inhibited division protein A"
FT                   /note="ORF_ID:bll0633"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45898"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45898"
FT                   /db_xref="GOA:Q89WP5"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WP5"
FT                   /protein_id="BAC45898.1"
FT                   /translation="MRPERESFDVIVIGGGHAGCEAAAASARMGAATALVTHRFSTVGA
FT                   MSCNPAIGGLGKGHLVREVDALDGLMGRVGDAGGIQFRVLNRRKGPAVRGPRAQADRKL
FT                   YAAAMQAAIRETEGLSVIEGEADELIVVEGRVTGLRLADGREFGAGSIVVTTGTFLRGL
FT                   IHLGEKNWPAGRVGEAPAMGLSSSFERAGFTLGRLKTGTPPRLDGTTIDWSAVEMQPGD
FT                   EPPEPFSVMTDRITTPQIQCGITRTTAATHEVIRANVHRSPMYSGQIKSSGPRYCPSIE
FT                   DKIVRFGDRDGHQIFLEPEGLDDSTVYPNGISTSLPEEVQLAILASIPGLERVKMVRPG
FT                   YAIEYDHIDPRELDPTLQTKRLRGLFLAGQINGTTGYEEAAGQGIVAGLNAALAASGAA
FT                   LTVFDRADGYLGVMIDDLVTRGISEPYRMFTSRAEYRLTLRADNADQRLTEKGIALGCV
FT                   RSARTLHHRTKMEALNAARTLSKSLTITPNEAIKHGLSLNRDGQRRSAFELMAYPDIGW
FT                   SQVRAIWLELSAIDPVIATHLEIDAKYDVYLERQSADVEAFRRDEGLVLSEVDYQLVPG
FT                   LSNEVRAKLEKARPFTVGQAGRIDGMTPAALGILAAYLRREARKTSKAIA"
FT   CDS_pept        complement(681017..682375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thdF"
FT                   /product="tRNA modification GTPase"
FT                   /note="ORF_ID:bll0634"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45899"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45899"
FT                   /db_xref="GOA:Q89WP4"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WP4"
FT                   /protein_id="BAC45899.1"
FT                   /translation="MHPRDQTIFALSSGRPPSAIAVVRVSGAQAGLVLTTLAGKLPAPR
FT                   QASRRLLRDGTGQPIDDAVVLWFPGPASATGEDVAEFHAHGGRAVLAALLAAISVIPNM
FT                   RAAEPGEFTRRAFENGKLDLTEAEGLDDLIHADTDRQRRQALRQLQGLLGNRARDWRER
FT                   IIEASALIEAGIDFSDEGDVPAELRAPAVKAIKALHVEITEVLAAQGHSERLRDGMVVA
FT                   IAGEPNVGKSTLMNQLARRDVAIVSPHAGTTRDVIEVQLDLDGYPVTVIDTAGIRETDD
FT                   PVEQEGVRRARARAEDADLVLWLVEGEQAADPASMRSLWTSGDGSHPSGGSVWIVRNKI
FT                   DLGEFGDEGPQGEFGISASRGDGIRELVDALVKFSAEFFGTSEGALVTRARQRDLLRQA
FT                   SDSLRRSLELVGEGEELAAEELRSAAYALGRLLGRVDVEDVLGAIFQKFCIGK"
FT   CDS_pept        complement(682690..683955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /product="transcription termination factor"
FT                   /note="ORF_ID:bll0635"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45900"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45900"
FT                   /db_xref="GOA:Q89WP3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WP3"
FT                   /protein_id="BAC45900.1"
FT                   /translation="MREIKLQDLKSKTPAELVSFAEENGVENASTMRKQELLFAILKQL
FT                   SLAETDIVGEGVVEVLSDGFGFLRSPDANYLPGPDDIYVSPSQIRRFGLRTGDTIEGHI
FT                   RSPKEGERYFALLKVNTLNFEDPEKAKHKVNFDNLTPLFPNQRFRMEIDDPTRKDLSAR
FT                   VIDIVAPIGKGQRALIVAPPRTGKTVLMQNIAHSITHNHPECYLIVLLIDERPEEVTDM
FT                   QRSVKGEVVSSTFDEPAVRHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVV
FT                   PSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEFKG
FT                   TGNSELILDRKVSDKRTFPAIDISRSGTRKEELITDPQVLKKMYVLRRILNPMGTMDAI
FT                   DFLLDKLRSTKSNSEFFDSMNT"
FT   CDS_pept        complement(684206..684628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0636"
FT                   /note="ORF_ID:bll0636"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45901"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45901"
FT                   /db_xref="GOA:Q89WP2"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WP2"
FT                   /protein_id="BAC45901.1"
FT                   /translation="MYEWIKALHVIAVISWMAGMLYLPRLFVYHCEAEIGSKQSETFKV
FT                   MERRLLKAIINPAMIITWLAGLYLAWSGHWFASGWLHVKLALVLALSAVHGFFSRWLKD
FT                   FAADRRPRSQKFYRIINEVPTALMIFIVIMVIVKPF"
FT   CDS_pept        685148..685987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0637"
FT                   /note="ORF_ID:blr0637"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45902"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45902"
FT                   /db_xref="GOA:Q89WP1"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WP1"
FT                   /protein_id="BAC45902.1"
FT                   /translation="MPTSNNYFHLHLVSDSTGETLITVARAVAAQYANVTPVEHVYPLV
FT                   RSQKQLDRVLDEIEEAPGIVLFTLLEKDLVSRLEDKCKGINVPSLSIIGPVMQLFEAYL
FT                   GAATTGRVGAQHVLNAEYFKRIDALNYTMIHDDGQHVEGLDDADVVLVGVSRTSKTPTS
FT                   IYLANRGIRTANVPLVPGIPVPVQLETLTRPLVVSLHATPERLIQVRQNRLLSMGADSS
FT                   SDTYTDRQSVAEEVAFARKLSAKHDWPLLDVTRRSIEETAAAIMKLYSDRQRNRPSE"
FT   CDS_pept        685996..686604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0638"
FT                   /product="Maf-like protein"
FT                   /note="ORF_ID:blr0638"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45903"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45903"
FT                   /db_xref="GOA:Q89WP0"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WP0"
FT                   /protein_id="BAC45903.1"
FT                   /translation="MGLWRGKSPLILASQSSARKMLLANAGLEFIAITADIDERGIQAA
FT                   SKLSSPRDIGLLLAREKAKAVSANHPGSHVIGADQTLALGERLFNKPAGRAQAMAQLRD
FT                   LAGNYHELNSAVAVAHDGKIVFEDVSVARMTMRQMSEAELSAYLDAAGDAVTTSVGAYQ
FT                   LEGLGIHLFERIEGDHFTILGLPLLPLLAFLRSEQLIAV"
FT   CDS_pept        686628..687227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /product="dephospho-CoA kinase"
FT                   /note="ORF_ID:blr0639"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45904"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45904"
FT                   /db_xref="GOA:Q89WN9"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WN9"
FT                   /protein_id="BAC45904.1"
FT                   /translation="MRILGLTGSIGMGKSTTAKLFAEAGVPVYDADAAVHQLYEGEAAP
FT                   AIEAAFPGTTANGKVDRPKLSARVVHDPAAIKQLEQIVHPMLGASRQKFFADAEAANAP
FT                   VVVLDIPLLFETGGEKRVDAVVVVSTSPELQRERVLARGTMDEAKLNAIIAKQTPDAEK
FT                   RKRADFVVDTSHGLEPVRAQIAHILAEVVKMPQRRA"
FT   CDS_pept        687254..687973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /product="DNA polymerase III epsilon chain"
FT                   /note="ORF_ID:blr0640"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45905"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45905"
FT                   /db_xref="GOA:Q89WN8"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WN8"
FT                   /protein_id="BAC45905.1"
FT                   /translation="MREIVLDTETTGLDPLRGDRLVEIGCVEMFNRMPTGQTYHVYINP
FT                   ERDMPAEAFAVHGLSAEFLSTKPVFHEVADAFLEFIGDAPLVIHNASFDISFINAELDR
FT                   IKRAAIPREQLVDTLLLARRKHPGVSNRLDDLCSRYAIDNSRRTKHGALLDAELLAEVY
FT                   VDLVGARQSQLLLASEAEEIRINAAGDTPRRQRPTPLAPRISDAEREAHRAFIATLGDK
FT                   AIWNEFLPAPVTVNPAG"
FT   CDS_pept        complement(687982..688467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /product="protein-export protein"
FT                   /note="ORF_ID:bll0641"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45906"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45906"
FT                   /db_xref="GOA:Q89WN7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WN7"
FT                   /protein_id="BAC45906.1"
FT                   /translation="MTNGNGTPPEAAPAPQLNVLAQYTKDLSFENPNAPSSLQQQGQPP
FT                   QINIQINVGANNLSEQEFEVTLSVEGKAETAGKVMFSFELAYAGVFRIVNVPKENLHPL
FT                   VMIECPRLLFPFAREIIATAVRDGGFPPLMLDPVDFVGLYRQNMERQMAAGGQAGQA"
FT   CDS_pept        688883..689590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0642"
FT                   /note="ORF_ID:blr0642"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45907"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45907"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR039544"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WN6"
FT                   /protein_id="BAC45907.1"
FT                   /translation="MDIYTIIFLALAVFIFLRLRSVLGQRTGNERPPFDHTAARNALGG
FT                   AQDKNVVTMPGKVIDQAPLAPTVEPTPPSDRWKGLTEPGTALAQGLDAIVDKDSTFDPR
FT                   HFISGARGAYEMIVLAFANGDRRALRDLLSSEVYESFDAAIKEREKNEQKTETRFVSID
FT                   KAELVGAELRDRTAQLTIRFVSQMISATRDKAGNIVDGSADTVADITDIWTFARDITSR
FT                   DPNWKLVGTGSAN"
FT   CDS_pept        689637..691121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0643"
FT                   /note="ORF_ID:blr0643"
FT                   /note="putative lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45908"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45908"
FT                   /db_xref="GOA:Q89WN5"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WN5"
FT                   /protein_id="BAC45908.1"
FT                   /translation="MLSSFSLGAEAARRHYRSHHHHLPQLPATPPRALPYPQLPLPFEI
FT                   SGAQYLPLAWADVKGWSDDDHLAAYKTFRASCRSINAQTVAPEPKSEYKALGASLSEPC
FT                   RAAKSLELSDDAKAKTFFEENFAPLRISRLGEPDGFVTGYYEPVLEGSRTQTDVYNVPV
FT                   YRRPSNLFVRGYKQDSVSLPNKGPVYRKIGRRKLVPYYDRGEIEDGKIAGRGLEIAWLK
FT                   DPTDLLFAQIQGSARIKFDDGTTLRLNYDAYNGYPYTAVGRILIERGIIPKEEMSMQKI
FT                   REWMAQNPDGAKELRRQNRAYIFFREVNLSDKDEAVGAQGIPLTAGRSIAVDKSLHVYG
FT                   TPFFIEGELPIDSERSKTPFHRLMIAQDTGSAIIGPARADLYFGAGADAGRVSGRLRHP
FT                   MHFVMLVPKSLDPTPRAARLPVPDPRPSEKIAKLFPQTEPAKDQAKPAAPAAAVAPGKG
FT                   ETVAVASPVPLPVPRPVIEPVQELRRPAKNRPHRQQ"
FT   CDS_pept        691118..691708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0644"
FT                   /note="ORF_ID:blr0644"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45909"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45909"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WN4"
FT                   /protein_id="BAC45909.1"
FT                   /translation="MKRSSRPPVLEPRPSPRRRALSEDERELWDTVAKQVKPLRKHRAP
FT                   KAHPASRPEPSPAAPATRPAPSPRPIAAAPAPRAAKPSVPPLAPLGKRERTKLSRGRSE
FT                   IEARLDLHGMTQTRAHRALTGFLHRAHHDGLTFVLVITGKGRSGGESGVLRRQVPEWLS
FT                   LPEFRAFVVGFETAHIGHGGEGALYVRIRRARF"
FT   CDS_pept        complement(691853..692977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0645"
FT                   /note="ORF_ID:bll0645"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45910"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45910"
FT                   /db_xref="GOA:Q89WN3"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WN3"
FT                   /protein_id="BAC45910.1"
FT                   /translation="MTTRILQNPWRLLLAINAVVIVGVFVHKIQLPPYVPYIHLLVDYH
FT                   FGFIKRALIGAVVALFTTKVPVWLVFALGGVTWLVTLALFARLFQKTFGFAAKTLPLFV
FT                   FIAGSPFFLKNFMHTLGHFDIYGCALAIILLLMPAGSLLFVATAALFSIVLVLIHHIHL
FT                   LMYVPTIIAIVVIRHYLACGCNRSNVAFGVVALAVVSALFFAAQFLGTMPIPEADFVAY
FT                   LKTRMVDPSRTDLLQFSYIWYQPLAKEILDTWGRLPHNILGVPVFALLIWLHTPLWRYF
FT                   ADLISALASETHRRLVIAALIGVSLAYLVMFAMVFDYSRWISNWAVCMFLILHAVKMLP
FT                   AKQETPLIPAGDRNTDIFGLVITLIPRVGIVRPF"
FT   CDS_pept        complement(693203..694507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /product="heat shock chaperone"
FT                   /note="ORF_ID:bll0646"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45911"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45911"
FT                   /db_xref="GOA:Q89WN2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WN2"
FT                   /protein_id="BAC45911.1"
FT                   /translation="MTDFSPREIVSELDRFIVGQTDAKRAVSIALRNRWRRQQLEGSLR
FT                   EEVLPKNILMIGPTGVGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVEQIVRDLV
FT                   EVAIAQVRERKRKDVQARAQLAAEERVLDALVGANASSATRESFRKKLRAGELNDKEIE
FT                   IETQSSGGGMPMFEIPGMPGAQMGAISIGDIFGKLGGRSKTRRLTVESSHEILINEESD
FT                   KLLDTEQLTLEAISAVENNGIVFLDEIDKICARDGRVGGDVSREGVQRDLLPLIEGTTV
FT                   STKHGAVKTDHILFIASGAFHVAKPSDLLPELQGRLPIRVELQALTRDDMRRILTEPEA
FT                   SLIKQYVALMQTEGVTLDITDNAIDALADVAVAVNSTVENIGARRLQTVMERVLDEISF
FT                   TAPDRNGETIRVDADFVQKHVGDLAKNADLSRFIL"
FT   CDS_pept        complement(694560..695177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0647"
FT                   /note="ORF_ID:bll0647"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45912"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45912"
FT                   /db_xref="GOA:Q89WN1"
FT                   /db_xref="InterPro:IPR019691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WN1"
FT                   /protein_id="BAC45912.1"
FT                   /translation="MTLATTHESKAAVPAFAWVSIALLLLALQASILFAMGRVPICTCG
FT                   YVKLWHGVVNSSENSQHIADWYSFSHVLHGFLFYGLTFLLFARLPLLPLSWPARLIVAM
FT                   LIEGAWEIVENSPFIIERYRAGTISLDYFGDSIVNSVSDNLAMVLGFLAARVLPVWVTV
FT                   MIGLAFEIMLALHIRDNLTLNILMLIHPIEAVKQWQSGPPII"
FT   CDS_pept        complement(695174..695659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0648"
FT                   /note="ORF_ID:bll0648"
FT                   /note="putative aminoglycoside N(6')-acetyltransferase (EC
FT                   2.3.1.82)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45913"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45913"
FT                   /db_xref="GOA:Q89WN0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WN0"
FT                   /protein_id="BAC45913.1"
FT                   /translation="MTQSYAFRPMTAADLPLIRRWLGEAHVREWWGDPGEQFALVSGDL
FT                   DEPAMDQFIVLAGDKPFGYLQCYRLTAWNTGFGPQPGGTRGIDQFIGESDMIARGHGSA
FT                   FIRQFVDEQLRHGLPRVVTDPDPLNSRAVRAYEKAGFVRDRMVETPDGPALLMVRVP"
FT   CDS_pept        complement(695841..696401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /product="ATP-dependent protease"
FT                   /EC_number="3.4.25.-"
FT                   /note="ORF_ID:bll0649"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45914"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45914"
FT                   /db_xref="GOA:Q89WM9"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WM9"
FT                   /protein_id="BAC45914.1"
FT                   /translation="MQDSQKSSPGWHGTTILTVRKGGKVVIGGDGQVSIGQTVIKSNAK
FT                   KVRKLGRGDVIGGFAGATADAFTLFERLEAKLEQYPGQLTRAAVELAKDWRTDRYLRRL
FT                   EAMMIVADKDVSLVLTGTGDVLEPEAGVMAIGSGGNYALAAARALLDTDKDAETIVRRS
FT                   LDIAADICVYTNRNVTIESLATG"
FT   CDS_pept        696643..697236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /note="ORF_ID:blr0650"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45915"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45915"
FT                   /db_xref="GOA:Q89WM8"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WM8"
FT                   /protein_id="BAC45915.1"
FT                   /translation="MRTATIKRKTKETDIEVTVNLDGTGVSNIATGIGFFDHMLDLLAR
FT                   HSRIDLTVKAVGDLHIDHHHTTEDTGIALGQAVKQALGTMAGITRYAGVHMPMDETLSR
FT                   VVIDISGRPVLVFKVDFPRDKIGEFDTELVREWFQAFAMNASVTLHVETLYGDNSHHIA
FT                   ESCFKGLARALRAAVAIDPKAAGEIPSTKGSLGG"
FT   CDS_pept        697301..697831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0651"
FT                   /note="ORF_ID:blr0651"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45916"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45916"
FT                   /db_xref="GOA:Q89WM7"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WM7"
FT                   /protein_id="BAC45916.1"
FT                   /translation="MPVYTVHAPSPAGADLRATDKFVFVRDGFHFWAMIFGPFWLLWNR
FT                   LWLALIGWIVFLAAFDAGLHRLGVGRSSIFFANMIVAVLMGFEASSLRRWTLSRGKWRQ
FT                   LDIVISDDEDTAERRFFERWSQKQHGIVNDQWAVDRGGPPPTRNTPGQQFSNPPPIPAG
FT                   GIIGLFPEPGGSR"
FT   CDS_pept        697828..698478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /product="glutamine amidotransferase"
FT                   /note="ORF_ID:blr0652"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45917"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45917"
FT                   /db_xref="GOA:Q89WM6"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WM6"
FT                   /protein_id="BAC45917.1"
FT                   /translation="MSIAIIDYGSGNLHSAAKAFERAARSLEDPQKVFVTSDPDQAYGA
FT                   DRLVLPGVGAFADCRRGLDAVNGMVEAITEAVRVKARPMFGICVGMQLFATRGKEHVIT
FT                   QGLNWIGGDVEKITPRDESLKIPHMGWNTLDVLREHPVLNKLPLGPKGQHAYFVHSYHL
FT                   NAANEADVLARADYGGPVTAIVAKDTAIGTQFHPEKSQRFGLALISNFLRWKP"
FT   CDS_pept        698466..699212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /product="phosphoribosylformino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /note="ORF_ID:blr0653"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45918"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45918"
FT                   /db_xref="GOA:Q89WM5"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WM5"
FT                   /protein_id="BAC45918.1"
FT                   /translation="MEAVILFPAIDLKNGQCVRLEQGDMARATVFNLNPAAQAQSFAEQ
FT                   GFEYLHVVDLDGAFAGKPVNAQAVEAMLKTIKIPVQLGGGIRDLATVEAWLEKGITRVI
FT                   IGTAAVRDPDLVKAAAKKFPGRVAVGLDARDGKVAVEGWAETSQVTALEIAQRFEDAGV
FT                   AAIIFTDIARDGLLKGLNLDATIALADSISIPVIASGGLASIDDVKAMLTPRAKKLAGA
FT                   IAGRALYDGRLDPAAALTLIRNARAA"
FT   CDS_pept        699223..699996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /product="imidazoleglycerol-phosphate synthase cyclase"
FT                   /note="ORF_ID:blr0654"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45919"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45919"
FT                   /db_xref="GOA:Q89WM4"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WM4"
FT                   /protein_id="BAC45919.1"
FT                   /translation="MFKVRVIPCLDVKDGRVVKGVNFVDLRDAGDPVEAAIAYDAAGAD
FT                   ELTFLDITATHENRGIMLDVVRRTAEACFMPVTVGGGVREVDDIKTLLRAGADKVSINS
FT                   AAVSRREFVKEAAEKFGEQCVVVAIDAKRVKRPGGDRWEIFTHGGRNATGIDAIEYAQE
FT                   VVSLGAGEILLTSMDRDGTRQGFDIPLTRAIADSIPVPVIASGGVGNLDHLVDGIRDGH
FT                   ATAVLAASIFHFGEFTVREAKEHMARRGLPMRLDA"
FT   CDS_pept        700086..700406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /product="phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /note="ORF_ID:blr0655"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45920"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45920"
FT                   /db_xref="GOA:Q89WM3"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WM3"
FT                   /protein_id="BAC45920.1"
FT                   /translation="MPRFTIHDLAETIDARAAAGGEGSYTRKLLDKGAEHCAKKFGEEA
FT                   VETVIAAVENDRAHLIAEGADLLYHFLVLLKARGIKLEEVEAALGKRTSMSGLEEKASR
FT                   KE"
FT   CDS_pept        700403..701389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panK"
FT                   /product="pantothenate kinase"
FT                   /note="ORF_ID:blr0656"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45921"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45921"
FT                   /db_xref="GOA:Q89WM2"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WM2"
FT                   /protein_id="BAC45921.1"
FT                   /translation="MSKSQRKGGVMDIRAPEQQYNPYRVYTREQWARLRDDTPMTLEPG
FT                   EFDRLRSLHDRLDLQEVEDIYLPLSRLLSIYVDAMQRLYYAERQFLNIRDRKMPYIIGV
FT                   AGSVAVGKSTTARVLQALLARWSPRPKVDLITTDGFLYPNAVLDRQGIMQKKGFPESYD
FT                   LPLLLGFLSDIKAGRRHVRAPVYSHLTYDIVPNQWVEIDQPDILIVEGVNVLQTGKLPR
FT                   DGKAVPVVSDFFDFSVYIDADEAALRRWYIKRFLALRDTAFTNPKSYFNRYALLSDEEA
FT                   TATAIAIWERTNLANLEDNILPTRPRATLILKKGPDHVVESVALRRL"
FT   CDS_pept        complement(701520..702623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0657"
FT                   /note="ORF_ID:bll0657"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45922"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45922"
FT                   /db_xref="GOA:Q89WM1"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WM1"
FT                   /protein_id="BAC45922.1"
FT                   /translation="MIPTSREERLKGRRHVRTSEDRSFLVLLAAISVAFGWLLWPFSGA
FT                   LLWATLLAIIFAPLYRLCLETFPEWRNLAALSTVLVVVVMVLIPVAVVIASLVEQGGEL
FT                   YQRVQTGEISFAHPLQQLKSALPDWAASVSDRLAGIDLSALKERLSSLVVPAGQQLAGH
FT                   AINIGQLTVEFVASLLVMLYLLFFFLRDGDELNLRIRDALPLRRSHTAAILDAFTLSVR
FT                   GTIKGIILVALIQGALGGLIFWLLGLTAPLLAGALMALLSLLPVLGSALVWVPVGLYLL
FT                   VAGAVTKGMILLVFGTFVIGLADNFLRPVLVGQSIRMPSYVVLLATLGGLATFGANGFV
FT                   IGPLVAAMFLTAWHIFVGSKEQQEVRN"
FT   CDS_pept        complement(702691..703329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0658"
FT                   /note="ORF_ID:bll0658"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45923"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45923"
FT                   /db_xref="GOA:Q89WM0"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WM0"
FT                   /protein_id="BAC45923.1"
FT                   /translation="MSHMNVLCRLAVIVLLAGFSRYAAADTPDLLSSLKQGGYVLIFRH
FT                   TATDDSQKDVYPFRFDDMSAQRQLSEKGRDMARQIGAAVKELAIPIGDVYTSRLNRAIE
FT                   TGKLISGREVRPVDALTDSSNASASGMANPAGANAKAGQSVRQLVDAPPKAGTNTFLVT
FT                   HKTNIADAFGKDAGDVQEGEAFVYKASGSGPAAFAGRIKPADWSAKAGR"
FT   CDS_pept        complement(703424..705655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0659"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /note="ORF_ID:bll0659"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45924"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45924"
FT                   /db_xref="GOA:Q89WL9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WL9"
FT                   /protein_id="BAC45924.1"
FT                   /translation="MAMGRTFRIKVRMRRFRRQHPRIAFAIRSFMIFSATFGGAYGFVS
FT                   GSRSENSGYDPHTFAIGASFLFALACLGLATLSMRLRFVNKRLRKLAAHNEALIDRNWE
FT                   LKEAEERARSLFEQQGDLIVLRDHQNRITFANDAYCALAGQARGALVGTRFDFDVLEQG
FT                   DSARESSGTRVHDQKIATPLGARWIAWREGYVRLDAGQPAELQSVGRDVTDRTETERAL
FT                   SDARDQADAANRAKSRFLAMASHEIRTPLNGIIGMGGLLLDTTLTPEQATYAKAVKTSG
FT                   EALMALIEELLDYSKIEAGKLDLEQRPFALSTLIEEITELLAPRAQAKTLEIAAYVDER
FT                   LPLEVVGDAARLRQVLLNLAGNAIKFTASGGVALIVEPGIRPNEISFLVRDTGIGIAAE
FT                   AQQRIFREFEQADERVARTYGGTGLGLAISERIVKRMGGRITLASEPGKGSTFEVAVPL
FT                   APSEARAGQTAFPSPDLTGKSILLIAEGIEASLIARRLERWGSQTCLVTDATVAEALLP
FT                   ERSWHAVLVDRAIGPAIADRLGGVARAHAPQRLVLLTSSSRHEKQSAAFTGFLVKPLRA
FT                   ASLAARLALTPEVASPELAPEPPVEATSAAPARGLSVLVAEDNEINALLMRSLLTKLGH
FT                   RVVIAVHGEAALESWLAASSAGTPYDLVLMDIQMPQLDGIEATKRIRAHEAATGGHHTP
FT                   ILALTANTLVEDRYACFEAGMNGFLIKPLDRDKLDEALAGLAASRQLAG"
FT   CDS_pept        complement(705857..706324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0660"
FT                   /note="ORF_ID:bll0660"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45925"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45925"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WL8"
FT                   /protein_id="BAC45925.1"
FT                   /translation="MLRFKILASVVPLLAAAVFARSEIGSVSHPCIALGDTSVELTSLF
FT                   WTAGIHVAFTDDPTRATVRVQITDDADGADFAVVDDGLGAEPDSCQANPQTRLITIAAQ
FT                   PVDGGPVIYLSTDGPADYRIYVRSKTFSQREAAALIVGAHDGHRPFQAASL"
FT   CDS_pept        complement(706422..707960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0661"
FT                   /note="ORF_ID:bll0661"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45926"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45926"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WL7"
FT                   /protein_id="BAC45926.1"
FT                   /translation="MVQRVSTVAFEGIEARAVDVQVQVAPGLPAFAIVGLPDKAVSEAR
FT                   ERVRSALIASGLALPARRIIVNLAPADLPKEGSHYDLPIALGLMAAIGAIPPDALTGFT
FT                   VLGELGLDGSIAPVAGVLPAAIGANVREEGLICPAACGSEAAWASPDIQIIAAQSLIQI
FT                   ANHFKGTQVLSRPSPKVHEAAASKLDLRDIKGQESAKRALEIAAAGGHHLLMIGAPGAG
FT                   KSMLAARLPSILPPLSPGELLEVSMIASVAGEIEGGALTARRPFRSPHHSASMAALTGG
FT                   GMRAKPGEISLAHQGVLFLDELPEFDPRVLDSLRQPLENGEVSVSRANHRVTYPARFML
FT                   VAAMNPCRCGNAFEPGYACKRGRIDRCTGDYQARISGPLMDRIDLRIEVPAVTAADLIL
FT                   PPPAEGSAEVAARVAAARDIQLARYADIGLPNVRTNAEAPASVLEDIAKPDAQGAKLLR
FT                   DAAETMRLSARGYHRVLRVARTLADLDGADKIGRLHLAEALSYRALAEDVRQMA"
FT   CDS_pept        708186..708431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0662"
FT                   /note="ORF_ID:bsr0662"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45927"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45927"
FT                   /db_xref="GOA:Q89WL6"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WL6"
FT                   /protein_id="BAC45927.1"
FT                   /translation="MLANRRRSERRVCSRLAKIHFGAGSLPRDCTITDISDGGVKVVAE
FT                   FLEVPPQFTIIFAPDYSRQCRLRWRIGCEFGAEFTD"
FT   CDS_pept        708510..709286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0663"
FT                   /note="ORF_ID:blr0663"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45928"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45928"
FT                   /db_xref="GOA:Q89WL5"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014596"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WL5"
FT                   /protein_id="BAC45928.1"
FT                   /translation="MSKRLSLASRPARYLLSALVLLALGGCQTTGIEDITGALGGKSEA
FT                   ASKADGKPDMDALRERYRAKPSDPNVALDYGKALRESGQSAQAVAVLEQAVLGHPRNKA
FT                   LLAGYGRALADNGNFQQAFDVLSRAHTPEDPDWRILSAQGAALDQLGRNEEAQQYYATA
FT                   LKIVPDEPQVLSNLGLSYVLQNNLPKAEQVLGRAHQRNQNDARIRANLALVLGLQGREA
FT                   EAEILVKADLPPDQAAAKITALRQLLAKKQQQRAEK"
FT   CDS_pept        complement(709336..710625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpF"
FT                   /product="CtpF protein"
FT                   /note="ORF_ID:bll0664"
FT                   /note="components of type IV pilus"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45929"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45929"
FT                   /db_xref="GOA:Q89WL4"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WL4"
FT                   /protein_id="BAC45929.1"
FT                   /translation="MTSVNDEETDHPRHPEEHIAPVPRISVQAFCETDQTLAAVTAAGE
FT                   DRRLAKAHLTAKEGGLAAAIEVYETMPTPNVIVIESDGTRDILEGLDDLAGVCDPGTRV
FT                   VVIGNPNDTAPYRELVRRGVNDYVVGPVETIDVVRSICSLFSASEAIITGRVIAVVGAK
FT                   GGVGASTVAHNVAWTIARDLALDSVVIDLDLAFGTASLDYNQDPVQGIANAVLSQDRPD
FT                   TALMERLLAKCTERLSLLAAPATLDRVYDFGAEAFDAVFDTLRMTTPCIVLDVPHQWSG
FT                   WTRRALINADDIVIVAEPDLANLRNTKNMLTVLKTARPNDRPPLYCINQVGMHKRAEID
FT                   VKSFAKTMESQPIAVIPFDSKLFSTAANNGQMIAEVSKSHRTTALFQNMANRLVGRGEV
FT                   KKPKRSLLGPLLKKLKGRSGRASAPHRKAS"
FT   CDS_pept        complement(710622..711356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilV"
FT                   /note="ORF_ID:bll0665"
FT                   /note="putative pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45930"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45930"
FT                   /db_xref="InterPro:IPR013361"
FT                   /db_xref="InterPro:IPR019027"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WL3"
FT                   /protein_id="BAC45930.1"
FT                   /translation="MTKTMADRRRGLSVALVLTGLSVMLGACNTTGEIVTQTVPTDYRQ
FT                   RHPIAVQEAKKSIVIFVGKARGGLSAAQQSDVAGTARDWVREGTGSVVVDVPIGSANSR
FT                   AAATTYHEIRSVLASGGVPSRAIVQHPYRPEDPGLLPTIRLSYSRIAAVAGPCGLWPED
FT                   VGPSILDPGYNENQPYFNLGCASQRNLAAMIDNPADLEQPRAETPVYTARRDIAFDRYR
FT                   KGAAIATPSPEADKAKLSDTGK"
FT   CDS_pept        complement(711413..712930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0666"
FT                   /note="ORF_ID:bll0666"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45931"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45931"
FT                   /db_xref="GOA:Q89WL2"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WL2"
FT                   /protein_id="BAC45931.1"
FT                   /translation="MNYGDDRAGLRIRGNRARTFWAGAMLTLGLLAAPGLVSAAEAPVG
FT                   DQAPLQAPDLGVASVGTIAPAKTRFLSLGVGKSVVIDLPREVKDVLVADPKIANAVIRS
FT                   AQRAYIIGGQVGQTNVVFFTADGQQVAAYDIAVKRDLNGMRAALRQSLPGVQIEGIGDS
FT                   VMLTGSVSSPVEAQQAGEVAAKLVGGSEKVVNNIVVRGRDQVMLKVVVGEVRRDIVKQL
FT                   GVDLSASLNAGTAVVNFNNSNPFSVSGGPLVSSNGLGVTGLAKGVATVNATMRAMETAG
FT                   VMRTLAEPSLTAISGESATFIAGGEFPIPGGYACDPVTHVCTTQITYKKFGISLNFTPV
FT                   VLSEGRISLRVMTEVSELSNQNAISVTQAVSASQTSSVTIPSIQTRRAETTLEIPSGGS
FT                   MAMAGLIQQQTKQAINGLPGVDQVPIIGALFRSQDFVNNETELMVIVTPYVVRAVAQKE
FT                   LSRPDDGFAPASDAQTALLGRMNRLYGIARRVDPIDGARGDFGFIID"
FT   CDS_pept        complement(712941..713753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpC"
FT                   /product="CtpC protein"
FT                   /note="ORF_ID:bll0667"
FT                   /note="components of type IV pilus"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45932"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45932"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WL1"
FT                   /protein_id="BAC45932.1"
FT                   /translation="MNTARIVVLVIALGAGGVAAYLASGYDNKPAPALPVAEKLPTVEV
FT                   LVAKNDIQLGQAVKPEDLQWQSWPAATASGAFIRRDSRPEAQTQIAGSIARVPLMQGEP
FT                   IREQKLVRAEGSGFMAAILPSGMRAVSTDVTAETSAGGFILPNDRVDIVLTRRLKNPDV
FT                   NGPTAGNDLILSEVILTNIRVLAIDQAPKEKDGQNAVVGKTVTLELKPDQVATLTAARQ
FT                   GGTLQLALRSIVDANATELTAEDLAIKRSGGVNVIRYGVQVRQLTSQK"
FT   CDS_pept        complement(714107..715051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /product="glutathione synthetase"
FT                   /note="ORF_ID:bll0668"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45933"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45933"
FT                   /db_xref="GOA:Q89WL0"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WL0"
FT                   /protein_id="BAC45933.1"
FT                   /translation="MKLNVAVQMDPIARINIKGDSTFALLLEAQKRGHGLSYYTPDKLS
FT                   MIGEELVAPVQLLTVRDEPGDHFTLGEPKREALNGFDVVLLRQDPPFDLAYITSTHFLE
FT                   RIHPKTLVVNDPASVRNAPEKLFVMNFPQLMPPTLISRDLDEINAFRDKHGAVVMKPLH
FT                   GHGGAAVFRVMPQDMNFGSLFDMFTVTFKEPWVIQQFIPEVKHGDKRIILVNGEFAGAV
FT                   NRVPAADDLRSNMVRGGAAQETELTPREREICATVGPALRERGLLFVGIDVINGNLTEI
FT                   NVTSPTGIRAIARLGGPDVAAKVWDTIEQKRAK"
FT   CDS_pept        complement(715062..715463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0669"
FT                   /note="ORF_ID:bll0669"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45934"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45934"
FT                   /db_xref="GOA:Q89WK9"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WK9"
FT                   /protein_id="BAC45934.1"
FT                   /translation="MAKPEGGAEPKVASPERVAAFRTGISAESRAAAYLMAKGYRILAK
FT                   RYRTPHGEIDIVARRRNLIAFVEVKARASLDDAAYAVTPRQQQRIIDAAQGWLAAHPEH
FT                   AEFELRFDAMLIAPRSLPRHVLAAFDAST"
FT   CDS_pept        complement(715450..716400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0670"
FT                   /note="ORF_ID:bll0670"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45935"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45935"
FT                   /db_xref="GOA:Q89WK8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WK8"
FT                   /protein_id="BAC45935.1"
FT                   /translation="MRAKPAPINTPEGPDAAPRGFSIDAHRLAAPKAAAGLYLVATPIG
FT                   NLGDITLRALQTLAGVDVIACEDTRITRRLTERYDISAQLKPYHEHNAEAARPKILERL
FT                   SQGGSIALVSDAGTPLISDPGFKLVREVCAAGHAVYALPGPSSVLAALSVAALPTDRFF
FT                   FEGFLPAKSAARRSRLAELARIDATLVMFESGNRVQDTLADLAEIMGTREAAICRELTK
FT                   LHEEISRATLTELAREADALETRGEFVLVIAPPAADAEMLTSHALDDLLRAQLATHSVK
FT                   DAVAHAVELSGRPRREVYARALELAKDLRGGDGEA"
FT   CDS_pept        716714..717988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0671"
FT                   /note="ORF_ID:blr0671"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45936"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45936"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WK7"
FT                   /protein_id="BAC45936.1"
FT                   /translation="MTGRRRQVRREATMLGPRHPKSPDPGPQSSGATRRSALGLLLGAP
FT                   LLSACAGVQQSLSQFSNPFSSSSTPPAQPAGPPQQATTAGTGGVKVAVILPLSAAGNAG
FT                   LAAQSMRNAAEMALAEFQNPNIQLLIKDDNGSPQGAQAGAQQAIDEGAEIILGPLFAQS
FT                   VPAVAQVARTRGISVIAFSTDSSIAGRGVYLLSFLPESDVNRIVEYSASMGKRSVAVLV
FT                   PDNAYGNVVEAAVKAAVPRRGGRIVAFEKYGADRATPARAVAQQLGSADALFIADDGDA
FT                   VVTVADAMTAAGANLRNIQLLGTGLWDNPRVYANASLQGGLYAAPDPAGFRAFSGRYRT
FT                   KYGAEPIRTATLAYDAVALVAALARTQGTTRFSSDVLTNPSGFAGIDGLFRFRADGTNE
FT                   RGLAVMKVTTGGGVAVAGSPKSFGA"
FT   CDS_pept        complement(718141..719262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="ORF_ID:bll0672"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45937"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45937"
FT                   /db_xref="GOA:Q89WK6"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WK6"
FT                   /protein_id="BAC45937.1"
FT                   /translation="MHWPFCLSKCPYCDFNSHVRHAAIDEARFASAFAREIETTAQRAP
FT                   GREVTSIFLGGGTPSLMQPATVGAVLDSIGKHWQVARDVEVTLEANPTSVEATRFAGYR
FT                   AAGVNRVSLGVQALDDASLKALGRMHSAREALDAVAIARRSFERYSFDLIYARPDQTPA
FT                   MWADELRLAIAEAAEHLSLYQLTIEEGTPFFGLHQAGKLKTPDEAVARALYDVTQETCD
FT                   KLGLPAYEISNHARRGAECRHNLVYWRGDEYAGIGPGAHGRLDIDGIRHATATEKRPEA
FT                   WLLRVETNGHGVVTDDLLNSEERADEFLLMGLRLAEGIDPERYTALSGRALDPKRIALL
FT                   REEGAITVDATGRLRVTSSGFPVLDAVVADLAA"
FT   CDS_pept        complement(719282..719917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0673"
FT                   /note="ORF_ID:bll0673"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45938"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45938"
FT                   /db_xref="GOA:Q89WK5"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WK5"
FT                   /protein_id="BAC45938.1"
FT                   /translation="MHRRITGKLVIATHNPGKLAEMKELLAPYGIEAVSAGELGLSEPD
FT                   ETGNDFRSNAAIKAIAAAHASKLPSFADDSGIVVDALDGAPGIYSARWAGPTKDFTAAM
FT                   TRIERLLQERGATAPDKRKAHFVSALCVAWPDDHLEEVEARVDGTLVWPPRGTAGFGYD
FT                   PMFRPDGHTRTFGEMTSIEKHGLPPLGLALSHRARAFVKLAEICLEPR"
FT   CDS_pept        complement(719929..720642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /product="Ribonuclease PH"
FT                   /note="ORF_ID:bll0674"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45939"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45939"
FT                   /db_xref="GOA:Q89WK4"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WK4"
FT                   /protein_id="BAC45939.1"
FT                   /translation="MRPSRRAPDELRPVTLERGVVKYAEGSCLVKFGDTHVLVTATLED
FT                   RLPPWLKGQGRGWVTAEYGMLPRATSERTRREASAGKQSGRTVEIQRLIGRSLRTIINL
FT                   EALGERQITVDCDVLQADGGTRTASITGAWVALADCVNWMKARNMVKANVLRDNVAAIS
FT                   CGIYNGTPVLDLDYAEDSEAQTDANFVMTGDGRIIEVQGTAEREPFTQDELLALMALAQ
FT                   KGIARLVDLQKLAVA"
FT   CDS_pept        720817..721905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /product="heat-inducible transcription repressor"
FT                   /note="ORF_ID:blr0675"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45940"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45940"
FT                   /db_xref="GOA:Q9REF2"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9REF2"
FT                   /protein_id="BAC45940.1"
FT                   /translation="MAHHDPIHLIAPRAGLAQLNERSRDIFRQIVESYLATGEPVGSRN
FT                   ISRLIAMPLSPASVRNVMADLEQLGLIYAPHTSAGRLPTELGLRFFVDALMQVGDLNDA
FT                   ERQSIQSQLTSVGQAQSVEAALDQALTRLSGLTRAAAVVLTPKSNARLKHIEFVRLEPE
FT                   KALVILVGEDGQVENRVLTLPPGVPSSAITEAGNFLNSRIRGRTLAEARLELETALGEA
FT                   RAELDQLTQKVISAGIASWSGGENEDRQLIVRGHANLLEDLHALEDLERVRLLFDDLET
FT                   KRGVIDLLGRAETAEGVRIFIGSENKLFSLSGSSTIISPYRDAAGHIVGVLGVIGPTRL
FT                   NYARVIPTVDYAARIVSRLLGG"
FT   CDS_pept        722003..722608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /product="heat shock protein"
FT                   /note="ORF_ID:blr0676"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45941"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45941"
FT                   /db_xref="GOA:Q79V15"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q79V15"
FT                   /protein_id="BAC45941.1"
FT                   /translation="MTDRDRQPEDTTAPTGEPVVSKPYIMPDDPEPGSVELLQKEAAEA
FT                   RDRMLRTLAEMENLRKRTTKEVADARLYGITGFARDVLDIADNLQRALDAVPAEARAAA
FT                   DPGLTSLIEGVELTERSLLNALEKHGVKKFDPQGQKFDPNFQQAMFEVPDASVPAGTVV
FT                   QVMQAGYTIGERVLRPALVGVAKGGAKAASAANSNEVN"
FT   CDS_pept        complement(722742..723464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncA"
FT                   /product="bifunctional pyrazinamidase/nicotinamidase"
FT                   /note="ORF_ID:bll0677"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45942"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45942"
FT                   /db_xref="GOA:H7C7U0"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:H7C7U0"
FT                   /protein_id="BAC45942.1"
FT                   /translation="MLDRRQVLAALGTSALVALAPTALLAAASIKPDDASALLVIDVQN
FT                   CFLPGGSLAVKEGEQVVPVINKISKAFSNVVMTQDWHTPGHVSFASVHSGKKPFETIDL
FT                   PYGKQVLWPDHCVQGTDGASLSKDLAIPHAELIIRKGFHKDVDSYSAFLEADGKTSTGL
FT                   AGYLKGRKIKRVFVAGLATDFCVAWTALDARKAGFEVYVVEDACRGIDTQGSLAKAWAD
FT                   MAKAGVKRIQSADIAASA"
FT   CDS_pept        complement(723729..724676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0679"
FT                   /note="ORF_ID:bll0679"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45943"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45943"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WK3"
FT                   /protein_id="BAC45943.1"
FT                   /translation="MPMKLIRPLAALALLAVSALPAFAADAVFPPGLRLGMVPLVGLST
FT                   AKTFPGFESEDGTVKVLITELPPAAYGEVVSAFNSNPAGTGGVKQDKIETPAGLAYFTT
FT                   ESGKAGETAVKRYSMIVPGAGFSGYVAVQIPENATKIYTDEAVRQMFASTVTRKQVSAE
FT                   EQIALMPFKITDLADFKDIRTLAPGSSIILADGNESTGYESKPFMILGLIGATPQAADD
FT                   RARFAQEAALQIPGVRESRVTMSEPIRINGQQGFETRIDGVSGKDKTPVTVVQWIRFSS
FT                   GGASLRIIASAPRDQWQAAFTRFRAVRDGIQPKG"
FT   CDS_pept        725067..726968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /product="heat shock protein 70"
FT                   /note="ORF_ID:blr0678"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45944"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45944"
FT                   /db_xref="GOA:P94317"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94317"
FT                   /protein_id="BAC45944.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVMDGKNAKVIENSEGMRTTPSIVAVTDD
FT                   GERLVGQPAKRQAVTNPERTFFAVKRLIGRRYDDPMVEKDKKLVPYKIVKASNGDAWVE
FT                   ADGQTYSPSQVSAFILQKMKETAEAHLGQKVDQAVITVPAYFNDAQRQATKDAGKIAGL
FT                   EVLRIINEPTAAALAYGLDKTKTGTIAVYDLGGGTFDISILEIGDGVFEVKSTNGDTFL
FT                   GGEDFDMRLVGYLADEFQKEQGINLRNDKLALQRLKEAAEKAKIELSSTTQTEINLPFI
FT                   TADQTGPKHLTMKLTRAKFEALVDDLIQKTVEPCRKALKDAGVTAGEIGEVVLVGGMSR
FT                   MPKVQEVVKQLFGKEPHKGVNPDEVVAIGAAIQAGVLQGDVKDVLLLDVTPLSLGIETL
FT                   GGVFTRIIDRNTTIPTKKSQVFSTAEDNQNAVTIRVFQGEREMAADNKMLGQFDLMGIP
FT                   PAPRGMPQIEVTFDIDANGIVNVSAKDKATGKEQQIRIQASGGLSEADIEKMVKDAEAN
FT                   AEADKKRREAVTAKNEADGLVHSTEKALAEHGSKVAETERRAIEDAVSDLKEALKGDDA
FT                   EAIKAKTQTLAQASMKLGEAMYKQQAEADAKKDAAKDDVVDAEFTEVDDDKNNKKSA"
FT   CDS_pept        727214..728347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /product="chaperone protein"
FT                   /note="ORF_ID:blr0680"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45945"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45945"
FT                   /db_xref="GOA:P94319"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94319"
FT                   /protein_id="BAC45945.1"
FT                   /translation="MSTSTKRCYYETLEVERDADESKLKSSFRKLAMKFHPDRNPGDDT
FT                   SEVKFKEINEAYEVLKDKDKRAAYDRFGHAAFEQGGPGGGAGFGAGFASSFSDIFEDLF
FT                   GMAGQRGRGGRERGADLRYNMEITLEEAFGGKTAQIEIPVSVTCEACSGIGAKAGTKPK
FT                   TCSTCGGAGRVRQSQGFFTLERTCPGCQGRGQMIEDACPSCSGQGRVTRERTLSVNIPQ
FT                   GVEDGTRIRLAGEGEAGVRGGPPGDLYIFLSLAQHQFFQRDGADLHCRVPISMVTAALG
FT                   GEFEVPTIEKGKAKVKVPAGTQSNRRFRIASKGMPVLRSRQTGDMYVQVVVETPQNLTK
FT                   KQQELLAEFEKLSSGNTQPESEGFFTKVKDFFGSRAN"
FT   CDS_pept        728435..729034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmtA"
FT                   /product="phospholipid N-methyltransferase"
FT                   /note="ORF_ID:blr0681"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45946"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45946"
FT                   /db_xref="GOA:H7C6S7"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:H7C6S7"
FT                   /protein_id="BAC45946.1"
FT                   /translation="MPLPSSARALKKPRLDDEVRFLRSWIEKPLHMGAVMPSGKLLART
FT                   MAHYVDVNSDAPVVELGPGTGAITSALVERGVDQKRLVLVEYNPGFCALLRDRYPQAKV
FT                   VQGDAYRLRDTLWNVLSAPASAVVSGLPLVTKPMLTRLRLIRDAFTALAPGAPFVQFTY
FT                   AVVPPIPKSLPGVSTEASERIWMNLPPARVWVYRKD"
FT   CDS_pept        729092..729670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0682"
FT                   /note="ORF_ID:blr0682"
FT                   /note="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45947"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45947"
FT                   /db_xref="GOA:H7C6G7"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:H7C6G7"
FT                   /protein_id="BAC45947.1"
FT                   /translation="MSAPKILVIPGSLRTGSHNAKLAALAAYEFAQAGVDVTRISLADF
FT                   PLPIYDGDLQAKSGVPKHAINLKRMIGAHHGVLIVSPEYNASVPPLLKNAIDWVSRVHE
FT                   LHEARGEVFRNRAFALAGASQSRLGAARALQALRLILTSCHANVIASQLTLAFAGEAYD
FT                   DMDRLKNEGDIAALKELVAQLIDISQRMM"
FT   CDS_pept        729677..730390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /product="orotidine 5'-monophosphate"
FT                   /note="ORF_ID:blr0683"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45948"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45948"
FT                   /db_xref="GOA:Q9LCT0"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LCT0"
FT                   /protein_id="BAC45948.1"
FT                   /translation="MTPAEIAPKDRLIVALDLPSVDAAEAMIARLGDSVTFYKIGYRLA
FT                   YAGGLPLVARLADKGKKVFLDLKLHDIGNTVAQGVESITRLGATFLTVHAYPQTMKGAV
FT                   EGRGGSNLKILAVTVLTSYNEDDLHAAGFRLGVAELVEARAQQAQVLGIDGLVSSPEEV
FT                   GALRKIVGHQMSLVTPGIRPAGSASGDQKRIMTPGRAITAGADYLVVGRPVVEAAEPKA
FT                   IADAIQAEIGQALGA"
FT   CDS_pept        730510..730821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0684"
FT                   /note="ORF_ID:blr0684"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45949"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45949"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:H7C7V4"
FT                   /protein_id="BAC45949.1"
FT                   /translation="MAKGYWIGRVDVNSDEGYKPYAVANGAIFKKWGGRFVVRGGKFTT
FT                   VEGASRTRNVVIEFPDYETAIACYNSPEYQANIKVRQPHSVADLIIIEGYDGAQPSDG"
FT   CDS_pept        730903..731790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /product="dihydrodipicolinate reductase"
FT                   /note="ORF_ID:blr0685"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45950"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45950"
FT                   /db_xref="GOA:Q89WK2"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WK2"
FT                   /protein_id="BAC45950.1"
FT                   /translation="MTVVSPSVAGTASPRYNGPEEDHTMSDMRLIVAGAGGRMGRALTR
FT                   AIAESKGAVLAGALEAPGSEMLGKDAGVLAGLPANGIKLSADLWAMSKEADGILDFTVP
FT                   AATIANVAIAAERGIVHVIGTTGLSGSDNAVIKSVTNRAVVVQSGNMSLGVNLLAAVVK
FT                   RVAKALDQSFDIEIVETHHRMKIDAPSGTALMLGQAAAAGRGISLDEHADRGRDGITGA
FT                   RKPGNIGFASLRGGTAAGDHSVSFLGPFERLTLSHQAEDRMLFAHGALKAALWAHGKKP
FT                   GHYSMADVLGLADI"
FT   CDS_pept        731818..732441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0686"
FT                   /product="phosphoglycerate mutase"
FT                   /note="ORF_ID:blr0686"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45951"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45951"
FT                   /db_xref="GOA:Q89WK1"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WK1"
FT                   /protein_id="BAC45951.1"
FT                   /translation="MSERLLVLVRHGQSEWNLKNLFTGWKDPDLTEQGVAEAREAGRKL
FT                   KAQGLVFDVAYTSVLTRAQHTLDLILGELGQKGLPTEKNLALNERDYGDLSGLNKDDAR
FT                   KKWGEDQVLIWRRSYDVPPPGGESLKDTLARALPYYVQEILPSVLNGKRTLVAAHGNSL
FT                   RALIMVLEKLSPEGILKRELATGVPIIYRLNADSTVASKLDLAG"
FT   CDS_pept        complement(732558..733454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0687"
FT                   /product="transcriptional regulatory protein"
FT                   /note="AraC family"
FT                   /note="ORF_ID:bll0687"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45952"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45952"
FT                   /db_xref="GOA:Q89WK0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WK0"
FT                   /protein_id="BAC45952.1"
FT                   /translation="MMTLAIHDQRLTKPGHQNAALRDYDSVRRAIAFISENWRAQPTIE
FT                   AMADAAGVTPDELHHLFRRWASITPKAFMQALTLDHAKGLLRDSASVLDAALDSGLSGP
FT                   GRLHDLFVTHEAMSPGEWKNGGAGLTLRYGFHASPFGTAIVIATDRGLSGLAFADPGEE
FT                   KAALADMTRRWRNATYVEDHEGTAPLAQRIFDTKLWRPDQPLRVVMIGTDFEVRVWETL
FT                   LKIPMGRAVSYSDIACNINSPKASRAVGAAVGKNPVSFVVPCHRALGKSGTLTGYHWGI
FT                   TRKQAMLGWEAGQLGMQ"
FT   CDS_pept        complement(733510..734043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0688"
FT                   /note="ORF_ID:bll0688"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45953"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45953"
FT                   /db_xref="GOA:Q89WJ9"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WJ9"
FT                   /protein_id="BAC45953.1"
FT                   /translation="MSTGNEIERRDSEDQSEAQIFSALLTPHRSLNRTGFLAVMLFLSA
FT                   VSFVTGLVFLMMGAWPVLGFFGLDVLVIWWAFKVNFRAARASEEIVVTPSELRVRRVSH
FT                   RGQVAEWTFNPLWVRLDLEIDEDFGLEHLYLISRGRRLQLAGFLGPEEKTSFYNGLVEA
FT                   LNAAKRGPTFNPIR"
FT   CDS_pept        734036..734818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0689"
FT                   /product="endonuclease III"
FT                   /note="ORF_ID:blr0689"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45954"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45954"
FT                   /db_xref="GOA:Q89WJ8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WJ8"
FT                   /protein_id="BAC45954.1"
FT                   /translation="MLIVPQYIPIMAKITRKPVPRKAAVPKKKAKAAVAKPKAPAKKSL
FT                   KAMKPWTPAEIREVFSRFRKANPEPKGELEHVNPFTLLVAVVLSAQATDAGVNKATRAL
FT                   FEVADTPQKMLDLGEESLREYIKTIGLYRTKAKNVIALSAKVLSEFGGEVPRTRAEIES
FT                   LPGAGRKTANVVLNMAFGEHTMAVDTHVFRVGNRTGLAPGKTPLEVELGLEKVIPAEFM
FT                   LHAHHWLILHGRYTCLARKPRCEVCLINDLCRWPEKTV"
FT   CDS_pept        734850..736097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0690"
FT                   /note="ORF_ID:blr0690"
FT                   /note="putative multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45955"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45955"
FT                   /db_xref="GOA:Q89WJ7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WJ7"
FT                   /protein_id="BAC45955.1"
FT                   /translation="MRSIEPGISRFRVWSFGPSRNDSGEIRIRAKWLWGHTVSQQEQAS
FT                   SPPPAATPAPPPKPTQRPASSLWSRFAIPLFAVIVALAFVALATLRFDEWVGNAVIQTT
FT                   NDAYVRSELTRLASRVSGEVLTVGVTDFQRVKAGDLLIQIDPADYEAQVAQSEAAVAAA
FT                   QATLDNLANQVELQYATIAQAQAARLSAEAIEVEARQEQERQQSLSQTESGTRQRFEQA
FT                   VAAYAKAQADVRASRAVIAAQQHQLEVLQGTRKQRAADLDATKASLASARLKLGYTTIS
FT                   APFDGVVGERQVQPGDYVNIGTNLINVVPLPKVYVIANYKETQLTHVAPGQPVEITVDS
FT                   FPREKLRGRVERIAPATGAQVALLPPDNATGNFTKVVQRIPVRIQLDDNQQLTARLVPG
FT                   MSVVTSINTAGANGGK"
FT   CDS_pept        736084..737712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0691"
FT                   /note="ORF_ID:blr0691"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45956"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45956"
FT                   /db_xref="GOA:Q89WJ6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WJ6"
FT                   /protein_id="BAC45956.1"
FT                   /translation="MAGNDDSDRGPLSRGGVAPQPMFAVAAVLLGSFLANFDSRLTTVG
FT                   LPDLRGAFSLSFDEGAWLSTAGIGSQIFIAPAVAWLATAFGLRRVLGIPSLVYAAVSLI
FT                   IPFVHDYPTLIALSVVHGLLLGTFVPATLMIVFRNLPIRWWLPAISIYSIRVGFALDTS
FT                   SSLVGFYVDHLGWQWLYWQGVVIAPLMGLMVYLGTPSEPVNRALLRDADWGGMLLLGAS
FT                   VSMIYAGLDQGNRLDWLGSGTVMALLAAGAVLFAGFLVNESLVRQPWAHVNVLFSRNIG
FT                   LSLVVILLYTLTSLSNSSLVPNFLGNVGLLRPEQSGLLLLTYGALPMFVLVPISIWLLR
FT                   HFDARVVTVLGFACFAAANLWGTQLTHDWAREDFIGIVLLQSVGQSTTLLPIIIMALSN
FT                   SDPSRATSFAAYIQIMRLGGAEIGVALMGTWLRVREQVHSFYLGQNLGVGDVDVVRTLK
FT                   QLADHFAAHGAGLAQARAVGTLASFVQREANVLAYIDGFWLCFWLAMAALGVVALITRA
FT                   PPGPFTPAPFGFAKMLLRKCGAQVT"
FT   CDS_pept        complement(737721..738461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0692"
FT                   /note="ORF_ID:bll0692"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45957"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45957"
FT                   /db_xref="GOA:Q89WJ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WJ5"
FT                   /protein_id="BAC45957.1"
FT                   /translation="MLDAAVKALSQMISPPMRSILWRSIGLALVLITVLAIGLQRLLSW
FT                   FATYGEVWLEGLLGPGWHTSLEVLAWIVSIAAGLGVVFGAVFLMPAITSLVASLFVDDV
FT                   ADHVEREHYPAERPGVALPFSQAIYEGVKTALLTILVYLIALPFVLLAGAGFLIFFLAT
FT                   AWLLGREYFELAAMRFRSPKEAKAMRRDNAATVFAAGLIIAAFVSIPIVNLATPIFGMA
FT                   FMVHMHKRLSGPRPELIEPARQMR"
FT   CDS_pept        complement(738549..739763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0693"
FT                   /note="ORF_ID:bll0693"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45958"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45958"
FT                   /db_xref="GOA:Q89WJ4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WJ4"
FT                   /protein_id="BAC45958.1"
FT                   /translation="MEDICQNQIDGDDAMLADRKWVERNLGFDPITTPPPPETFVVKRV
FT                   KDAAAKKTAKVTAEDFRREIIDFDSESAEGRAFMAFSTSTGLSRFTDIPWPKGLAPQTG
FT                   PKPKGNGKGPLPRADVLVVTWTVDEGHALSRVLTPGKDSRNDYVPYTHNYAAISKKMRN
FT                   GCPAKELKRLGTYWTTTIGKKKCVIFKSDSHMSQDGPRLPNIDVWRQIITEVQPTLVIT
FT                   TGTAGGIGKAFEVGDVVVSPIVRFDCLSKFKKQPFAQEHFSSRPAVSKKFAQAKTLFKA
FT                   NAGQLPKDNTRAPKIFVVKPSGLSSSVVTTDFFGFDTSDNHFHLQGLGDVSEMGDAILG
FT                   LVAQEMGEKAPRWLAIRNVSDPQIKAEGTLKQQEQVAAQIYKGFGRWSTVCSAITCWAS
FT                   IAAER"
FT   CDS_pept        740099..741304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0694"
FT                   /note="ORF_ID:blr0694"
FT                   /note="probable peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45959"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45959"
FT                   /db_xref="GOA:Q89WJ3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WJ3"
FT                   /protein_id="BAC45959.1"
FT                   /translation="MVGVHGLDNRPVAQPHFRRKMAKTGATARAAQGGSFSVEQIAELY
FT                   NFPGGETGAGQCIAIIELNDIDQKGHPTGAGYKTSDLRTFFKKAGIPMPQIAPASVDGG
FT                   ANKPGHSEADGEVVLDIEVAGAIAPGARIVVYFAPNTTNGFIDAVKAAVHDAARKPSVI
FT                   SISWGGPEDEDGSQQFVDGLNEAIRDAAAMGVTVCVASGDNGSADMGEDWDGKPHADFP
FT                   ASSPFALACGGTNLKAPNGHIQEVVWNGGTQGGAGGGGVSVVFPRPAYQAHAHVPKSPS
FT                   HSVGRGVPDVAGDADPATGYQIFLNGVGTTIGGTSAVAPLMAGLIARINEATTKKFGKT
FT                   VGFINPLIYASHAQGVFRDITVGNNDITGDLHGMYKAGPGWDACSGLGVPNGAALQNLL
FT                   AA"
FT   CDS_pept        complement(741449..742894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0695"
FT                   /product="major facilitator superfamily transporter"
FT                   /note="ORF_ID:bll0695"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45960"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45960"
FT                   /db_xref="GOA:Q89WJ2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WJ2"
FT                   /protein_id="BAC45960.1"
FT                   /translation="MRSAHLGEDTMSVVGIDTGFELGAAPSVPDEISRRLEAMPGSPYV
FT                   WRLVILLSLGGCFEIYDLFLTGYIAPGLSRSGLLSTTTQAFFGFAGIGAFVAATFAGLF
FT                   VGTFFLGFLADRFGRRAIFTYALLGYTAASVIMACQTSPEGLLFWRFLAGIGIGVEVIT
FT                   IDAYITELVPSRMRGRAFAVNQSIMFVAVPVVAFLAWWLVPLAPYGVEGWRWVVLIGAA
FT                   ASMIIWVLRLFLPESPLWLARHGRNEEALRILTTLEAASGGAGSRPATSPARQAVRSTT
FT                   NVSFADLFRPPYLSLVVLFMVFNLCQAFGFYGFANWVPTLLVEKGINVTKSLQYSFIVA
FT                   FAYPIAPLLASSFADKFERRWIIAGACVAIIVFGMAFAQLTEPALLIVCGVLLTACNTT
FT                   MSYAYHAYQTEVFPTQIRARASGLVYSMSRLSATFSGFIVAYMLKEGGVTGVFGLITAA
FT                   MLIVVIAMALFGPNVRGKPLDAV"
FT   CDS_pept        complement(743190..744122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0696"
FT                   /product="transcriptional regulatory protein"
FT                   /note="LysR family"
FT                   /note="ORF_ID:bll0696"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45961"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45961"
FT                   /db_xref="GOA:Q89WJ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WJ1"
FT                   /protein_id="BAC45961.1"
FT                   /translation="MDSRQLRYFIAVYEQRNLSRAADQVNVAQSALSHHISNLEAEFAT
FT                   PLFERKSRGMEPTAAGERLYEHARIILRAMAEAETEVREGARVIAGEISIGMANSGVKA
FT                   IGVELMRTVLTKYPKLKLSLTESLSGATLMHLMVSNVDLALVYNPPSEKELITEPVLEE
FT                   EMFLVGIPKLVGKGKAPIRFEELSRMPLILLRYGLGLSSRALLDDPVLLKRLEGGAILH
FT                   ANSITGMTGALVEGLGCTIATKLFAREELAAGRLIARKVIEPKLTRTLYLCRLRNRPMT
FT                   YAMEEMRRLMLAFIAEQVRSGGWQAELVG"
FT   CDS_pept        744229..745404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0697"
FT                   /note="ORF_ID:blr0697"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45962"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45962"
FT                   /db_xref="GOA:Q89WJ0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WJ0"
FT                   /protein_id="BAC45962.1"
FT                   /translation="MTEAGLPLEGVRIVEMTHMVMGPTCGMILAQLGAEVIKVEPPSGD
FT                   KTRSLGGMGTAFFPLFNRGKRSVVLDFEKPGDRDSMHRLLATADVFLENFRDGQLEKQG
FT                   LGAEELRRRHPHLIIAGHKGFLSGPYEHRPALDEVVQMMSGLAAMTGTKEKPQRVGSSA
FT                   NDIMGGMFGVIAILAALYQKRGGKRDGADIRIGLFENCLFLVAQHMVEYEMTGNKPRSM
FT                   PEREHAWPIYDIFDAADGERIFIGVVTEGHWQSFCREFGLTEFLEDPALRTTTDRILAR
FT                   PRILPRVAEIIRQRNVAELSQKLDALNICFSPINRPEDLLTDPHVLRPGGLVSNFTADG
FT                   KPFHVPALPVEWNGSHLGEGLKVAPLGADTSAVRAEIDKDDIASKAAGRPA"
FT   CDS_pept        745401..746348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0698"
FT                   /note="ORF_ID:blr0698"
FT                   /note="putative hydroxymethylglutaryl-CoA lyase (EC
FT                   4.1.3.4)"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45963"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45963"
FT                   /db_xref="GOA:Q89WI9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WI9"
FT                   /protein_id="BAC45963.1"
FT                   /translation="MSRIETIYPSDRVSLREVGLRDGLQLVKKFPSTEAKQRWVREEYA
FT                   AGVRHFEVGSFLPAKTFPQFVDVRDVIGAVANLPGAHGIALALNERGVNEALESGVGEI
FT                   ASVVSATEEHSQANAHRSRDSAIANVRRLCEMRDASSHKPLVNAAISMALGCSITGAVD
FT                   PAEVLRLVDKCLEAGVDFVAIADTVGYAGPKQVAELSRAAVKLAGQKPICIHLHDTRGM
FT                   GIANAAAALDEGVRILDGSLGGLGGCPFAPGATGNVVFEDLVFLCESKGFATGIDLEKL
FT                   VGVRRILRDEMPNETLYGGVARAGLPCGTVAKAA"
FT   CDS_pept        complement(746528..746974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nikR"
FT                   /product="nickel responsive regulator"
FT                   /note="ORF_ID:bll0699"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45964"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45964"
FT                   /db_xref="GOA:Q89WI8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014160"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WI8"
FT                   /protein_id="BAC45964.1"
FT                   /translation="MQRITITIEDDLLAEIDAAAAARGYQNRSEIIRDLARAGLQQTSE
FT                   DTAQTGPCVAGLVYVYDHAARDLSKRLVQEFHGHHDLALATLHVHLDDNNCMEMTALRG
FT                   AADEVRHFADHIIAERGVRYGRVVMIPTGEGKPAKARKHGHRHE"
FT   CDS_pept        complement(747183..749654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0700"
FT                   /product="heavy-metal transporting P-type ATPase"
FT                   /note="ORF_ID:bll0700"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45965"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45965"
FT                   /db_xref="GOA:Q89WI7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WI7"
FT                   /protein_id="BAC45965.1"
FT                   /translation="MEMSDAEHKHHHDADGHTGCGCSSKAATPPNEKPAAASCCGGHGD
FT                   HAGHAHHHAHDQGNAATKVLDPVCGMTVDPATSKHRFDHHGETFHFCSAGCRTKFAADP
FT                   AKYLAKEKASEPEMPAGTIYTCPMHPQIRQVGPGSCPICGMALEPEVASLEAGPNPELA
FT                   DMTRRFWIGGVLALPAVVLEMGGHLAGPHNWIDQTLSNWIQLVFATPVVLWAGWPFFVR
FT                   GWQSLVTRNLNMFTLIAMGTGVAYIYSVLGTVVPQIFPDTFRSHGGAVAIYFEAAAVIT
FT                   VLVLLGQVLELRARDATSGAIKALLQLAPKTARRVEADGSEHEVEIDTLHAGEHLRVRP
FT                   GEKVPVDGVILEGRSSLDESLVTGESMPVTKETGAKVIAGTLNQSGSFIMRADKVGRET
FT                   LLSQIVQMVADAQRSRAPIQRLADQVAGWFVPAVIVVALAAFAAWAWFGPEPRLAFGLV
FT                   AAVSVLIIACPCALGLATPMSIMVGVGRGAQAGVLIKNAESLERMEKIDTLVVDKTGTL
FT                   TEGKPKVVAIVPASGFADDDILRWAASVERASEHPLADAIVRAAKEKQLTLGQVEAFDS
FT                   PTGKGATGKVDGKTIVLGNARYLSSIGIDTKALDTEAERLRGDGATVINMAVDGRLAGL
FT                   FAIADPVKASTPEALKALAAEGIKVIMLTGDNRTTAQAVARRLGIAEVEAEVLPDQKSA
FT                   VVTKLQKAGRSVAMAGDGVNDAPALAAAEVGIAMGTGTDVAMESAGVTLLKGDLTGIVR
FT                   ARKLSQATMSNIRQNLFFAFIYNAAGIPIAAGILYPNFGVLLSPIIAAAAMALSSVSVV
FT                   GNALRLRATRL"
FT   CDS_pept        749723..749998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsr0701"
FT                   /note="ORF_ID:bsr0701"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45966"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45966"
FT                   /db_xref="GOA:Q89WI6"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WI6"
FT                   /protein_id="BAC45966.1"
FT                   /translation="MRKDIKTSVGKRLGRIEGQVRGLSKMVEEDRYCIDIVTQISAVRA
FT                   ALRRVEEEVLKDHVAHCVEHAITSGDKADQRAKIAELMAVIGRAER"
FT   CDS_pept        complement(750178..751161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0702"
FT                   /note="ORF_ID:bll0702"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45967"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45967"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WI5"
FT                   /protein_id="BAC45967.1"
FT                   /translation="MGTVLDSVGKLIAAYLSKEVPGYEPFTPSDPEHLRGVIEPGDVLL
FT                   VEGNNRISGIIKYLTQSTWSHAALYVGPIEGAEEPSGEPHVLIEANIGEGVTSAPLSKY
FT                   FPYHTRVCRPVGLSHEDRTTVCRYAINRIGFGYDTKNIVDLMRFLFPLPIPQRWRRRMI
FT                   AIGSGDPTKIICSALIAQAFDAVRYPILPKITKAGSRAARREILHIRDSSLYMPRDFDI
FT                   SPYFEVVKPTIVHGFDYTTLHWADKQKPLEEVAGTFSVFPETISAPPLVPEAADEEAPD
FT                   EIPAEQVSAQPAEMVECAAAAAHVSLLKKLAMYRPRRRRRAREIAA"
FT   CDS_pept        751354..752742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0703"
FT                   /note="ORF_ID:blr0703"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45968"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45968"
FT                   /db_xref="GOA:Q89WI4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WI4"
FT                   /protein_id="BAC45968.1"
FT                   /translation="MTITRRGFLSASAAFAAMPVLRATAAPLPREADIVVIGAGAAGIA
FT                   AARRIMAANRKVVVVEAASQIGGRCITDTTTFDVPFDRGARWMHNPETNPMIRLARSAG
FT                   LDVLPAPSGQKMRIGRRNARAGETEEFLAALVRANRAIDEAARGKLDTSCASVLPKDLG
FT                   DWAGAAEFMLGASFAGKDLKELSAIDKARAQDRNAAIACRQGLGTLITKLGEQAPVALS
FT                   TPASRISWSNRDVSVETQGGKIAARAAIVTVSTNVLTAGAIKFAPDIPKRTLDAASKLS
FT                   LGSYDHIVLQLPGNPLGLARDDILIEQSNSTRTALLFANIGGSSLCSIDVGGSFGRDLS
FT                   EQGEKAMAAFAKEWIAKLFGSEAAAIVQKTSATRWNASPFVMGAMSASSPGGQLSRKIL
FT                   TEPIGNLFLAGEATHETLWGTVDGAWESGERAADAALRKIGALKDEPADVPTQSTKKRR
FT                   APRQ"
FT   CDS_pept        complement(752910..753680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0704"
FT                   /note="ORF_ID:bll0704"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45969"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45969"
FT                   /db_xref="GOA:Q89WI3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WI3"
FT                   /protein_id="BAC45969.1"
FT                   /translation="MSLTDFLPKDVSFTIAMALCAVAFVSGTARGFSGFGSALIFMPLA
FT                   SSFAAPRLVAALLLVIDFVAALPLLPDAWRKADRKATAVIVLGALIGVPIGTYFLSVLE
FT                   PVTTRWIISSFVAALLLLLLSGWRYRGEDHAWLSVGIGGLSGFCSGLAQTGGPPIVGYW
FT                   LGRPIASIVARANILLFFGASDFFSMVSYATTGLISRESLMLSLIVGPVYAIGVAFGAS
FT                   LFGRASEKVFRGICYVLIAMAVVFGLPALDGILR"
FT   CDS_pept        complement(753734..756142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /product="phenylalanyl-tRNA synthetase beta chain"
FT                   /note="ORF_ID:bll0705"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45970"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45970"
FT                   /db_xref="GOA:Q89WI2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WI2"
FT                   /protein_id="BAC45970.1"
FT                   /translation="MKFTLSWLKDHLETDEPLDRLAEKLTMIGLEVENIEDKAKALKPF
FT                   TIARVISAEQHPNADRLRVCMVDTGDGGAPVQVVCGAPNARAGLVSVFSAPGTYIPGKD
FT                   ITLGVGTIRGVESRGMLCSAAELQISNDHDGIMELPADAPIGAAYAEWAALGDPVVEIN
FT                   LTPNRQDCTGVHGIARDLAAADMGKFKDPTIKPVKGEFPCPVKVTVEDATLCPGFALRL
FT                   VRGVKNGPSPEWLQKRLTAIGLRPINALVDITNFMTYDRARPLHVFDARKVKGNLVVRR
FT                   ARDGETLLALDGRTYNLDPATCVIADEHGVESLAGIMGGEASGCDENTTDVLIESALWN
FT                   EINIAQTGRKLGINSDARYRFERGVDPAFMVPGLELATKLVMEMCGGAPSENVVVGKAF
FT                   GDDRVIDFPVTEVKRLSGIEVPQPEMKRILTHLGFMMAGPGPVVKVAVPSWRTDVHGKA
FT                   DIVEEIVRIYGVDKVPMTPFERGDDARKPVLTPLQLRTRRARRALASRGIIEAVTWSFI
FT                   TKSAAKLFGGGQRELEVANPIASDLSDMRPTLLAGLIAAAQANADRGFGDVALFEVGQV
FT                   FKGDRPQDQFMAASGVRRGFASSEGLGRHWSGSVQADLFDAKADALAVLAAAGAPMQAL
FT                   QIVAGGPGWLHPGRSGTIQIGPQNVLGYFGEMHPRALEALGADGPLMVFEVILDRVPEA
FT                   KKRPTRAKPLIELSAFQPVSRDFAFIVDRTVKAGDIVRAAQGVDKKLITGVNVFDVYEG
FT                   KGIDDGKKSIAIAVTIQPREKTLTDQEIEAVAAKVVAEVTKKTGGTLRA"
FT   CDS_pept        complement(756139..757221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /product="phenylalanyl-tRNA synthetase alpha chain"
FT                   /note="ORF_ID:bll0706"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45971"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45971"
FT                   /db_xref="GOA:Q89WI1"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WI1"
FT                   /protein_id="BAC45971.1"
FT                   /translation="MSDLATLETSILDQVAAAGDEAALEAVRVAALGKKGSISALLATL
FT                   GKMSPDDRKTQGAAINQAKDKVTEALAARRDVLKSAALDARLASETIDVTLPLREAPTD
FT                   AGRIHPLSQVWDELTTIFADMGFSVAEGPDIETDDYNFTKLNFPEGHPAREMHDTFFFH
FT                   PKEDGSRMLLRTHTSPVQVRTMLSQKPPIRVICPGRTYRIDSDATHTPQFHQVEGLVID
FT                   KHSHLGHLKWILHEFCKAFFEVDHINMRFRPSFFPFTEPSLEVDIQCRRDKGEIRFGEG
FT                   EDWLEILGCGMVHPNVLRACGIDPDEYQGFAWGMGIDRIAMLKYGIADLRQLFDSDVRW
FT                   LSHYGFKPLEVPTLAGGLSS"
FT   CDS_pept        complement(757818..758177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /product="50S ribosomal protein L20"
FT                   /note="ORF_ID:bll0707"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45972"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45972"
FT                   /db_xref="GOA:Q89WI0"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WI0"
FT                   /protein_id="BAC45972.1"
FT                   /translation="MSRVKRGVTAHAKHKKVYKAAKGFYGRRKNTIRAAKPAVEKAQQY
FT                   AFRDRKRKKRTFRALWIQRLNAAVRPFGLTYSRFIDGLAKSGITVDRKVLSDLAINEPA
FT                   SFQAIAEKAKAALAA"
FT   CDS_pept        complement(758258..758458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /product="50S ribosomal protein L35"
FT                   /note="ORF_ID:bsl0708"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45973"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45973"
FT                   /db_xref="GOA:Q89WH9"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WH9"
FT                   /protein_id="BAC45973.1"
FT                   /translation="MPKLKTKSGAKKRFKVTATGKVMHAQRGKRHGMIKRTKKQIRQLR
FT                   GTRVLFKTDGDNVKKYFLPNA"
FT   CDS_pept        758651..759139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0709"
FT                   /note="ORF_ID:blr0709"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45974"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45974"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WH8"
FT                   /protein_id="BAC45974.1"
FT                   /translation="MNRRNPPADYPELLSSCPSRVAWSRTKMAHFSQLIPQFVPQFTRP
FT                   RRLALLAVLAAAALPSTADARAGGYDGIWNVTFATTRGNCSSGYSVPFTVTGGRVSSAG
FT                   GGRVSGRVKRSGMVAVYVSVGASHASGGGRLAGVNGAGSWRGIISGDQCSGTWHATRS"
FT   CDS_pept        complement(759202..759741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0710"
FT                   /product="translation initiation factor IF-3"
FT                   /note="ORF_ID:bll0710"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45975"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45975"
FT                   /db_xref="GOA:Q89WH7"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WH7"
FT                   /protein_id="BAC45975.1"
FT                   /translation="MRRPNKAPPAASKDGPRINDDIRNAQIQLIDQTGDNKGTVETVVA
FT                   IKMAQEAGMDLVEISPNTSPPVCKIMDYGKYKYSAQKKAAEARKRQKTVEIKEIKLRPM
FT                   IDDHDYDVKMRAMQRFFEEGDKVKITLRYRGREMAHQEIGTKLLDKIKTDVAELAKVEQ
FT                   DARFEGRQVVMVLAPR"
FT   CDS_pept        759991..760803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0711"
FT                   /note="ORF_ID:blr0711"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45976"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45976"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WH6"
FT                   /protein_id="BAC45976.1"
FT                   /translation="MTDAIPDTVLDFIDVGEGASARRIAVRRRAGKGPGLVWLGGFKSD
FT                   MQGSKALALDAWAGDHGRAAVRFDYSGHGESGGDFADGTIGRWLEESVAVFERFCDGPQ
FT                   ILIGSSMGGWMALLLAREIRKRQENRQENQQESASLAGLVLIAPAPDFTEELMWKNFPA
FT                   AVKKEIETKGVWLRPSEYGDGSPYPITRNLIEEGRNHLVLGGAIDLGCPVRILQGAQDP
FT                   DVPWQHAFALTHRLPADDVVLTLIQDGDHRLSRPQDIARILAAVAEIG"
FT   CDS_pept        760944..761426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0712"
FT                   /note="ORF_ID:blr0712"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45977"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45977"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WH5"
FT                   /protein_id="BAC45977.1"
FT                   /translation="MGEAPMTTTAMLRAFCDAVEQRNGRAFADLFIKDGVYHDVFYGAF
FT                   AGREKIAAMIDDWFYRTATDFRWDMHDPVTDGTTLYARYTFSYRSTLPEASGARAMFEG
FT                   VAVMTLKGGRIASYHEVANTAPAFVDLKFAPERIAKIVTRQGAELKARPEMKRHLA"
FT   CDS_pept        complement(761574..762536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0713"
FT                   /note="ORF_ID:bll0713"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45978"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45978"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WH4"
FT                   /protein_id="BAC45978.1"
FT                   /translation="MSCPAKAGHPVRRGLSIEPQPSRSTGSPAFAGDDSGERGERAPLI
FT                   SPRVPSRSRVMTDMPFFTRDGDTFHPTEVANGPWDPKSLHGRVIVGLLGFAIEERHSGP
FT                   EFVPARLTVDMFRLPTIDKPIEVTTRLVRDGLRIRVVEAEFVSGGVGMARASCQLLRKT
FT                   QNPDGNVWSPPNWDVPKPADIPKPTDPRLGMHGKWTTRPIVGHMGSLGPRRLWMSEVRE
FT                   LVAGVPMTPFVHVAVGADFASPFANAGDQGLGYINSDVTIYLHRLPVTNWIGFDVVNHQ
FT                   ATDGVAIGECWLYDEQGPIGTATVAALAQRKPMANPSKR"
FT   CDS_pept        complement(762543..763721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0714"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="ORF_ID:bll0714"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45979"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45979"
FT                   /db_xref="GOA:Q89WH3"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WH3"
FT                   /protein_id="BAC45979.1"
FT                   /translation="MARRRAGVADLCGPGFLSSADLSELKAKLTTEAKALGFDCIGVTE
FT                   PGTIETAGKHFLEFIASGGHGDMDWLAAQPERRVDPRGLWQDVRSVIMLGVNYGPDADP
FT                   LAILEQRTRAAISVYAQGDDYHDLVKKRLKALARWLVAAAPSEVKVFVDTAAVMEKPLA
FT                   QAAHLGWQGKHTNLVSREFGSWLFLGAIYTTLDLPRDAAEIDHCGSCQACLDICPTAAF
FT                   PAPYKLDARRCISYLTIENKGAIPREFRKAIGNRIYGCDDCLAACPWNKFAQAGREAKL
FT                   AARDELRAPGLAELARLDDAAFRALFTKSPVKRIGRDRFLRNVLIAIGNSGEAALAEEA
FT                   RRLLGDESALVRGAAVWALAQLVARDAFEAMRSVAMGNEHDEGVREEWDLAT"
FT   CDS_pept        complement(763670..764362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0715"
FT                   /product="glutathione S-transferase"
FT                   /note="ORF_ID:bll0715"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45980"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45980"
FT                   /db_xref="GOA:Q89WH2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WH2"
FT                   /protein_id="BAC45980.1"
FT                   /translation="MFTLFHHPFCPHSRFIRLIAGEYGLDLKLVEERSWERREAFLLLN
FT                   AAGTTPVLVDEEQPPIPGAAIIAEYVDEAYGAGMGPKRLMPETLPERVEVRRLMAWFNE
FT                   KFFEEVSHPLVTERIYKRFMSEENGGGAPSADVMRAAKANVRYHLAYIGWLAQTRNFLA
FT                   GDRLTYADLAAAAHLSAIDYLGDVPWSEDDAAKAWYARVKSRPSFRPLLSEWLAGVPAS
FT                   RTYVDLDF"
FT   CDS_pept        764532..765338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0716"
FT                   /note="ORF_ID:blr0716"
FT                   /note="putative undecaprenol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45981"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45981"
FT                   /db_xref="GOA:Q89WH1"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q89WH1"
FT                   /protein_id="BAC45981.1"
FT                   /translation="MSDAIRAVILGIIEGVTEFLPVSSTGHLLLAERFFHLGEGAFWDS
FT                   FTVLIQLGAILAIVGLYFKKLWDVVIGFFTGDTYSRRFVIGVLVAFLPAVVVGLVAGKY
FT                   IKSVLFNPWVVCFTLIVGGAILLWVDKLDLKPREHDATRFPLLMYLYIGIAQCVAMIPG
FT                   VSRSGASIVAAMLLGADKRAAAEFSFFLAIPTMIGAFAYDFYKNRSEMTMDHMGIVAIG
FT                   FVVSFITAVIVVKTFLTYVTRHGFVVFAWWRVIVGTLGLIALALGR"
FT   CDS_pept        complement(765559..766524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0717"
FT                   /product="oxidoreductase"
FT                   /note="ORF_ID:bll0717"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45982"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45982"
FT                   /db_xref="GOA:Q89WH0"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WH0"
FT                   /protein_id="BAC45982.1"
FT                   /translation="MASNLETLVTVFGGSGFLGRNVVRALCKRDYRVRVAVRRPELAGY
FT                   LQPSGKVGQVHVVQANLRYPASVEAALRDSDVVINLVGILTESGKQSFDAVQAKGAETV
FT                   AKAAAAVGARLVHVSAIGADAESPSRYAKAKAAGEAAVLAAVPSATIFRPSVMFGPEDQ
FT                   FTNRFAALARMSPVLPLIGGETKMQPVYVGDVATAIADAVDGKAKAGATYELGGPEVLT
FT                   MREIIEAILEITARKPTLVPLPFGLARFQANFLQFAPGAFKLTPDQVTLLQRDNVVSDA
FT                   AKAAGLTLEGLGITADSLEAIAPQYLWRFRAAGQFQRMSI"
FT   tRNA            766675..766761
FT                   /product="trnL-CAG"
FT   CDS_pept        complement(766848..768119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0718"
FT                   /note="ORF_ID:bll0718"
FT                   /note="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45983"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45983"
FT                   /db_xref="GOA:Q89WG9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WG9"
FT                   /protein_id="BAC45983.1"
FT                   /translation="MTEQTLAAPIDDQQDRQRGFSRYQALLIALLAFTQFTIILDFIIM
FT                   SPLGAILMPALDITATQFGVAVSAYAFSAGLSGILAAGFADRFDRKRLLLFFYVGFTLG
FT                   TLLCAMAQTYHVLLLGRIVTGLFGGVIGSVVLAIITDLFPLHLRGRVMGFVQTAFAASQ
FT                   VLGIPAGLFLANHWNWHVCFAAIVGLSIAAIAIIAFAMEPVDAHLRLKQDRNPFHHLIA
FT                   TVAQKRYTLAFAVTTLLATGGYMLMPFSSAYTVNNLGIDMLHLPTIYLVSGLFSIVTGP
FT                   LVGRASDAFGKYPTFVFGSVVSVIMVLIYTHLGHVSLATAILVNVLMFVGIFSRMIPSQ
FT                   ALMSAIPDPSQRGSFSAISASLQQLSGGLGSMLAGAIIAQAPDGSLIHFDRIGYVVVAS
FT                   AIVSLVAMYFVQKAVAERAGKRVV"
FT   CDS_pept        768465..769079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0719"
FT                   /note="ORF_ID:blr0719"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45984"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45984"
FT                   /db_xref="GOA:Q89WG8"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WG8"
FT                   /protein_id="BAC45984.1"
FT                   /translation="MTVRLHRGDLPDLSRYTGAVAIDTETMGLNPHRDRLCVVQLSPGD
FT                   GSADVVQIPKGHTDAPNLKALLANPAITKIFHFARFDVAVLYQSFGVMTGPIYCTKIAS
FT                   RLTRTYTDRHGLKDLVREVLNVDLSKQQQSSDWGSDSLTEPQLAYAASDVLHLHALRER
FT                   LDAMLVREGRTGLAKACFDFLPTRALLDLQGWAEEDIFAHS"
FT   CDS_pept        769224..769958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0720"
FT                   /note="ORF_ID:blr0720"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45985"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45985"
FT                   /db_xref="GOA:Q89WG7"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WG7"
FT                   /protein_id="BAC45985.1"
FT                   /translation="MNSAQNPTYDAALAAKFASAARHSRLVRILRVAVPGAVLLSLAAI
FT                   VGVSIFNPFRMLLPKLPLDSGNLVVSGTKITMESPHLAGYTPDRRPYELWAKTATQDIT
FT                   DPDHVDLSDLRAKVLMEDQSTLFLDARTGRFDNKQQQLDLHKDIFLRTSTGYEARLNSA
FT                   FVDMGKGTVSSDERVDVKLTNGTLTADRLRITEGGDLIRFEGNVVMHLDKLDDPAAAQP
FT                   APAEPTPPVKTRTPQNKSANSK"
FT   CDS_pept        769955..770674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0721"
FT                   /note="ORF_ID:blr0721"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45986"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45986"
FT                   /db_xref="GOA:Q89WG6"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WG6"
FT                   /protein_id="BAC45986.1"
FT                   /translation="MIFMIRFFPRNDSKRCAAIGAAALAATVALMAMGAAIAQSTMQGV
FT                   PNAMQGFSQNRDQPIQIEAASLEMRDKKKEATFAGNVKVIQGDTTMTSKTLVVFYESGG
FT                   DKPATPQPAAKGAKAAPMQSATPGPGGSSSIKRLEARGNVVVTQKDQVVTGDTAVFDTK
FT                   TNLITMLGGTGQVVLTQCKNVLQGDRLVVDMTTGVSRVESDSGKVRGLFDQNSKCGTQA
FT                   GPGSGPALQLPGATKPK"
FT   CDS_pept        770896..771894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0722"
FT                   /note="ORF_ID:blr0722"
FT                   /note="probable ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45987"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45987"
FT                   /db_xref="GOA:Q89WG5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q89WG5"
FT                   /protein_id="BAC45987.1"
FT                   /translation="MVDLFSMFRRRPAKRGRPGFARQDITALGDSVGGLVASPVRDAPP
FT                   IARDQPMHAPDHFQADYQTEPPRAQAVHPVRAAARPNGAGGPQLLKRPGFLAVHSVEKA
FT                   FGSRQVVRGVSIYVRRGEAVGLLGPNGAGKTTVFYMITGLIKADRGAIELDGHDVTKLP
FT                   MYQRARLGIGYLPQEASIFRGLTVEQNIRAVLEVVEPSRKKREQQLDSLLDEFNITRLR
FT                   KSPSIALSGGERRRVEIARALATRPNYMLLDEPFAGIDPIAVGDIQDLVRHLTNRGIGV
FT                   LITDHNVRETLGLTDRAYIVYAGEILTEGSPDEIVADPDVRRLYLGEEFRL"
FT   CDS_pept        771986..773599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN2"
FT                   /product="RNA polymerase sigma-54 subunit"
FT                   /note="ORF_ID:blr0723"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45988"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45988"
FT                   /db_xref="GOA:P30333"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30333"
FT                   /protein_id="BAC45988.1"
FT                   /translation="MALTQRLEFRQSQSLVMTPQLMQAIKLLQLSNLDLTTFVEEELER
FT                   NPLLERANDEASGGEAPAEAGQFSDSDGGHNDEPGGGPGEAFEPGQEEWMSKDLGTRAE
FT                   IEQTLDTGLDNVFSEEPAEAAARNAQDAAPTTYTEWGGGASGDEDYNLEAFVAAEVTLG
FT                   DHLAEQLSVAFTAPAQRMIGQYLIDLVDEAGYLPPDLGQAAERLGASQQEVEDVLAVLQ
FT                   KFDPPGVCARNLSECLAIQLRELDRYDPAMQALVEHLDLLAKRDIAGLRKVCGVDDEDI
FT                   ADMIGEIRRLNPKPGMKFGAARLQTMVPDVYVRPGPDGGWHVELNSDTLPRVLVNQTYY
FT                   SELSKKIGKDGDKSYFTDALQNATWLVRALDQRARTILKVATEIVRQQDGFFTHGVAHL
FT                   RPLNLKAVADAIQMHESTVSRVTANKYMATNRGTFELKYFFTASIASADGGEAHSAEAV
FT                   RHHIKQLIDSEAPAAILSDDTIVERLRASGIDIARRTVAKYREAMRIPSSVQRRRDKQS
FT                   ALGNVLSTAMSDRSRNPEPA"
FT   CDS_pept        773756..774367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blr0724"
FT                   /product="sigma-54 modulation protein"
FT                   /note="ORF_ID:blr0724"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45989"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45989"
FT                   /db_xref="GOA:P30334"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30334"
FT                   /protein_id="BAC45989.1"
FT                   /translation="MTLRISGKSVSVGEALRGRVSDRTEEVLRKYFDGNYSGHITLSKD
FT                   GFGFRTDCALHLDSGITLEADSNAPDAYASADQALVMIEKRLKRYKSRLKDRSARKAHV
FT                   ASAALAAMDATSYVLEAPGEGEDEDEVTGYSPVIIAEATTSLKQLSVSEAVMELDLSGA
FT                   PCLVFQHGSSGRVNIIYRRADGNVGWVDPPGGKADGKAGG"
FT   CDS_pept        774590..775051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /product="nitrogen regulatory IIA protein"
FT                   /note="ORF_ID:blr0725"
FT                   /db_xref="EnsemblGenomes-Gn:BAC45990"
FT                   /db_xref="EnsemblGenomes-Tr:BAC45990"
FT                   /db_xref="GOA:P30335"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30335"
FT                   /protein_id="BAC45990.1"
FT                   /translation="MPITDLVAPEAILPALKVNSKKQALQELAAKAAELTGQNERAVFE
FT                   VLLQREKLGTTAVGYGVAIPHGKLPKLEKIFGLFARLDRPIDFESMDGQPVDLVFLLLA
FT                   PEGAGADHLKALARIARLLRDQDIAKKLRASRDAQAIYSVLALPPATAA"
FT   CDS_pept        complement(775081..775587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bll0726"
FT                   /note="