(data stored in ACNUC7421 zone)

EMBL: BA000043

ID   BA000043; SV 1; circular; genomic DNA; STD; PRO; 3544776 BP.
XX
AC   BA000043; AP006508-AP006519;
XX
PR   Project:PRJNA13233;
XX
DT   06-DEC-2004 (Rel. 82, Created)
DT   10-OCT-2016 (Rel. 130, Last updated, Version 7)
XX
DE   Geobacillus kaustophilus HTA426 DNA, complete genome.
XX
KW   .
XX
OS   Geobacillus kaustophilus HTA426
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus;
OC   Geobacillus thermoleovorans group.
XX
RN   [1]
RP   1-3544776
RA   Takami H., Takaki Y., Chee G.;
RT   ;
RL   Submitted (25-JUN-2003) to the INSDC.
RL   Contact:Hideto Takami Japan Marine Science and Technology Center, Microbial
RL   Genome Analysis Research Group; 2-15 Natsushima-cho, Yokosuka, Kanagawa
RL   237-0061, Japan URL    :http://www.jamstec.go.jp/jamstec-e/bio/exbase.html
XX
RN   [2]
RX   DOI; 10.1093/nar/gkh970.
RX   PUBMED; 15576355.
RA   Takami H., Takaki Y., Chee G.J., Nishi S., Shimamura S., Suzuki H.,
RA   Matsui S., Uchiyama I.;
RT   "Thermoadaptation trait revealed by the genome sequence of thermophilic
RT   Geobacillus kaustophilus";
RL   Nucleic Acids Res. 32(21):6292-6303(2004).
XX
DR   MD5; 0e50f5f1586378caf7b5378298b81c89.
DR   BioSample; SAMD00061072.
DR   EnsemblGenomes-Gn; EBG00000006281.
DR   EnsemblGenomes-Gn; EBG00000006282.
DR   EnsemblGenomes-Gn; EBG00000006283.
DR   EnsemblGenomes-Gn; EBG00000006284.
DR   EnsemblGenomes-Gn; EBG00000006285.
DR   EnsemblGenomes-Gn; EBG00000006286.
DR   EnsemblGenomes-Gn; EBG00000006287.
DR   EnsemblGenomes-Gn; EBG00000006288.
DR   EnsemblGenomes-Gn; EBG00000006289.
DR   EnsemblGenomes-Gn; EBG00000006290.
DR   EnsemblGenomes-Gn; EBG00000006291.
DR   EnsemblGenomes-Gn; EBG00000006292.
DR   EnsemblGenomes-Gn; EBG00000006293.
DR   EnsemblGenomes-Gn; EBG00000006294.
DR   EnsemblGenomes-Gn; EBG00000006295.
DR   EnsemblGenomes-Gn; EBG00000006296.
DR   EnsemblGenomes-Gn; EBG00000006297.
DR   EnsemblGenomes-Gn; EBG00000006298.
DR   EnsemblGenomes-Gn; EBG00000006299.
DR   EnsemblGenomes-Gn; EBG00000006300.
DR   EnsemblGenomes-Gn; EBG00000006301.
DR   EnsemblGenomes-Gn; EBG00000006302.
DR   EnsemblGenomes-Gn; EBG00000006303.
DR   EnsemblGenomes-Gn; EBG00000006304.
DR   EnsemblGenomes-Gn; EBG00000006305.
DR   EnsemblGenomes-Gn; EBG00000006306.
DR   EnsemblGenomes-Gn; EBG00000006307.
DR   EnsemblGenomes-Gn; EBG00000006308.
DR   EnsemblGenomes-Gn; EBG00000006309.
DR   EnsemblGenomes-Gn; EBG00000006310.
DR   EnsemblGenomes-Gn; EBG00000006311.
DR   EnsemblGenomes-Gn; EBG00000006312.
DR   EnsemblGenomes-Gn; EBG00000006313.
DR   EnsemblGenomes-Gn; EBG00000006314.
DR   EnsemblGenomes-Gn; EBG00000006315.
DR   EnsemblGenomes-Gn; EBG00000006316.
DR   EnsemblGenomes-Gn; EBG00000006317.
DR   EnsemblGenomes-Gn; EBG00000006318.
DR   EnsemblGenomes-Gn; EBG00000006319.
DR   EnsemblGenomes-Gn; EBG00000006320.
DR   EnsemblGenomes-Gn; EBG00000006321.
DR   EnsemblGenomes-Gn; EBG00000006322.
DR   EnsemblGenomes-Gn; EBG00000006323.
DR   EnsemblGenomes-Gn; EBG00000006324.
DR   EnsemblGenomes-Gn; EBG00000006325.
DR   EnsemblGenomes-Gn; EBG00000006326.
DR   EnsemblGenomes-Gn; EBG00000006327.
DR   EnsemblGenomes-Gn; EBG00000006328.
DR   EnsemblGenomes-Gn; EBG00000006329.
DR   EnsemblGenomes-Gn; EBG00000006330.
DR   EnsemblGenomes-Gn; EBG00000006331.
DR   EnsemblGenomes-Gn; EBG00000006332.
DR   EnsemblGenomes-Gn; EBG00000006333.
DR   EnsemblGenomes-Gn; EBG00000006334.
DR   EnsemblGenomes-Gn; EBG00000006335.
DR   EnsemblGenomes-Gn; EBG00000006336.
DR   EnsemblGenomes-Gn; EBG00000006337.
DR   EnsemblGenomes-Gn; EBG00000006338.
DR   EnsemblGenomes-Gn; EBG00000006339.
DR   EnsemblGenomes-Gn; EBG00000006340.
DR   EnsemblGenomes-Gn; EBG00000006341.
DR   EnsemblGenomes-Gn; EBG00000006342.
DR   EnsemblGenomes-Gn; EBG00000006343.
DR   EnsemblGenomes-Gn; EBG00000006344.
DR   EnsemblGenomes-Gn; EBG00000006345.
DR   EnsemblGenomes-Gn; EBG00000006346.
DR   EnsemblGenomes-Gn; EBG00000006347.
DR   EnsemblGenomes-Gn; EBG00000006348.
DR   EnsemblGenomes-Gn; EBG00000006349.
DR   EnsemblGenomes-Gn; EBG00000006350.
DR   EnsemblGenomes-Gn; EBG00000006351.
DR   EnsemblGenomes-Gn; EBG00000006352.
DR   EnsemblGenomes-Gn; EBG00000006353.
DR   EnsemblGenomes-Gn; EBG00000006354.
DR   EnsemblGenomes-Gn; EBG00000006355.
DR   EnsemblGenomes-Gn; EBG00000006356.
DR   EnsemblGenomes-Gn; EBG00000006357.
DR   EnsemblGenomes-Gn; EBG00000006358.
DR   EnsemblGenomes-Gn; EBG00000006359.
DR   EnsemblGenomes-Gn; EBG00000006360.
DR   EnsemblGenomes-Gn; EBG00000006361.
DR   EnsemblGenomes-Gn; EBG00000006362.
DR   EnsemblGenomes-Gn; EBG00000006363.
DR   EnsemblGenomes-Gn; EBG00000006364.
DR   EnsemblGenomes-Gn; EBG00000006365.
DR   EnsemblGenomes-Gn; EBG00000006366.
DR   EnsemblGenomes-Gn; EBG00000006367.
DR   EnsemblGenomes-Gn; EBG00000006368.
DR   EnsemblGenomes-Gn; EBG00000006369.
DR   EnsemblGenomes-Gn; EBG00000006370.
DR   EnsemblGenomes-Gn; EBG00000006371.
DR   EnsemblGenomes-Gn; EBG00000006372.
DR   EnsemblGenomes-Gn; EBG00000006373.
DR   EnsemblGenomes-Gn; EBG00000006374.
DR   EnsemblGenomes-Gn; EBG00000006375.
DR   EnsemblGenomes-Gn; EBG00000006376.
DR   EnsemblGenomes-Gn; EBG00000006377.
DR   EnsemblGenomes-Gn; EBG00000006378.
DR   EnsemblGenomes-Gn; EBG00000006379.
DR   EnsemblGenomes-Gn; EBG00000006380.
DR   EnsemblGenomes-Gn; EBG00000006381.
DR   EnsemblGenomes-Gn; EBG00000006382.
DR   EnsemblGenomes-Gn; EBG00000006383.
DR   EnsemblGenomes-Gn; EBG00000006384.
DR   EnsemblGenomes-Gn; EBG00000006385.
DR   EnsemblGenomes-Gn; EBG00000006386.
DR   EnsemblGenomes-Gn; EBG00000006387.
DR   EnsemblGenomes-Gn; EBG00000006388.
DR   EnsemblGenomes-Gn; EBG00000006389.
DR   EnsemblGenomes-Gn; EBG00000006390.
DR   EnsemblGenomes-Gn; EBG00000006391.
DR   EnsemblGenomes-Gn; EBG00000006392.
DR   EnsemblGenomes-Gn; EBG00000006393.
DR   EnsemblGenomes-Gn; EBG00000006394.
DR   EnsemblGenomes-Gn; EBG00001443922.
DR   EnsemblGenomes-Gn; EBG00001443923.
DR   EnsemblGenomes-Gn; EBG00001443924.
DR   EnsemblGenomes-Gn; EBG00001443925.
DR   EnsemblGenomes-Gn; EBG00001443926.
DR   EnsemblGenomes-Gn; EBG00001443927.
DR   EnsemblGenomes-Gn; EBG00001443928.
DR   EnsemblGenomes-Gn; EBG00001443929.
DR   EnsemblGenomes-Gn; EBG00001443930.
DR   EnsemblGenomes-Gn; EBG00001443931.
DR   EnsemblGenomes-Gn; EBG00001443932.
DR   EnsemblGenomes-Gn; EBG00001443933.
DR   EnsemblGenomes-Gn; EBG00001443934.
DR   EnsemblGenomes-Gn; EBG00001443935.
DR   EnsemblGenomes-Gn; EBG00001443936.
DR   EnsemblGenomes-Gn; EBG00001443937.
DR   EnsemblGenomes-Gn; EBG00001443938.
DR   EnsemblGenomes-Gn; EBG00001443939.
DR   EnsemblGenomes-Gn; EBG00001443940.
DR   EnsemblGenomes-Gn; EBG00001443941.
DR   EnsemblGenomes-Gn; EBG00001443942.
DR   EnsemblGenomes-Gn; EBG00001443943.
DR   EnsemblGenomes-Gn; EBG00001443944.
DR   EnsemblGenomes-Gn; EBG00001443945.
DR   EnsemblGenomes-Gn; EBG00001443946.
DR   EnsemblGenomes-Gn; EBG00001443947.
DR   EnsemblGenomes-Gn; EBG00001443948.
DR   EnsemblGenomes-Gn; EBG00001443949.
DR   EnsemblGenomes-Gn; EBG00001443950.
DR   EnsemblGenomes-Gn; EBG00001443951.
DR   EnsemblGenomes-Gn; EBG00001443952.
DR   EnsemblGenomes-Gn; EBG00001443953.
DR   EnsemblGenomes-Gn; EBG00001443954.
DR   EnsemblGenomes-Gn; EBG00001443955.
DR   EnsemblGenomes-Gn; EBG00001443956.
DR   EnsemblGenomes-Gn; EBG00001443957.
DR   EnsemblGenomes-Gn; EBG00001443958.
DR   EnsemblGenomes-Gn; EBG00001443959.
DR   EnsemblGenomes-Gn; EBG00001443960.
DR   EnsemblGenomes-Gn; EBG00001443961.
DR   EnsemblGenomes-Gn; EBG00001443962.
DR   EnsemblGenomes-Gn; EBG00001443963.
DR   EnsemblGenomes-Gn; EBG00001443964.
DR   EnsemblGenomes-Gn; EBG00001443965.
DR   EnsemblGenomes-Gn; EBG00001443966.
DR   EnsemblGenomes-Gn; EBG00001443967.
DR   EnsemblGenomes-Gn; EBG00001443968.
DR   EnsemblGenomes-Gn; EBG00001443969.
DR   EnsemblGenomes-Gn; EBG00001443970.
DR   EnsemblGenomes-Gn; EBG00001443971.
DR   EnsemblGenomes-Gn; EBG00001443972.
DR   EnsemblGenomes-Gn; EBG00001443973.
DR   EnsemblGenomes-Gn; EBG00001443974.
DR   EnsemblGenomes-Gn; EBG00001443975.
DR   EnsemblGenomes-Gn; EBG00001443976.
DR   EnsemblGenomes-Gn; EBG00001443977.
DR   EnsemblGenomes-Gn; EBG00001443978.
DR   EnsemblGenomes-Gn; EBG00001443979.
DR   EnsemblGenomes-Gn; EBG00001443980.
DR   EnsemblGenomes-Gn; EBG00001443981.
DR   EnsemblGenomes-Gn; EBG00001443982.
DR   EnsemblGenomes-Gn; EBG00001443983.
DR   EnsemblGenomes-Gn; EBG00001443984.
DR   EnsemblGenomes-Gn; EBG00001443985.
DR   EnsemblGenomes-Gn; EBG00001443986.
DR   EnsemblGenomes-Gn; EBG00001443987.
DR   EnsemblGenomes-Gn; EBG00001443988.
DR   EnsemblGenomes-Gn; EBG00001443989.
DR   EnsemblGenomes-Gn; EBG00001443990.
DR   EnsemblGenomes-Gn; EBG00001443991.
DR   EnsemblGenomes-Gn; EBG00001443992.
DR   EnsemblGenomes-Gn; EBG00001443993.
DR   EnsemblGenomes-Gn; EBG00001443994.
DR   EnsemblGenomes-Gn; EBG00001443995.
DR   EnsemblGenomes-Gn; EBG00001443996.
DR   EnsemblGenomes-Gn; EBG00001443997.
DR   EnsemblGenomes-Gn; EBG00001443998.
DR   EnsemblGenomes-Gn; EBG00001443999.
DR   EnsemblGenomes-Gn; EBG00001444000.
DR   EnsemblGenomes-Gn; EBG00001444001.
DR   EnsemblGenomes-Gn; EBG00001444002.
DR   EnsemblGenomes-Gn; EBG00001444003.
DR   EnsemblGenomes-Gn; EBG00001444004.
DR   EnsemblGenomes-Gn; EBG00001444005.
DR   EnsemblGenomes-Gn; EBG00001444006.
DR   EnsemblGenomes-Gn; EBG00001444007.
DR   EnsemblGenomes-Gn; EBG00001444008.
DR   EnsemblGenomes-Gn; EBG00001444009.
DR   EnsemblGenomes-Gn; EBG00001444010.
DR   EnsemblGenomes-Gn; EBG00001444011.
DR   EnsemblGenomes-Gn; EBG00001444012.
DR   EnsemblGenomes-Gn; EBG00001444013.
DR   EnsemblGenomes-Gn; EBG00001444014.
DR   EnsemblGenomes-Gn; EBG00001444015.
DR   EnsemblGenomes-Gn; EBG00001444016.
DR   EnsemblGenomes-Gn; EBG00001444017.
DR   EnsemblGenomes-Gn; EBG00001444018.
DR   EnsemblGenomes-Gn; EBG00001444019.
DR   EnsemblGenomes-Gn; EBG00001444020.
DR   EnsemblGenomes-Gn; EBG00001444021.
DR   EnsemblGenomes-Gn; EBG00001444022.
DR   EnsemblGenomes-Gn; EBG00001444023.
DR   EnsemblGenomes-Gn; EBG00001444024.
DR   EnsemblGenomes-Gn; EBG00001444025.
DR   EnsemblGenomes-Gn; EBG00001444026.
DR   EnsemblGenomes-Gn; EBG00001444027.
DR   EnsemblGenomes-Gn; EBG00001444028.
DR   EnsemblGenomes-Gn; EBG00001444029.
DR   EnsemblGenomes-Gn; EBG00001444030.
DR   EnsemblGenomes-Gn; EBG00001444031.
DR   EnsemblGenomes-Gn; EBG00001444032.
DR   EnsemblGenomes-Gn; EBG00001444033.
DR   EnsemblGenomes-Gn; EBG00001444034.
DR   EnsemblGenomes-Gn; EBG00001444035.
DR   EnsemblGenomes-Gn; EBG00001444036.
DR   EnsemblGenomes-Gn; EBG00001444037.
DR   EnsemblGenomes-Gn; EBG00001444038.
DR   EnsemblGenomes-Gn; EBG00001444039.
DR   EnsemblGenomes-Gn; EBG00001444040.
DR   EnsemblGenomes-Gn; EBG00001444041.
DR   EnsemblGenomes-Gn; EBG00001444042.
DR   EnsemblGenomes-Gn; EBG00001444043.
DR   EnsemblGenomes-Gn; EBG00001444044.
DR   EnsemblGenomes-Gn; EBG00001444045.
DR   EnsemblGenomes-Gn; EBG00001444046.
DR   EnsemblGenomes-Gn; EBG00001444047.
DR   EnsemblGenomes-Gn; EBG00001444048.
DR   EnsemblGenomes-Gn; EBG00001444049.
DR   EnsemblGenomes-Gn; EBG00001444050.
DR   EnsemblGenomes-Gn; EBG00001444051.
DR   EnsemblGenomes-Gn; EBG00001444052.
DR   EnsemblGenomes-Gn; EBG00001444053.
DR   EnsemblGenomes-Gn; EBG00001444054.
DR   EnsemblGenomes-Gn; EBG00001444055.
DR   EnsemblGenomes-Gn; EBG00001444056.
DR   EnsemblGenomes-Gn; EBG00001444057.
DR   EnsemblGenomes-Gn; EBG00001444058.
DR   EnsemblGenomes-Gn; EBG00001444059.
DR   EnsemblGenomes-Gn; EBG00001444060.
DR   EnsemblGenomes-Gn; EBG00001444061.
DR   EnsemblGenomes-Gn; EBG00001444062.
DR   EnsemblGenomes-Gn; EBG00001444063.
DR   EnsemblGenomes-Gn; EBG00001444064.
DR   EnsemblGenomes-Gn; EBG00001444065.
DR   EnsemblGenomes-Gn; EBG00001444066.
DR   EnsemblGenomes-Gn; EBG00001444067.
DR   EnsemblGenomes-Gn; EBG00001444068.
DR   EnsemblGenomes-Gn; EBG00001444069.
DR   EnsemblGenomes-Gn; EBG00001444070.
DR   EnsemblGenomes-Gn; EBG00001444071.
DR   EnsemblGenomes-Gn; EBG00001444072.
DR   EnsemblGenomes-Gn; EBG00001444073.
DR   EnsemblGenomes-Gn; EBG00001444074.
DR   EnsemblGenomes-Gn; EBG00001444075.
DR   EnsemblGenomes-Gn; EBG00001444076.
DR   EnsemblGenomes-Gn; EBG00001444077.
DR   EnsemblGenomes-Gn; EBG00001444078.
DR   EnsemblGenomes-Gn; EBG00001444079.
DR   EnsemblGenomes-Gn; EBG00001444080.
DR   EnsemblGenomes-Gn; EBG00001444081.
DR   EnsemblGenomes-Gn; EBG00001444082.
DR   EnsemblGenomes-Gn; EBG00001444083.
DR   EnsemblGenomes-Gn; EBG00001444084.
DR   EnsemblGenomes-Gn; EBG00001444085.
DR   EnsemblGenomes-Gn; EBG00001444086.
DR   EnsemblGenomes-Gn; EBG00001444087.
DR   EnsemblGenomes-Gn; EBG00001444088.
DR   EnsemblGenomes-Gn; EBG00001444089.
DR   EnsemblGenomes-Gn; EBG00001444090.
DR   EnsemblGenomes-Tr; EBG00000006281-1.
DR   EnsemblGenomes-Tr; EBG00000006282-1.
DR   EnsemblGenomes-Tr; EBG00000006283-1.
DR   EnsemblGenomes-Tr; EBG00000006284-1.
DR   EnsemblGenomes-Tr; EBG00000006285-1.
DR   EnsemblGenomes-Tr; EBG00000006286-1.
DR   EnsemblGenomes-Tr; EBG00000006287-1.
DR   EnsemblGenomes-Tr; EBG00000006288-1.
DR   EnsemblGenomes-Tr; EBG00000006289-1.
DR   EnsemblGenomes-Tr; EBG00000006290-1.
DR   EnsemblGenomes-Tr; EBG00000006291-1.
DR   EnsemblGenomes-Tr; EBG00000006292-1.
DR   EnsemblGenomes-Tr; EBG00000006293-1.
DR   EnsemblGenomes-Tr; EBG00000006294-1.
DR   EnsemblGenomes-Tr; EBG00000006295-1.
DR   EnsemblGenomes-Tr; EBG00000006296-1.
DR   EnsemblGenomes-Tr; EBG00000006297-1.
DR   EnsemblGenomes-Tr; EBG00000006298-1.
DR   EnsemblGenomes-Tr; EBG00000006299-1.
DR   EnsemblGenomes-Tr; EBG00000006300-1.
DR   EnsemblGenomes-Tr; EBG00000006301-1.
DR   EnsemblGenomes-Tr; EBG00000006302-1.
DR   EnsemblGenomes-Tr; EBG00000006303-1.
DR   EnsemblGenomes-Tr; EBG00000006304-1.
DR   EnsemblGenomes-Tr; EBG00000006305-1.
DR   EnsemblGenomes-Tr; EBG00000006306-1.
DR   EnsemblGenomes-Tr; EBG00000006307-1.
DR   EnsemblGenomes-Tr; EBG00000006308-1.
DR   EnsemblGenomes-Tr; EBG00000006309-1.
DR   EnsemblGenomes-Tr; EBG00000006310-1.
DR   EnsemblGenomes-Tr; EBG00000006311-1.
DR   EnsemblGenomes-Tr; EBG00000006312-1.
DR   EnsemblGenomes-Tr; EBG00000006313-1.
DR   EnsemblGenomes-Tr; EBG00000006314-1.
DR   EnsemblGenomes-Tr; EBG00000006315-1.
DR   EnsemblGenomes-Tr; EBG00000006316-1.
DR   EnsemblGenomes-Tr; EBG00000006317-1.
DR   EnsemblGenomes-Tr; EBG00000006318-1.
DR   EnsemblGenomes-Tr; EBG00000006319-1.
DR   EnsemblGenomes-Tr; EBG00000006320-1.
DR   EnsemblGenomes-Tr; EBG00000006321-1.
DR   EnsemblGenomes-Tr; EBG00000006322-1.
DR   EnsemblGenomes-Tr; EBG00000006323-1.
DR   EnsemblGenomes-Tr; EBG00000006324-1.
DR   EnsemblGenomes-Tr; EBG00000006325-1.
DR   EnsemblGenomes-Tr; EBG00000006326-1.
DR   EnsemblGenomes-Tr; EBG00000006327-1.
DR   EnsemblGenomes-Tr; EBG00000006328-1.
DR   EnsemblGenomes-Tr; EBG00000006329-1.
DR   EnsemblGenomes-Tr; EBG00000006330-1.
DR   EnsemblGenomes-Tr; EBG00000006331-1.
DR   EnsemblGenomes-Tr; EBG00000006332-1.
DR   EnsemblGenomes-Tr; EBG00000006333-1.
DR   EnsemblGenomes-Tr; EBG00000006334-1.
DR   EnsemblGenomes-Tr; EBG00000006335-1.
DR   EnsemblGenomes-Tr; EBG00000006336-1.
DR   EnsemblGenomes-Tr; EBG00000006337-1.
DR   EnsemblGenomes-Tr; EBG00000006338-1.
DR   EnsemblGenomes-Tr; EBG00000006339-1.
DR   EnsemblGenomes-Tr; EBG00000006340-1.
DR   EnsemblGenomes-Tr; EBG00000006341-1.
DR   EnsemblGenomes-Tr; EBG00000006342-1.
DR   EnsemblGenomes-Tr; EBG00000006343-1.
DR   EnsemblGenomes-Tr; EBG00000006344-1.
DR   EnsemblGenomes-Tr; EBG00000006345-1.
DR   EnsemblGenomes-Tr; EBG00000006346-1.
DR   EnsemblGenomes-Tr; EBG00000006347-1.
DR   EnsemblGenomes-Tr; EBG00000006348-1.
DR   EnsemblGenomes-Tr; EBG00000006349-1.
DR   EnsemblGenomes-Tr; EBG00000006350-1.
DR   EnsemblGenomes-Tr; EBG00000006351-1.
DR   EnsemblGenomes-Tr; EBG00000006352-1.
DR   EnsemblGenomes-Tr; EBG00000006353-1.
DR   EnsemblGenomes-Tr; EBG00000006354-1.
DR   EnsemblGenomes-Tr; EBG00000006355-1.
DR   EnsemblGenomes-Tr; EBG00000006356-1.
DR   EnsemblGenomes-Tr; EBG00000006357-1.
DR   EnsemblGenomes-Tr; EBG00000006358-1.
DR   EnsemblGenomes-Tr; EBG00000006359-1.
DR   EnsemblGenomes-Tr; EBG00000006360-1.
DR   EnsemblGenomes-Tr; EBG00000006361-1.
DR   EnsemblGenomes-Tr; EBG00000006362-1.
DR   EnsemblGenomes-Tr; EBG00000006363-1.
DR   EnsemblGenomes-Tr; EBG00000006364-1.
DR   EnsemblGenomes-Tr; EBG00000006365-1.
DR   EnsemblGenomes-Tr; EBG00000006366-1.
DR   EnsemblGenomes-Tr; EBG00000006367-1.
DR   EnsemblGenomes-Tr; EBG00000006368-1.
DR   EnsemblGenomes-Tr; EBG00000006369-1.
DR   EnsemblGenomes-Tr; EBG00000006370-1.
DR   EnsemblGenomes-Tr; EBG00000006371-1.
DR   EnsemblGenomes-Tr; EBG00000006372-1.
DR   EnsemblGenomes-Tr; EBG00000006373-1.
DR   EnsemblGenomes-Tr; EBG00000006374-1.
DR   EnsemblGenomes-Tr; EBG00000006375-1.
DR   EnsemblGenomes-Tr; EBG00000006376-1.
DR   EnsemblGenomes-Tr; EBG00000006377-1.
DR   EnsemblGenomes-Tr; EBG00000006378-1.
DR   EnsemblGenomes-Tr; EBG00000006379-1.
DR   EnsemblGenomes-Tr; EBG00000006380-1.
DR   EnsemblGenomes-Tr; EBG00000006381-1.
DR   EnsemblGenomes-Tr; EBG00000006382-1.
DR   EnsemblGenomes-Tr; EBG00000006383-1.
DR   EnsemblGenomes-Tr; EBG00000006384-1.
DR   EnsemblGenomes-Tr; EBG00000006385-1.
DR   EnsemblGenomes-Tr; EBG00000006386-1.
DR   EnsemblGenomes-Tr; EBG00000006387-1.
DR   EnsemblGenomes-Tr; EBG00000006388-1.
DR   EnsemblGenomes-Tr; EBG00000006389-1.
DR   EnsemblGenomes-Tr; EBG00000006390-1.
DR   EnsemblGenomes-Tr; EBG00000006391-1.
DR   EnsemblGenomes-Tr; EBG00000006392-1.
DR   EnsemblGenomes-Tr; EBG00000006393-1.
DR   EnsemblGenomes-Tr; EBG00000006394-1.
DR   EnsemblGenomes-Tr; EBT00001821596.
DR   EnsemblGenomes-Tr; EBT00001821597.
DR   EnsemblGenomes-Tr; EBT00001821598.
DR   EnsemblGenomes-Tr; EBT00001821599.
DR   EnsemblGenomes-Tr; EBT00001821600.
DR   EnsemblGenomes-Tr; EBT00001821601.
DR   EnsemblGenomes-Tr; EBT00001821602.
DR   EnsemblGenomes-Tr; EBT00001821603.
DR   EnsemblGenomes-Tr; EBT00001821604.
DR   EnsemblGenomes-Tr; EBT00001821605.
DR   EnsemblGenomes-Tr; EBT00001821606.
DR   EnsemblGenomes-Tr; EBT00001821607.
DR   EnsemblGenomes-Tr; EBT00001821608.
DR   EnsemblGenomes-Tr; EBT00001821609.
DR   EnsemblGenomes-Tr; EBT00001821610.
DR   EnsemblGenomes-Tr; EBT00001821611.
DR   EnsemblGenomes-Tr; EBT00001821612.
DR   EnsemblGenomes-Tr; EBT00001821613.
DR   EnsemblGenomes-Tr; EBT00001821614.
DR   EnsemblGenomes-Tr; EBT00001821615.
DR   EnsemblGenomes-Tr; EBT00001821616.
DR   EnsemblGenomes-Tr; EBT00001821617.
DR   EnsemblGenomes-Tr; EBT00001821618.
DR   EnsemblGenomes-Tr; EBT00001821619.
DR   EnsemblGenomes-Tr; EBT00001821620.
DR   EnsemblGenomes-Tr; EBT00001821621.
DR   EnsemblGenomes-Tr; EBT00001821622.
DR   EnsemblGenomes-Tr; EBT00001821623.
DR   EnsemblGenomes-Tr; EBT00001821624.
DR   EnsemblGenomes-Tr; EBT00001821625.
DR   EnsemblGenomes-Tr; EBT00001821626.
DR   EnsemblGenomes-Tr; EBT00001821627.
DR   EnsemblGenomes-Tr; EBT00001821628.
DR   EnsemblGenomes-Tr; EBT00001821629.
DR   EnsemblGenomes-Tr; EBT00001821630.
DR   EnsemblGenomes-Tr; EBT00001821631.
DR   EnsemblGenomes-Tr; EBT00001821632.
DR   EnsemblGenomes-Tr; EBT00001821633.
DR   EnsemblGenomes-Tr; EBT00001821634.
DR   EnsemblGenomes-Tr; EBT00001821635.
DR   EnsemblGenomes-Tr; EBT00001821636.
DR   EnsemblGenomes-Tr; EBT00001821637.
DR   EnsemblGenomes-Tr; EBT00001821638.
DR   EnsemblGenomes-Tr; EBT00001821639.
DR   EnsemblGenomes-Tr; EBT00001821640.
DR   EnsemblGenomes-Tr; EBT00001821641.
DR   EnsemblGenomes-Tr; EBT00001821642.
DR   EnsemblGenomes-Tr; EBT00001821643.
DR   EnsemblGenomes-Tr; EBT00001821644.
DR   EnsemblGenomes-Tr; EBT00001821645.
DR   EnsemblGenomes-Tr; EBT00001821646.
DR   EnsemblGenomes-Tr; EBT00001821647.
DR   EnsemblGenomes-Tr; EBT00001821648.
DR   EnsemblGenomes-Tr; EBT00001821649.
DR   EnsemblGenomes-Tr; EBT00001821650.
DR   EnsemblGenomes-Tr; EBT00001821651.
DR   EnsemblGenomes-Tr; EBT00001821652.
DR   EnsemblGenomes-Tr; EBT00001821653.
DR   EnsemblGenomes-Tr; EBT00001821654.
DR   EnsemblGenomes-Tr; EBT00001821655.
DR   EnsemblGenomes-Tr; EBT00001821656.
DR   EnsemblGenomes-Tr; EBT00001821657.
DR   EnsemblGenomes-Tr; EBT00001821658.
DR   EnsemblGenomes-Tr; EBT00001821659.
DR   EnsemblGenomes-Tr; EBT00001821660.
DR   EnsemblGenomes-Tr; EBT00001821661.
DR   EnsemblGenomes-Tr; EBT00001821662.
DR   EnsemblGenomes-Tr; EBT00001821663.
DR   EnsemblGenomes-Tr; EBT00001821664.
DR   EnsemblGenomes-Tr; EBT00001821665.
DR   EnsemblGenomes-Tr; EBT00001821666.
DR   EnsemblGenomes-Tr; EBT00001821667.
DR   EnsemblGenomes-Tr; EBT00001821668.
DR   EnsemblGenomes-Tr; EBT00001821669.
DR   EnsemblGenomes-Tr; EBT00001821670.
DR   EnsemblGenomes-Tr; EBT00001821671.
DR   EnsemblGenomes-Tr; EBT00001821672.
DR   EnsemblGenomes-Tr; EBT00001821673.
DR   EnsemblGenomes-Tr; EBT00001821674.
DR   EnsemblGenomes-Tr; EBT00001821675.
DR   EnsemblGenomes-Tr; EBT00001821676.
DR   EnsemblGenomes-Tr; EBT00001821677.
DR   EnsemblGenomes-Tr; EBT00001821678.
DR   EnsemblGenomes-Tr; EBT00001821679.
DR   EnsemblGenomes-Tr; EBT00001821680.
DR   EnsemblGenomes-Tr; EBT00001821681.
DR   EnsemblGenomes-Tr; EBT00001821682.
DR   EnsemblGenomes-Tr; EBT00001821683.
DR   EnsemblGenomes-Tr; EBT00001821684.
DR   EnsemblGenomes-Tr; EBT00001821685.
DR   EnsemblGenomes-Tr; EBT00001821686.
DR   EnsemblGenomes-Tr; EBT00001821687.
DR   EnsemblGenomes-Tr; EBT00001821688.
DR   EnsemblGenomes-Tr; EBT00001821689.
DR   EnsemblGenomes-Tr; EBT00001821690.
DR   EnsemblGenomes-Tr; EBT00001821691.
DR   EnsemblGenomes-Tr; EBT00001821692.
DR   EnsemblGenomes-Tr; EBT00001821693.
DR   EnsemblGenomes-Tr; EBT00001821694.
DR   EnsemblGenomes-Tr; EBT00001821695.
DR   EnsemblGenomes-Tr; EBT00001821696.
DR   EnsemblGenomes-Tr; EBT00001821697.
DR   EnsemblGenomes-Tr; EBT00001821698.
DR   EnsemblGenomes-Tr; EBT00001821699.
DR   EnsemblGenomes-Tr; EBT00001821700.
DR   EnsemblGenomes-Tr; EBT00001821701.
DR   EnsemblGenomes-Tr; EBT00001821702.
DR   EnsemblGenomes-Tr; EBT00001821703.
DR   EnsemblGenomes-Tr; EBT00001821704.
DR   EnsemblGenomes-Tr; EBT00001821705.
DR   EnsemblGenomes-Tr; EBT00001821706.
DR   EnsemblGenomes-Tr; EBT00001821707.
DR   EnsemblGenomes-Tr; EBT00001821708.
DR   EnsemblGenomes-Tr; EBT00001821709.
DR   EnsemblGenomes-Tr; EBT00001821710.
DR   EnsemblGenomes-Tr; EBT00001821711.
DR   EnsemblGenomes-Tr; EBT00001821712.
DR   EnsemblGenomes-Tr; EBT00001821713.
DR   EnsemblGenomes-Tr; EBT00001821714.
DR   EnsemblGenomes-Tr; EBT00001821715.
DR   EnsemblGenomes-Tr; EBT00001821716.
DR   EnsemblGenomes-Tr; EBT00001821717.
DR   EnsemblGenomes-Tr; EBT00001821718.
DR   EnsemblGenomes-Tr; EBT00001821719.
DR   EnsemblGenomes-Tr; EBT00001821720.
DR   EnsemblGenomes-Tr; EBT00001821721.
DR   EnsemblGenomes-Tr; EBT00001821722.
DR   EnsemblGenomes-Tr; EBT00001821723.
DR   EnsemblGenomes-Tr; EBT00001821724.
DR   EnsemblGenomes-Tr; EBT00001821725.
DR   EnsemblGenomes-Tr; EBT00001821726.
DR   EnsemblGenomes-Tr; EBT00001821727.
DR   EnsemblGenomes-Tr; EBT00001821728.
DR   EnsemblGenomes-Tr; EBT00001821729.
DR   EnsemblGenomes-Tr; EBT00001821730.
DR   EnsemblGenomes-Tr; EBT00001821731.
DR   EnsemblGenomes-Tr; EBT00001821732.
DR   EnsemblGenomes-Tr; EBT00001821733.
DR   EnsemblGenomes-Tr; EBT00001821734.
DR   EnsemblGenomes-Tr; EBT00001821735.
DR   EnsemblGenomes-Tr; EBT00001821736.
DR   EnsemblGenomes-Tr; EBT00001821737.
DR   EnsemblGenomes-Tr; EBT00001821738.
DR   EnsemblGenomes-Tr; EBT00001821739.
DR   EnsemblGenomes-Tr; EBT00001821740.
DR   EnsemblGenomes-Tr; EBT00001821741.
DR   EnsemblGenomes-Tr; EBT00001821742.
DR   EnsemblGenomes-Tr; EBT00001821743.
DR   EnsemblGenomes-Tr; EBT00001821744.
DR   EnsemblGenomes-Tr; EBT00001821745.
DR   EnsemblGenomes-Tr; EBT00001821746.
DR   EnsemblGenomes-Tr; EBT00001821747.
DR   EnsemblGenomes-Tr; EBT00001821748.
DR   EnsemblGenomes-Tr; EBT00001821749.
DR   EnsemblGenomes-Tr; EBT00001821750.
DR   EnsemblGenomes-Tr; EBT00001821751.
DR   EnsemblGenomes-Tr; EBT00001821752.
DR   EnsemblGenomes-Tr; EBT00001821753.
DR   EnsemblGenomes-Tr; EBT00001821754.
DR   EnsemblGenomes-Tr; EBT00001821755.
DR   EnsemblGenomes-Tr; EBT00001821756.
DR   EnsemblGenomes-Tr; EBT00001821757.
DR   EnsemblGenomes-Tr; EBT00001821758.
DR   EnsemblGenomes-Tr; EBT00001821759.
DR   EnsemblGenomes-Tr; EBT00001821760.
DR   EnsemblGenomes-Tr; EBT00001821761.
DR   EnsemblGenomes-Tr; EBT00001821762.
DR   EnsemblGenomes-Tr; EBT00001821763.
DR   EnsemblGenomes-Tr; EBT00001821764.
DR   EuropePMC; PMC2289816; 18307761.
DR   EuropePMC; PMC2632007; 19074389.
DR   EuropePMC; PMC4194401; 25273399.
DR   EuropePMC; PMC4995803; 27559429.
DR   EuropePMC; PMC5529333; 28735622.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01412; BsrG.
DR   RFAM; RF01690; Bacillaceae-1.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02004; group-II-D1D4-5.
DR   SILVA-LSU; BA000043.
DR   SILVA-SSU; BA000043.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3544776
FT                   /organism="Geobacillus kaustophilus HTA426"
FT                   /strain="HTA426"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="isolated from the deepest Ocean"
FT                   /note="thermophile"
FT                   /db_xref="taxon:235909"
FT   CDS_pept        88..1440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="GK0001"
FT                   /product="chromosome replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0001"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74286"
FT                   /db_xref="GOA:Q5L3Z2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3Z2"
FT                   /protein_id="BAD74286.1"
FT                   /translation="MENIHDLWDRVLAEIEQKISKPSFETWLKSTKAHSLRGDTLVIVA
FT                   PNEFARDWLDSRYSHLIAETIYTITGEELAVKFIIPPNQDDEELEFQSSKKKQRKPYEE
FT                   TNDFPQSMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLM
FT                   HAIGHYVIEHNPSAKVVYLSSEKFTNEFINAIRDNRPDDFRNKYRNVDVLLIDDIQFLA
FT                   GKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLE
FT                   TRIAILRKKAKAEGFDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKEITADLA
FT                   AEALKDIIPSAKPKVITIQDIQRVVGQHFNIKMEDFKAKKRTKSVAFPRQIAMYLSREL
FT                   TDCSLPKIGDEFGGRDHTTVIHAHEKISKLLQTDTQLQRHIQEIQEKLKQL"
FT   CDS_pept        1613..2749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="GK0002"
FT                   /product="DNA-directed DNA polymerase III beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:GK0002"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74287"
FT                   /db_xref="GOA:Q5L3Z1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3Z1"
FT                   /protein_id="BAD74287.1"
FT                   /translation="MNISIDREALAKSVQDVMKAVSTRTTIPILTGIKLTATASGVTLT
FT                   GSDSDISIESFIPLEKEGKLLVDVKRPGSIVLQARFFSEIVKKLPQQTVEIETEDNFLT
FT                   IIRSGHSEFRLNGLNADEYPRLPQIEEENVFQIPADLLKTVIRQTVFAVSTSETRPILT
FT                   GVNWKVEHGELVCTATDSHRLAMRKVKIESENEVSYNVVIPGKSLNELSKILDDGNHPV
FT                   DIVMTANQVLFKAEHLLFFSRLLDGNYPETARLIPTESKTTMIVNTKEFLQAIDRASLL
FT                   AREGRNNVVKLTTLPGGMLEISSISPEIGKVTEQLQTESLEGEELNISFSAKYMMDALR
FT                   ALDGTDIQISFTGAMRPFLLRPLHTDSMLQLILPVRTY"
FT   CDS_pept        2947..3168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0003"
FT                   /locus_tag="GK0003"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0003"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74288"
FT                   /db_xref="GOA:Q5L3Z0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3Z0"
FT                   /protein_id="BAD74288.1"
FT                   /translation="MEQRVTITTETITLGQLLKLVRLIDTGGAAKWFLQEHHVLVNGER
FT                   ENRRGRKLRDGDRIDIEPFGTFVVVKAE"
FT   CDS_pept        3180..4298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="GK0004"
FT                   /product="DNA replication and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0004"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74289"
FT                   /db_xref="GOA:Q5L3Y9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3Y9"
FT                   /protein_id="BAD74289.1"
FT                   /translation="MFLTNLTLTNYRNYEYETLNFGEGVNVILGENAQGKTNMMEAIYV
FT                   LAMAKSHRTSNDKDLIRWNEEYAKIEGRAEKRSGSLTLELLISKKGKKARCNHIEQQRL
FT                   SQYVGHLNVVMFAPEDLNLVKGSPQVRRRFVDMEIGQVSPVYIHDLSQYQKLLQQRNHY
FT                   LKMMQARERSDEAVLDVLTEQLVLLAAKITLRRRQFLSLLEQWAMPIHYEISRGAEQLC
FT                   IRYEPSVDVSEKAELSRIVEAYSETFAAMREREVQRGTTLVGPHRDDIAFFVNGKNVQT
FT                   FGSQGQQRTTALAVKLAELELIFSELGDYPILLLDDVLSELDDFRQTHLLDAIRKKVQT
FT                   FVTTTSIDGIKHDIIQEAAIYRVHSGSVTAPS"
FT   CDS_pept        4351..6267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="GK0005"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:GK0005"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74290"
FT                   /db_xref="GOA:Q5L3Y8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3Y8"
FT                   /protein_id="BAD74290.1"
FT                   /translation="MEQRVEQTYDASQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVWE
FT                   IVDNSIDEALAGYCTNIDVTIGKDNSITVADNGRGIPVDIHEATGRPAVEVIMTVLHAG
FT                   GKFGGGGYKVSGGLHGVGASVVNALSEWLEVYVYRDGKIHYQRYERGEPCTDLQVIGET
FT                   DRTGTTTRFKPDPEIFTETTEFDYETLATRLRELAFLNRGLKITLTDERVDSRKNEYVY
FT                   EGGIRSYVRHLNRTREVLHEEPIYIAGERDGIAVEIALQYNDGYTSNIYSFVNNIHTHE
FT                   GGTHESGFKMALTRIINDYARKQQIFKENDTNLTGEDVREGLTAIVSIKHPSPQFEGQT
FT                   KTKLGNSDARTVTDAVFSEQFETFLLENPTIARKIVEKGMMAARARLAAKKARELTRRK
FT                   SALEISNLPGKLADCSSRDPSISELYVVEGDSAGGSAKQGRDRHFQAILPLRGKILNVE
FT                   KARLDKILSNNEVRAIITALGTGIGEEFDISKARYHKVIIMTDADVDGAHIRTLLLTFF
FT                   YRYMRELIEHGYIYIAQPPLYKIEQGKQVRYAYNDRQLEKILAELPDQPKPTIQRYKGL
FT                   GEMNPEQLWETTMNPETRTLLQVSLQDAIDADETFEILMGDKVEPRRQFIEENARYVKN
FT                   LDI"
FT   CDS_pept        6418..8874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="GK0006"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:GK0006"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74291"
FT                   /db_xref="GOA:Q5L3Y7"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3Y7"
FT                   /protein_id="BAD74291.1"
FT                   /translation="MAEHEQPRIREVNISQEMRSSFLDYAMSVIVSRALPDVRDGLKPV
FT                   HRRILYAMHDLGMTADKPYKKSARIVGEVIGKYHPHGDAAVYDTMVRMAQDFNYRYMLV
FT                   DGHGNFGSIDGDAAAAMRYTEARMSKIAMELLRDINKDTIDYQDNYDGSEKEPVVLPSR
FT                   FPNLLVNGSSGIAVGMATNIPPHQLGEVIDALLALSQNPEMTVADLMEYIPGPDFPTAG
FT                   QIIGRSGIRKAYETGRGSITLRAKAEIEQQPNGKETIIVTELPYQVNKAKLIERIAELV
FT                   RDKKIDGITDLRDESDRSGMRIVIEVRRDANAKVVLNNLYKHTALQTSFGINMLALVNG
FT                   EPKVLNLKECLEHYLNHQKTVIRRRTAFELKKAEARAHILEGLRIALDHLDEVIDLIRR
FT                   SQTTEAAREGLMARFSLSERQAQAILDMRLQRLTGLEREKIEQEYQDLVRLIAELRGVL
FT                   ADEEKVLQIIRDELSEIKERFNDERRTEIVSGAVEQFDDEDLIPQEHVVITLTHKGYIK
FT                   RLPLSTYRSQKRGGRGVQGMHTAEDDFVEHLLITSTHDTVLFFTNKGKVYQAKGYEIPE
FT                   FGRTAKGLPIINLLELDKDEWINAMIPIESEFSDERYLVFATKQGIAKRSPLSAFAHIR
FT                   NNGLIAIHLREGDELISVRLTDGKKHLIIGTKNGMLIRFPETDVRAMGRSATGVKAITL
FT                   DDGDEVVGMEILEDHHDVLVVTKKGFGKRTPASEYRVQSRGGKGLKTCNVTDKNGPVVA
FT                   VTTVVGNEDVMVITTGGVLIRIAVSDISRTGRIAQGVKLIRLSGEDGHECVATVAKVPE
FT                   EERDEE"
FT   CDS_pept        9020..10087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0007"
FT                   /locus_tag="GK0007"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0007"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74292"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3Y6"
FT                   /protein_id="BAD74292.1"
FT                   /translation="MVRVKRSQLREGCVLAEDVLGKTKRPIIPKNTVITKPLLLVLEKF
FT                   LVEEVDVEPLLANGEPFPNVDSASTAVAKQPMAFYLEAVQRYKTWFQSWQAGLPVDIGE
FT                   IRGVIISLFERMAGQKRELLMLHHYATKDEYLHHHAVSVGLLAGFLAMQLGYSEGECHQ
FT                   IALAGVLADCGMAKVSKRILTNPSALTEAEFNEVKQHPVFSYRMVQKIPALNHGAKLAV
FT                   LQHHERNDGSGYPLGVKAERIHPYSQIVAVADVYHAMTSERLYRRKQSPFRAIETMQRE
FT                   QFGKLSTEAVAALVSNLIGLQTGAVVKLSNGEMAEVMFIPSDEPARPIVKIIETGQLLS
FT                   LSVQRDIYIEEMVQG"
FT   rRNA            10421..11973
FT                   /gene="rrnA-16S"
FT                   /product="16S ribosomal RNA"
FT   tRNA            12191..12264
FT                   /gene="trnA-Ile"
FT                   /product="transfer RNA trnA-Ile"
FT   tRNA            12271..12346
FT                   /gene="trnA-Ala"
FT                   /product="transfer RNA trnA-Ala"
FT   rRNA            12606..15535
FT                   /gene="rrnA-23S"
FT                   /product="23S ribosomal RNA"
FT   rRNA            15705..15821
FT                   /gene="rrnA-5S"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        complement(15866..16843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0008"
FT                   /locus_tag="GK0008"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0008"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74293"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3Y5"
FT                   /protein_id="BAD74293.1"
FT                   /translation="MFGNHGQLFRLSVFRSADTAQQFLRQCYQQLQRDDAVQRSYANCY
FT                   PFLYYLEHGQNFYAAAQQAPLSIKPVLLFYGMVQLLKACLLTVDPDYPESTSVLAHGVS
FT                   ARKRKKQGYEFLDDEVKIQKNGLFAHFSEKMFHVKQEAGEKFRMGTLLQRISELHETFF
FT                   LLSGRKKPLSLPVVHTASPPMLAIPKVILDHYHMSLSRFVQYLCEEGQGKRLSFAKEEG
FT                   EFLYFHIESPLSPAGEGPFLFHLDGTLRIPVKKEKTFSLPEIHAHYLLLYNLSMISRYE
FT                   TEWWSELLHSYPSKAYTFILEFLSVSAEKVPLLLHEYLMRKFLG"
FT   CDS_pept        16969..18435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0009"
FT                   /locus_tag="GK0009"
FT                   /product="inositol-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:GK0009"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74294"
FT                   /db_xref="GOA:Q5L3Y4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3Y4"
FT                   /protein_id="BAD74294.1"
FT                   /translation="MWEAKFAKEGLTFDDVLLIPAKSDVLPRDVDVTTKLSDTLQLNIP
FT                   ILSAGMDTVTEAEMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSERGVITDPFFLTP
FT                   DHQVYDAEHLMSKYRISGVPIVNNPEEQKLVGIITNRDLRFIQDYSIKISEVMTKENLI
FT                   TAPVGTTLEEAEKILQRHKVEKLPLVDENGVLKGLITIKDIEKVIEFPNSAKDAKGRLI
FT                   VGAAVGVTADTMIRVKKLVEAGVDVIVVDTAHGHSKGVLETVANIRRQYPDLNIIAGNV
FT                   ATAEGTRDLIEAGANIIKVGIGPGSICTTRVVAGVGVPQITAIYDCATEARKHGVPIIA
FT                   DGGIKYSGDIVKAIAAGAHAVMLGSLLAGVSESPGETEIYQGRRFKVYRGMGSVAAMER
FT                   GSKDRYFQEDAKKFVPEGIEGRVPYKGPLADTIYQLVGGLRAGMGYCGTRNLEELREKT
FT                   QFIRMTSAGLRESHPHDVQITKEAPNYSAF"
FT   CDS_pept        18540..19898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0010"
FT                   /locus_tag="GK0010"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:GK0010"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74295"
FT                   /db_xref="GOA:Q5L3Y3"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3Y3"
FT                   /protein_id="BAD74295.1"
FT                   /translation="MRRRKQNWLFWLLSICLCLTFGPFQQTVKAESAPLDIRADAAILV
FT                   DAQTGRILYEKNIDTVLGIASMTKMMTEYLLLDAIKAKRVKWDQMYTPSDYVYRLSQDR
FT                   ALSNVPLRKDGKYTVRELYEAMAIYSANGATVAIAEIIAGSEKNFVKMMNDKAKELGLK
FT                   DYKFVNATGLSNKDLKGFHPEGTSTNEENVMSARAMAMLAYRLLKDHPEVLKTASIPHK
FT                   VFREGTKDEIKMDNWNWMLPGLVYGYEGVDGLKTGYTEFAGNCFTGTAKRNGVRLISVV
FT                   MNAKDASGKTTKEARFKETEKLFNYGFNQYSLETLYPKGYQLKGKETLPVVKGKEKEVR
FT                   VATGKNLDLLVKNGEEKQYKPVYVLDKKKMTKEGKLVAPLKKGETVGYMTLEYKGDDSL
FT                   AFLSPDMQKNIRVPLVTTAEVEKANWFVLSMRAVGGLFVDLWTSVAKTVKGWL"
FT   CDS_pept        20029..20913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0011"
FT                   /locus_tag="GK0011"
FT                   /product="superoxide-inducible protein (protein required
FT                   for pyridoxine synthesis)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0011"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74296"
FT                   /db_xref="GOA:Q5L3Y2"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="PDB:1ZNN"
FT                   /db_xref="PDB:4WXY"
FT                   /db_xref="PDB:4WXZ"
FT                   /db_xref="PDB:4WY0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3Y2"
FT                   /protein_id="BAD74296.1"
FT                   /translation="MALTGTDRVKRGMAEMQKGGVIMDVVNAEQAKIAEAAGAVAVMAL
FT                   ERVPADIRAAGGVARMADPTVIEEVMNAVSIPVMAKVRIGHYVEARVLEALGVDYIDES
FT                   EVLTPADEEFHIDKRQFTVPFVCGCRDLGEAARRIAEGASMLRTKGEPGTGNIVEAVRH
FT                   MRKVNAQIRKVVNMSEDELVAEAKQLGAPVEVLREIKRLGRLPVVNFAAGGVATPADAA
FT                   LMMHLGADGVFVGSGIFKSENPEKYARAIVEATTHYEDYELIAHLSKGLGGAMRGIDIA
FT                   TLLPEHRMQERGW"
FT   CDS_pept        20938..21528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0012"
FT                   /locus_tag="GK0012"
FT                   /product="2-deoxy-scyllo-inosose synthase20kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GK0012"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74297"
FT                   /db_xref="GOA:Q5L3Y1"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PDB:4WXY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3Y1"
FT                   /protein_id="BAD74297.1"
FT                   /translation="MKIGVLGLQGAVREHVRAIEACGAEAVIVKKPEQLEGLDGLVLPG
FT                   GESTTMRRLIDRYGLMEPLKQFAAAGKPMFGTCAGLILLAKRIVGYDEPHLGLMDITVE
FT                   RNSFGRQRESFEAELSIKGVGDGFVGVFIRAPHIVEAGDGVDVLATYNDRIVAARQGQF
FT                   LGCSFHPELTDDHRLMQYFLNMVKEAKMASSLK"
FT   CDS_pept        21813..23087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="GK0013"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:GK0013"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74298"
FT                   /db_xref="GOA:Q5L3Y0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3Y0"
FT                   /protein_id="BAD74298.1"
FT                   /translation="MLDVKILRTQFEEVKEKLMQRGGDLTNIDRFEQLDKDRRRLIAEV
FT                   EELKSKRNDVSQQIAVLKREKKDAEPLIAQMREVGDRIKRMDEQIRQLEAELDDLLLSI
FT                   PNVPHESVPIGQSEEDNVEVRRWGEPRSFSFEPKPHWEIADRLGLLDFERAAKVAGSRF
FT                   VFYKGLGARLERALINFMLDIHLDEFGYEEVLPPYLVNRASMIGTGQLPKFAEDAFHLD
FT                   SEDYFLIPTAEVPVTNLHRDEILAADDLPIYYAAYSACFRAEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEDSYDELEKLTRQAETILQRLGLPYRVVALCTGDLGFSAAKTYDIEVW
FT                   LPSYGTYREISSCSNFEAFQARRANIRFRRDPKAKPEYVHTLNGSGLAIGRTVAAILEN
FT                   YQQEDGSVIVPEALRPYMGNRDVIR"
FT   CDS_pept        complement(23309..24595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0014"
FT                   /locus_tag="GK0014"
FT                   /product="spore peptidoglycan hydrolase
FT                   (N-acetylglucosaminidase)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0014"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74299"
FT                   /db_xref="GOA:Q5L3X9"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR041704"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3X9"
FT                   /protein_id="BAD74299.1"
FT                   /translation="MQIHVVQSGQTLSGIAEAYGTTAEDIVRANKLPNPDKLVVGQALV
FT                   IPIVGRFYWVQRGDTLWSIARRFSIPMQRLAEVNRLSLNAPLKVGQRLYIPPGAKRRAE
FT                   FNAYIEPRGATVSPALEASAREAAPYLTYLSPLYFAIRRDATLQEPPLDDFPDIARANR
FT                   VTLVMVVANIENGQFSDELGALMLTNETLQNRLLDNIVATARRYGFRDIHFDFEYLRPE
FT                   DREAYNAFLRKAKRRFAREGWMMSTALAPKTSATQRGRWYEAHDYRAHGQIVDFVVIMT
FT                   YEWGYSGGPPMPVSPIGPVRRVLEYAISEMPAGKILMGQNLYGYDWTLPYVPGGPYAQA
FT                   ISPQQAIALAAKYNVAIEYDTEAQAPHFRYRDENGREHEVWFEDARSIQAKFNLVKELG
FT                   LRGVSYWKLGIDFPQNWLLIADQFTVVKK"
FT   CDS_pept        24791..26155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0015"
FT                   /locus_tag="GK0015"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0015"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74300"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KX50"
FT                   /protein_id="BAD74300.1"
FT                   /translation="MKHLTTEWPLLKELEEQLVRTLQKVFAVLLAALLEEIDQQLAEAR
FT                   DKRRYQLKDKRPTTIQTLFGEVTFRRNYYYDRQAGAYTFLLDAELGFDGAQSISPCLEE
FT                   TAVELAVECSSYRKAARTLESIVGYAVMSHEAIRQLVLEASVSLHHPVSKRHGRVLFVE
FT                   ADGLFISRQGKGKRAKEEKILAIHEGWKRNGSQLELVNRRHYLHEGEGDVWERFEEWLM
FT                   NEYAYDPCRDLLIINGDAASWITACREYFGKRACFQLDRFHVARELRQCLSGHPRWREV
FT                   RKKLAKQDEEGLLVELNSAVGTLEDEGKEQQLAALIRRIESMPGCIRDYREWLSEQGVE
FT                   TTGMRPMGHAESVMSRFAHRVKSRRSWKDQGLRAFLRAMAARIDGIGWRKGRWEEQEPQ
FT                   SAVSASTKSKRIEQAKRKAGRLWADVMRQNIPYLQQSSGTPIHQALSALRDGGWV"
FT   CDS_pept        26394..26891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0016"
FT                   /locus_tag="GK0016"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0016"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74301"
FT                   /db_xref="GOA:Q5L3X7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3X7"
FT                   /protein_id="BAD74301.1"
FT                   /translation="MNTDEYYMRLAMEEAKKAEQIGEVPIGAVIVQDGRVIARAHNLRE
FT                   TEQRAIAHAEILAIDEACRATGSWRLERATLYVTLEPCAMCAGAIVLSRIERVVFGAFD
FT                   PKGGCAGTLMNLLQESRFNHQVKVVSGVLADECGSLLSQFFRRLREQKRNVGGSANENS
FT                   VD"
FT   CDS_pept        27312..28991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="GK0017"
FT                   /product="DNA-directed DNA polymerase III gamma and tau
FT                   subunits"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:GK0017"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74302"
FT                   /db_xref="GOA:Q5L3X6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3X6"
FT                   /protein_id="BAD74302.1"
FT                   /translation="MAYQALYRVFRPQRFADMVGQEHVTKTLQSALLQHKISHAYLFSG
FT                   PRGTGKTSAAKIFAKAVNCEQAPAAEPCNECPACLGITNGTVPDVLEIDAASNNRVDEI
FT                   RDIREKVKFAPTSARYKVYIIDEVHMLSIGAFNALLKTLEEPPKHVIFILATTEPHKIP
FT                   TTIISRCQRFDFRRIPLPAIVSRLKYVASAQGVEASDEALSAIARAADGGMRDALSLLD
FT                   QAISFSDGKLRLDDVLAMTGAASFAALSSFIEAIHRKDTAAVLQQLETMMAQGKDPHRL
FT                   VEDLILYYRDLLLYKTAPYVEGAIQIAVVDEAFTSLSEMIPVSNLYEAIELLNKSQQEM
FT                   KWTNHPRLLLEVALVKLCHPSAAAPSLSASELEPLIKRIETLEAELRRLKEQPPAPPST
FT                   AAPVKKLSKPMKTGGYKAPVGRIYELLKQATHEDLALVKGCWADVLDTLKRQHKVSHAA
FT                   LLQESEPVAASASAFVLKFKYEIHCKMATDPTSSVKENVEAILFELTNRRFEMVAIPEG
FT                   EWGKIREEFIRNKDAMVEKSEEDPLIAEAKRLFGEELIEIKE"
FT   CDS_pept        29015..29341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0018"
FT                   /locus_tag="GK0018"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0018"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74303"
FT                   /db_xref="GOA:Q5L3X5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3X5"
FT                   /protein_id="BAD74303.1"
FT                   /translation="MMRGGMGNMQKMLKQMQKMQKEMQKAQEELAEKTVEGTAGGGMVT
FT                   VVANGHKQILEVKIKEEVVDPDDIEMLQDLILAATNDALKKADELANEMMGQFTKGLNI
FT                   PGLF"
FT   CDS_pept        29351..29947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0019"
FT                   /locus_tag="GK0019"
FT                   /product="DNA repair and genetic recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0019"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74304"
FT                   /db_xref="GOA:Q5L3X4"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3X4"
FT                   /protein_id="BAD74304.1"
FT                   /translation="MHYPEPLSKLIDSFMKLPGIGPKTAARLAFHVLAMKEDTVLEFAK
FT                   ALVDVKRHIHYCTICGHITDTDPCYICKDERRDRTTICVVQDPKDVIAMERMKEYNGLY
FT                   HVLHGAISPMEGIGPEDIKIAELLTRLQDETVQEVILATDPNIEGEATAMYISRLLKPT
FT                   GIKVTRIAHGLPVGGDLEYADEVTLSKALEGRREL"
FT   CDS_pept        29959..30195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0020"
FT                   /locus_tag="GK0020"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0020"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74305"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3X3"
FT                   /protein_id="BAD74305.1"
FT                   /translation="MGIGLLWRRKGKLKRQFDEKLMAELQKARTEWLEQKQLIEKSVDP
FT                   SPEVLSALQLAEAKYFFLLREAKHRRITLKEVR"
FT   CDS_pept        30274..30537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0021"
FT                   /locus_tag="GK0021"
FT                   /product="inhibitor of the pro-sigma K processing
FT                   machinery"
FT                   /db_xref="EnsemblGenomes-Gn:GK0021"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74306"
FT                   /db_xref="GOA:Q5L3X2"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3X2"
FT                   /protein_id="BAD74306.1"
FT                   /translation="MEPKVVITVLLALIAVLLIVGARLKALRLIGYAAIRLIVGALALF
FT                   VINAIGGHFNIHIPINLVTSIVCGFLGLPGAAALIVIDRYIL"
FT   rRNA            30790..32343
FT                   /gene="rrnB-16S"
FT                   /product="16S ribosomal RNA"
FT   tRNA            32563..32636
FT                   /gene="trnB-Ile"
FT                   /product="transfer RNA trnB-Ile"
FT   tRNA            32643..32717
FT                   /gene="trnB-Ala"
FT                   /product="transfer RNA trnB-Ala"
FT   rRNA            33138..36067
FT                   /gene="rrnB-23S"
FT                   /product="23S ribosomal RNA"
FT   rRNA            36173..36289
FT                   /gene="rrnB-5S"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        36442..36648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0022"
FT                   /locus_tag="GK0022"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0022"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74307"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3X1"
FT                   /protein_id="BAD74307.1"
FT                   /translation="MRTSIADRNQREHVCIVCEQEKKEGIFLFGHFLCLDCNRAIVQTN
FT                   TDDPNYSFYVRQLRKMFTSKIHS"
FT   CDS_pept        36819..38252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0023"
FT                   /locus_tag="GK0023"
FT                   /product="lysine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0023"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74308"
FT                   /db_xref="GOA:Q5L3X0"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3X0"
FT                   /protein_id="BAD74308.1"
FT                   /translation="MDQTKTPLYDALVHHWARRPVSFHVPGHKYGALFSKRGRDMFAPL
FT                   LALDATEISGLDDLHQPESVIAEAQALAAELYGVRETFFLVNGSTAGNLAMIAAVCDGK
FT                   RKKVIVQRNCHKSVMHALQLMEATPVLLAPEFDRDVCVASHIRPEAVKEALALYDDVAA
FT                   VVLTNPNYYGMAADLTEIVRLVHEHGIPVLVDEAHGAHFVVGPPFPTSALRYGADVVVQ
FT                   SAHKTLPAMTMGAFLHVNSERVDLERLKYFLQLFQSSSPSYPIMASLDLARSYVAQLSK
FT                   SDAAAIVAEIEKFKAALADIDGVAVVCSRHFGVQTDPLKVMVQTRCSLTGYELQRWLER
FT                   EGVFVELADRMNVLFVCPLAVTGRLQEAAEKIKRAWRDLPDGEAPVCNASPFLGPPLSV
FT                   LVPYNELRHLRTKAVALEEAEGHIAAETVIPYPPGVPLVWVGERIGRGHIEQIRQLLCQ
FT                   RAHIQGGSRLKDGQLVVYE"
FT   CDS_pept        38267..38911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0024"
FT                   /locus_tag="GK0024"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:GK0024"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74309"
FT                   /db_xref="GOA:Q5L3W9"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3W9"
FT                   /protein_id="BAD74309.1"
FT                   /translation="MPRVMNGCFFSFEGPEGAGKTTMISKLESLLRERGIDVVATREPG
FT                   GVRIAEAIRSIILNRDYTEMDGRTEALLYAAARRQHLLEKIVPALEAGCVVLCDRFVDS
FT                   SLAYQGFARGLGIEEVWKINEFAIDGYMPSLTIYFDIDPQIGLERIRRNRGREVNRLDL
FT                   ETLSFHEKVREGYRELARRFADRIVVIDANRPLDDVFAETTAAVLSRLKGR"
FT   CDS_pept        38997..39983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0025"
FT                   /locus_tag="GK0025"
FT                   /product="DNA-directed DNA polymerase III delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:GK0025"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74310"
FT                   /db_xref="GOA:Q5L3W8"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3W8"
FT                   /protein_id="BAD74310.1"
FT                   /translation="MRWEQLAKRQPVVAKMLQSGLEKGRISHAYLFEGQRGTGKKAASL
FT                   LLAKRLFCLSPIGVSPCLECRNCRRIDSGNHPDVRVISPDGGSIKKEQIEWLQQEFSKT
FT                   AVESDKKMYIVEHADQMTTSAANSLLKFLEEPHPGTVAVLLTEQYHRLLGTIVSRCQVL
FT                   SFRPLPPAELAQGLVEEHVPLPLALLAAHLTNSFEEALALAKDSWFAEARTLVLQWYEM
FT                   LGKPELQLLFFIHDRLFPHFLESHQLDLGLDLLLYLYRDLLHIQAGQMDGVLYRDQLDR
FT                   LQRWALACPQRRILAGMEAILQAKTRLNTTNMSTALLVEQLVLQLKR"
FT   CDS_pept        39998..40825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0026"
FT                   /locus_tag="GK0026"
FT                   /product="signal peptidase II"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:GK0026"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74311"
FT                   /db_xref="GOA:Q5L3W7"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3W7"
FT                   /protein_id="BAD74311.1"
FT                   /translation="MYTVVGVRFKKAGKIYYFDPGDAVIPVGEFVIVETVRGIEYGKVV
FT                   IANKQVDENDIVLPLKKVIRVANEKDKWVVEENKKAAREAYDICLRKVEEHGLEMKLVD
FT                   VEYTFDRNKVIFYFTADGRVDFRELVKDLASIFRTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENEEYETAKEQLPDL
FT                   GEYVETPHGFGKVVGLNILERVLQIELPEFGRVVEYTLDELMKNGTLSIRVAD"
FT   CDS_pept        40877..41203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0027"
FT                   /locus_tag="GK0027"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0027"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74312"
FT                   /db_xref="GOA:Q5L3W6"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3W6"
FT                   /protein_id="BAD74312.1"
FT                   /translation="MANMEEQLSYFYRELVQLKQRVTELLEENHQLQIENAHLRRRLEQ
FT                   LSEAWEEGKRKGDKHGKKLIDIGEGYDNLARLYQEGFHICHIHYGSIRTEGDCLFCLSF
FT                   LNKN"
FT   CDS_pept        41267..42013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0028"
FT                   /locus_tag="GK0028"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0028"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74313"
FT                   /db_xref="GOA:Q5L3W5"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3W5"
FT                   /protein_id="BAD74313.1"
FT                   /translation="MELYEDERLDYLFNEELRIIQSPSVFSFSLDAVLLAHFAYMPIQK
FT                   GQIVDLCTGNGVIPLLLSRRTKGTIIGIEIQERLCDMARRSVQYNGLEGQIEIIHGDIK
FT                   EAPQRIGYSRYDVVTCNPPYFPAVGKDELSKNEHIAIARHEIYCTLEDVIRVSSQLLKQ
FT                   GGKAAFVHRPGRLLDLVTLMRQYRLEPKRLRFVYPKEGKEANMILIEGTKDASPDLKVL
FT                   PPLVVYDENNEYTEETKRILYGIISS"
FT   CDS_pept        42029..42940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0029"
FT                   /locus_tag="GK0029"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0029"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74314"
FT                   /db_xref="GOA:Q5L3W4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3W4"
FT                   /protein_id="BAD74314.1"
FT                   /translation="MLWQQKSFTEQTEQGTLYIVPTPIGNLEDMTFRAVRTLQEADVIA
FT                   AEDTRQTKKLLAHFGIHTPLVSYHEHNKYASGRQLVEWLKEGKTVALVSDAGMPGISDP
FT                   GYELIAAALAERCRVVPLPGANAALTALVASGLPTDRFLFVGFLKRAKKEKKEQLLSLK
FT                   TAAETLIFYEAPHRLKETLALMYDIFGNRRIALGRELTKRFEEFIRGDLSDAVAWAEEH
FT                   DIRGEFCLIVEGARDGKKQEQEGEEWWQPLSLVEHVDYYIREHSLSVKEAVKQAASDRN
FT                   MSKRDVYRQYHQQQEEEKKEFL"
FT   CDS_pept        complement(42957..43256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0030"
FT                   /locus_tag="GK0030"
FT                   /product="transition state regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GK0030"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74315"
FT                   /db_xref="GOA:Q5L3W3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3W3"
FT                   /protein_id="BAD74315.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLDINEKDALEIYVDDDRIIL
FT                   KKYKPNMTCVVTGEVSDDNFKLAGGKIILSREGAEILLQEIQQHLEAATDKEKE"
FT   CDS_pept        43653..45605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0031"
FT                   /locus_tag="GK0031"
FT                   /product="methionyl-tRNA synthetase (methionine--tRNA
FT                   ligase)"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:GK0031"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74316"
FT                   /db_xref="GOA:Q5L3W2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3W2"
FT                   /protein_id="BAD74316.1"
FT                   /translation="MEKKTFYLTTPIYYPSDRLHIGHAYTTVAGDAMARYKRMRGYDVM
FT                   YLTGTDEHGQKIQRKAEEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQERHKKV
FT                   VEQIFTRLVEQGDIYLGEYEGWYCTPCESFYTERQLVDGNCPDCGRPVEKVKEESYFFR
FT                   MSKYVDRLLQYYEENPDFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKH
FT                   VIYVWIDALANYITALGYGTDNDEKFRKYWPADVHLVGKEIVRFHTIYWPIILMALGLP
FT                   LPKKVFGHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGADGVFTPE
FT                   GFIERINYDLANDLGNLLHRTVAMIEKYFDGVIPPYRGPKTPFDQELVQTAREVVRQYE
FT                   EAMEGMEFSVALAAVWQLISRTNKYIDETQPWVLAKDEQKRDELAAVMTHLAESLRHTA
FT                   VLLQPFLTRTPERMFAQLGITDHSLKEWDSLYDFGLIPEGTKVQKGEPLFPRLDIEAEV
FT                   EYIKAHMQGGKPAAEPVKEEKKAAEAAEISIDEFAKVDLRVAEVIHAERIKNADKLLKL
FT                   QLDLGGEKRQVISGIAEFYKPEELVGKKVICVANLKPAKLRGEWSEGMILAGGSGGEFS
FT                   LATVDQHVPNGTKIK"
FT   CDS_pept        45742..46512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0032"
FT                   /locus_tag="GK0032"
FT                   /product="deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:GK0032"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74317"
FT                   /db_xref="GOA:Q5L3W1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3W1"
FT                   /protein_id="BAD74317.1"
FT                   /translation="MLFDTHAHLNAVQYEEDLEQVIERARDEGVSHIVVVGFDRPTIDR
FT                   AIELAERYPFIYAAVGWHPVDAIEMTDDDLQMIEQLAAHPKVVALGEMGLDYHWDKSPK
FT                   DVQQEVFRQQIRLAKKVKLPIIIHNREATADILKILQEENAAEIGGIMHCFSGSVEVAK
FT                   QCMDMNFLISLGGPVTFKNAKKPKEVAKEIPLSHLLIETDCPYLTPHPFRGKRNEPSYV
FT                   KYVAEAIAQIKNISFAEVAETTAENAKKLFAIDR"
FT   CDS_pept        46713..47918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0033"
FT                   /locus_tag="GK0033"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0033"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74318"
FT                   /db_xref="GOA:Q5L3W0"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3W0"
FT                   /protein_id="BAD74318.1"
FT                   /translation="MLPNGRKWLDLWRKNVTVTAGGFLAISATTGVAGYEMAKDDVTLI
FT                   KNGNKQEIRTHAKTVKELLAEQNIQPRKEDYVYPSLHSPITDDLHIVWEASKEVTLTVN
FT                   GKKKKIWTTADTVAELLRSQHVAVGAYDKVAPALSAKIQKGMDIGVEKAFPVHVNVGGK
FT                   QQQVWTTSTTVADFLKQQGIQLGQLDRIEPSLHEMVKEQMTIRVIRVKKVTDVVEEPVD
FT                   FAVVTKRDDSLPKGERRVIQPGEKGMVQKTYEVTLENGKETARKLIAVKTLKESKARIV
FT                   AIGTKTVRQAAAPDRPSSRGSDHAAKEFYVTATAYTAYCAGCSGITSTGINLRKNPSAK
FT                   VIAVDPSIIPLGSRVYVEGYGYAIAADTGSGIRGYKIDVFFPERSDAFRWGRKRVKIRV
FT                   LP"
FT   CDS_pept        48191..48739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0034"
FT                   /locus_tag="GK0034"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0034"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74319"
FT                   /db_xref="GOA:Q5L3V9"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3V9"
FT                   /protein_id="BAD74319.1"
FT                   /translation="MIVVEGKDDTAAIRRAVDADTIETNGAAVGADVIERIKLAKERRG
FT                   VIIFTDPDFPGEKIRRTIAEQVPGCKHAFLPREAAKAKNGKGIGVEHASPDEIRRALAN
FT                   VYEEASDWKEEITFAELIEAGLIGGAMARRRRQRLGEELKIGYANGRQFHKRLQVFRIS
FT                   RDAFYAALAHVMQEEADDV"
FT   CDS_pept        48732..49613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0035"
FT                   /locus_tag="GK0035"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:GK0035"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74320"
FT                   /db_xref="GOA:Q5L3V8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3V8"
FT                   /protein_id="BAD74320.1"
FT                   /translation="MYKDIATPGRTKEILERYGFSFKKSLGQNFLIDANILRKIVDVAD
FT                   ISPDTGAIEIGPGIGALTEQLARRAKKVVAFEIDGRLLPILADTLSPYDNVRIFHQDVL
FT                   KADLHAVIAEELADVSDRMVVANLPYYVTTPIIMKLLTERLPIRGMVVMLQKEVADRLA
FT                   AKPGTKDYGSLTIAVQYYTEAEVIMTVPRTVFMPQPNVDSAVIRLVKRQHPPVVVDDEG
FT                   VFFQVVRASFAQRRKTLFNNLTNNLPGGKENKEQIERVLVALGIDPRRRGETLDIAEFA
FT                   SLSNALAPLFGK"
FT   CDS_pept        49753..50652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0036"
FT                   /locus_tag="GK0036"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0036"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74321"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3V7"
FT                   /protein_id="BAD74321.1"
FT                   /translation="MDVIKIGDIVARKSYQCDLLFRVIDMKEKNGEWEAILYGEDVRLV
FT                   ADAPCSDLVVIDEQEQQERKKREIELIEQSYRLFRQDYQAIKQKVEYRATGGYRVEKDF
FT                   FQIPGRVLHLDGDPLYLRKCMDLYERIGVPVHGIYCEESEMPEKVGYWIEQFRPDILVI
FT                   TGHDSYSKSKGKVHELKAYRHSRHFVQTVKEARKKVPHLDQLIIFAGACQSHFESLIRA
FT                   GANFASSPARVNIHALDPVYIVSRLSFTPFTETVDVWDVLRNTLTGEKGLGGVETKGVL
FT                   RTGMPFRLIEDREENRRS"
FT   CDS_pept        50835..51092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0037"
FT                   /locus_tag="GK0037"
FT                   /product="veg protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0037"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74322"
FT                   /db_xref="GOA:Q5L3V6"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3V6"
FT                   /protein_id="BAD74322.1"
FT                   /translation="MPKTLSDIKKTLDSNIGKRLTLRANGGRRKMIERCGILAETYPSV
FT                   FVIELDQKENSFERVSFSYADVLTETVKLTFWDDEQAGGQ"
FT   CDS_pept        51379..51537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0038"
FT                   /locus_tag="GK0038"
FT                   /product="small acid-soluble spore protein (minor
FT                   alpha/beta-type SASP)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0038"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74323"
FT                   /db_xref="GOA:Q5L3V5"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3V5"
FT                   /protein_id="BAD74323.1"
FT                   /translation="MSQRLKEELAKELGFYDVVQREGWGAIRAKDAGNMVRLAIERAER
FT                   QLAGTTE"
FT   CDS_pept        51760..52632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0039"
FT                   /locus_tag="GK0039"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
FT                   (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0039"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74324"
FT                   /db_xref="GOA:Q5L3V4"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3V4"
FT                   /protein_id="BAD74324.1"
FT                   /translation="MRLSIKAPAKINLSLDVLYKRPDGYHEVKMVMTTIDLADRIELVA
FT                   LPEEDAIRIVSQNRFVPDDCRNLAYQAAKLLKETFSIRQGVAISITKHIPVAAGLAGGS
FT                   SNAAATLRGLNKLWQLGLTLDELAELGAKIGSDVAFCVYGGTALATGRGEIITPIPSPP
FT                   PCWVVLAKPPIGVSTAEVYRNLELERVSHPDVDAMVRAIERQDYAAICRLVGNVLEEVT
FT                   LKKYPEVAHIKEQMKRFGADAVLMSGSGPTVFGLIEHDSRMQRVYNGLRGFCDQVFAVR
FT                   MLGERHSLD"
FT   CDS_pept        52688..53509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0040"
FT                   /locus_tag="GK0040"
FT                   /product="transcriptional repressor of the purine operon"
FT                   /db_xref="EnsemblGenomes-Gn:GK0040"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74325"
FT                   /db_xref="GOA:Q5L3V3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3V3"
FT                   /protein_id="BAD74325.1"
FT                   /translation="MKLRRSGRLVDMTHYLLERPHQLIPLTFFAERYESAKSSISEDLA
FT                   IIKQTFEQQGIGTVRTLPGAAGGVQYIPKMAAEEAEEVVAYLCEQLSRPDRLLPGGYLY
FT                   MTDILGDPRIMNKIGRLYASMFADRPVDVVMTIATNGIPFAYAIANFLYVPVVIVRHDN
FT                   KVTEGPMVSINYVSGSSKRIQTMVLSKRSLAEGANVLIVDDFMKAGGTINGMISLLQEF
FT                   NGNVSGIGVLVESEEAKERLVDEYISLVKLSEVDVKEKRISVKEGNYKAFL"
FT   CDS_pept        53553..53927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0041"
FT                   /locus_tag="GK0041"
FT                   /product="translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:GK0041"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74326"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3V2"
FT                   /protein_id="BAD74326.1"
FT                   /translation="MRKVETTKAPQAIGPYSQGIIVNNMFYSSGQIPLTPEGELVKGDI
FT                   QAQTHQVFQNLKAVLEAAGASLDTVVKTTVFLKNMDDFAAMNEVYSQYFPNHKPARSCV
FT                   EVARLPKDVLVEIEVVALVP"
FT   CDS_pept        54053..54343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="GK0042"
FT                   /product="stage V sporulation protein G"
FT                   /db_xref="EnsemblGenomes-Gn:GK0042"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74327"
FT                   /db_xref="GOA:Q5L3V1"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3V1"
FT                   /protein_id="BAD74327.1"
FT                   /translation="MEVTDVRLRRVNTEGRMKAIASITLDNEFVVHDIRVIDGNNGLFV
FT                   AMPSKRTPDGEFRDIAHPINSATRGKIQEAILAEYHRLGKLEEELEEAGAS"
FT   CDS_pept        54476..55852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0043"
FT                   /locus_tag="GK0043"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /db_xref="EnsemblGenomes-Gn:GK0043"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74328"
FT                   /db_xref="GOA:Q5L3V0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3V0"
FT                   /protein_id="BAD74328.1"
FT                   /translation="MKRYAVILAAGQGTRMKSKRYKVLHPICGKPMVQHVIDQVSKLGV
FT                   EKAIAVVGFGAEQVKEQLGSQCEYALQEEQLGTAHAVMQAAPHLRGLEGVTIVVCGDTP
FT                   LITAETMEMLIEHHMAAKAKATVLTAIADDPSGYGRIVRNEAGHVEKIVEHKDASEQER
FT                   NIREINTGTYCFDNETLFQALTKVTNQNAQGEYYLTDVIEIIKADGGVVSAYQAPSFEE
FT                   TIGVNDRIALAEAERIMRARICRQHMKNGVTIIDPASTYISAEAVIGRDTVIYPGTVIE
FT                   GETVIGEDCVIGPNSEIKNCYIGHRTSIRHSVAHDSEIGSDVTIGPFAHIRPLSKIDDE
FT                   VRIGNFVEVKKSTFGKGSKASHLSYIGDAEVGADVNLGCGSITVNYDGVNKHMTKIEDG
FT                   AFIGCNVNLIAPVTVGQGAYVAAGSTITDDVPGRALAIARARQVNKEHYVDRLPGKKKS
FT                   "
FT   CDS_pept        55913..56812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="GK0044"
FT                   /product="ribose-phosphate pyrophosphokinase
FT                   (phosphoribosyl pyrophosphate synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0044"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74329"
FT                   /db_xref="GOA:Q5L3U9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3U9"
FT                   /protein_id="BAD74329.1"
FT                   /translation="MKLAKEIAEVMGIELGKCSVSRFSDGEIQINIEESIRGDDVFVIQ
FT                   STSVPVNEHLMELLIMIDALKRASARTINIVMPYYGYARQDRKARSREPITAKLVANLL
FT                   ETAGASRVITLDLHAPQIQGFFDIPIDHLMGVPILADYFKSKQLEDIVVVSPDHGGVTR
FT                   ARKLADRLKAPIAIIDKRRPKPNVAEVMNIVGQVAGKTAILIDDIIDTAGTITLAANAL
FT                   AENGAKEVYACCTHPVLSGPAIERIQNSRIKELVVTNSIALPEEKKIDKIVELSVAPLI
FT                   AEAISRVYEMKSVSVLFD"
FT   CDS_pept        56890..57522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="GK0045"
FT                   /product="50S ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:GK0045"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74330"
FT                   /db_xref="GOA:Q5L3U8"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3U8"
FT                   /protein_id="BAD74330.1"
FT                   /translation="MAIVLEAKERADKKRSTLHRIRSQGGIPAILYGKKVENKMIFVST
FT                   AELEKALREGGRTSLLTLKVGGEEHSVLLRELQRDPLRGHLLHADFQAVDMSTEVDIDV
FT                   EVRLVGEAPGVKDGGVLQQNLHELSIRVLPANIPPVIEVDISGLQVGDTVTVGDVKTDG
FT                   KFEINHEPSEVIATILPPQQEEEIDSGEQQEAGQPDAAEGRETTPEE"
FT   CDS_pept        57583..58143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVC"
FT                   /locus_tag="GK0046"
FT                   /product="stage V sporulation protein C (peptidyl-tRNA
FT                   hydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0046"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74331"
FT                   /db_xref="GOA:Q5L3U7"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3U7"
FT                   /protein_id="BAD74331.1"
FT                   /translation="MKLFVGLGNPGKEYEQTRHNVGFFVIDELAKRWNVSLKTAKFRGL
FT                   FGTASVSGEKVALCKPLTYMNLSGECVRPLMDYYDIAIDDVIVIYDDLDLPPGKIRLRL
FT                   KGSSGGHNGVKSLIHHLGTEQFKRIRIGIGRPAGGQPVTDYVLGRFTEEEKPAVDKAVL
FT                   RAADACEQAVKAPFIQVMNDFNE"
FT   CDS_pept        58254..58484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0047"
FT                   /locus_tag="GK0047"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0047"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74332"
FT                   /db_xref="GOA:Q5L3U6"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3U6"
FT                   /protein_id="BAD74332.1"
FT                   /translation="MALHYYCRHCGAKVGTIEQMPIYSEKLGFHHLTEEERLEMISYEP
FT                   NGDIHVKTICEDCQEALARNPEWHQYEKFIH"
FT   CDS_pept        58574..62107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0048"
FT                   /locus_tag="GK0048"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:GK0048"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74333"
FT                   /db_xref="GOA:Q5L3U5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3U5"
FT                   /protein_id="BAD74333.1"
FT                   /translation="MLSLHRYLAENQDVRTIIEGLHVRLKEQLVAGLSGSARSVFISTL
FT                   YKETGRPLLVVSHNLFQAQKMYDDLVSLLGPEDVFLYSVNEVIAAEMAVASPELKAQRL
FT                   EIMNHWVQGGKGVVVCPVAGLRRLLPPPSLWKQYLFTFSVGQEFDVERCKQKFVQMGYK
FT                   RVGTVSAPGEFSVRGGIIDIYPLTAELPYRIELFDTEIESIRTFTPDDQRSQGQIERIM
FT                   IGPADEIILDGETRRRGIERIEAGLASSLETMKDEAAKQRMYEHIHAELEQLREGQEIE
FT                   QQYKYMSLFYEKVASLLDYLPEDGVLLMDEMSRLQEAAERLDREEAEWYTSLLDGGKMI
FT                   HGVPLSHSFSELLQKHRFQRVYLSLFLRHVPYAHPQNVVNITCKQMQNFHGQMALLQSE
FT                   VERWTKANYAVVFLAPNAERVKKLQSLLQDYEIDALPLARDAALLHGKCQLLEGDLNTG
FT                   FELPLQKIAVITEEELFKKRVKRPVRRQKLSNAERIKSYAELQVGDYVVHVNHGIGKYL
FT                   GIETLEINGVHKDYIHIQYQGGDTLYVPVDQIDQVQKYVGSEGKEPKIYKLGGSEWKKV
FT                   KRKVESSVQDIAEDLIKLYAEREASKGYAFSPDTEMQREFEAAFPYQETEDQLRSIEEI
FT                   KRDMESDKPMDRLLCGDVGYGKTEVALRAAFKAIMDGKQVAFLVPTTILAQQHYETVRE
FT                   RFQGFPIKVGLLNRFRTKKQQAETIKGLKDGTIDMVIGTHRLLSKDVEFKDLGLLIIDE
FT                   EQRFGVAHKEKIKQLKANIDVLTLTATPIPRTLHMSMIGVRDLSIIETPPENRFPVQTY
FT                   VMEYTPELVKEAIERELARDGQVFFLYNHIEDIDLKAEEIAQLVPEARVTYVHGRMSET
FT                   ELESTILAFLEGQYDVLVTTTIIETGIDIPNVNTLIVYDADRMGLSQLYQLRGRVGRSN
FT                   RVAYAYFTYRKDKVLNEAAEKRLQAIKEFTELGSGFKIAMRDLSIRGAGNILGAEQHGF
FT                   IDSVGFDLYSQMLKEAIEKRRGIKREDEQPDVVIDVEVDAYIPSTYIADELQKIEMYKR
FT                   FKAVETLEDIEELREEMVDRFGDYPDEVAYLFQIAELKVLAKQLGVESMKQHKQQIDIL
FT                   FTEPASKTVEIQRLSDIGRRHGRLFGFGMDGAKLKIVLYIKEMKPHEWLMILEETLRRL
FT                   SGVEKEKSVTA"
FT   CDS_pept        62316..62852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="GK0049"
FT                   /product="stage V sporulation protein T (transcriptional
FT                   regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0049"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74334"
FT                   /db_xref="GOA:Q5L3U4"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3U4"
FT                   /protein_id="BAD74334.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYAEALFDSLGQPVLICDRDVYIAVAGVSKKEYMNKSVSPLVEK
FT                   AMEDRNSILHTEEGEVELVDGMTETLKSYTIGPIVANGDPIGAVIILSREKTLGEVEHK
FT                   AVETAASFLARQMEQ"
FT   CDS_pept        63128..64678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0050"
FT                   /locus_tag="GK0050"
FT                   /product="amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GK0050"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74335"
FT                   /db_xref="GOA:Q5L3U3"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3U3"
FT                   /protein_id="BAD74335.1"
FT                   /translation="MGNVWKGAAILTAAALAAKLLSALYRVPYQNMVGDIGFYIYQQVY
FT                   PIYGIVVALSLTGYPVAVSKLVAERLAGQDEAGAAASVRVALLVLSVLGVILFASLYLG
FT                   AGVIASAMGDGRLTPLVRLLSFSFLLFPPIALLRGYFQGRHDMTPTAASQVGEQFVRVA
FT                   AILGLSYGAVQRGADVYACGMAAVAGTLIGMAAALFILLFFLSRRRRLKTSGRTPPAWD
FT                   RQVGRRLLTAGTVICLTNMALTLIPLVDSFLFVPLLQEAGARLDEVQRLKGVYDRGQPL
FT                   IQLGTVVGTSFSLALVPLLSGARRQGAVFAYGALSIRLAVVIGLGASLGLICLIRPINA
FT                   MLFENDYGSSVLAVLSSSVFFTTIALTVSALLQGMGREWTAAAGVALAVAGKAALMHWL
FT                   APRFGALGAAAATTGAYALMAGFLCAFLPREYRTAGRKYMYPTVKAAAMMAVVLHGYRW
FT                   LMDSSSEGRLWAAAEALGGVAIGAVVYLACIVKGHVFSEQELAAFPLANKFRLRLGGR"
FT   CDS_pept        64685..66145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0051"
FT                   /locus_tag="GK0051"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0051"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74336"
FT                   /db_xref="GOA:Q5L3U2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3U2"
FT                   /protein_id="BAD74336.1"
FT                   /translation="MNTIYVFGLGAGDVKQLPIGVYRKLKRAHPLFLRTKEHPVVKWLT
FT                   EEGIAFTSFDEVYEKHEQFADVYADIVDQLTEQAKRGDVFYAVPGHPLVAERTVQLLFE
FT                   AERRGVCRIVIEGGQSFLDALFTAVRIDPIEGFQLLDATTFRGEEWSPSLHAVFCQVYD
FT                   SFVASNVKLSLMEQLPDDYPIYIVTAAGTKDEQVKRVPLYELDRETELDNLTSVYVPPV
FT                   KDEPLLYHRFETLRRVIATLRGPNGCPWDRKQTHASLKRYLLEEAYELLEAIDEGDDDH
FT                   MVEELGDVLLQVMLHAQIGADRGLFSIDDVIRTLTAKMIRRHPHVFGDVTAETAEQVVA
FT                   NWEKIKEKEKGGGLSESILADIPKSLPGTMRAYELQKRAAKVGFDWDDAAPIWQKVEEE
FT                   MAEFRAETSGGRRDRLVGEFGDLLFALINLARYYGIQPEEALQMANDKFARRFAYIEEQ
FT                   VRKSGRSITSFSLAELDRFWEEAKENER"
FT   CDS_pept        66159..66440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0052"
FT                   /locus_tag="GK0052"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0052"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74337"
FT                   /db_xref="GOA:Q5L3U1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3U1"
FT                   /protein_id="BAD74337.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEIADQGRVWINGHVAKASSDVKVGD
FT                   ELTMQFGQKRVTVKVTDLKETTKKEEATGLYELIREERTTPAPEQDDV"
FT   CDS_pept        66542..66868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0053"
FT                   /locus_tag="GK0053"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0053"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74338"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3U0"
FT                   /protein_id="BAD74338.1"
FT                   /translation="MEMRGMNMSRHDEFGGSTNKGPVQEHDVIMRGRRLLDITGVKQVE
FT                   SFDNEEFLLETVMGFLAIRGQNLQMKNLDVDKGVVSIKGRIFDLVYLDDHQEKAKGFFS
FT                   KLFK"
FT   CDS_pept        66865..67497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0054"
FT                   /locus_tag="GK0054"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0054"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74339"
FT                   /db_xref="GOA:Q5L3T9"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3T9"
FT                   /protein_id="BAD74339.1"
FT                   /translation="MNVSIQLYTMLAMIGMGGWLGLAWDTYSRMLKRHERAHWLVFVND
FT                   VLFWAVQALIVFYVLLFVNEGELRFYLFLALLCGYAAYQSLLRSFYVRVLEWFIGLAVR
FT                   LGQTLVQLFRLMVMRPLILLGQMALALLLFAWRLLLWIVRFVLLAVWKMIRLLLAPLRW
FT                   TGIMIWRRVPPQRRAGVEKFFRHLKGFAGQIKNTKEKISMWFAKRRE"
FT   CDS_pept        67514..67885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0055"
FT                   /locus_tag="GK0055"
FT                   /product="cell-division initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0055"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74340"
FT                   /db_xref="GOA:Q5L3T8"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3T8"
FT                   /protein_id="BAD74340.1"
FT                   /translation="MNVPQRTNVTKLSSTYIAEHEEKKQKAARRRRVVAVRLVVWSLLF
FT                   AIFASALVYTLHSQAKAIDAKTAEQQKLKEQLAELERKEKQLKEEMKKLHDDDYIAELA
FT                   RKKYYLSKDGEIIFVLPEK"
FT   CDS_pept        68004..68402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0056"
FT                   /locus_tag="GK0056"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0056"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74341"
FT                   /db_xref="GOA:Q5L3T7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3T7"
FT                   /protein_id="BAD74341.1"
FT                   /translation="MSIEVGSKLQGKVTGITKFGAFVELPEGVTGLVHISEVADNYVKD
FT                   INDHLKVGDMVYVKVINVGQDGKIGLSIRKAKDTPSSQRPRHRTNDRSAADSLEQKISR
FT                   FLKESEDRLASLRRHTESKRGGRGARRG"
FT   tRNA            68576..68652
FT                   /gene="trnC-Met"
FT                   /product="transfer RNA trnC-Met"
FT   tRNA            68665..68736
FT                   /gene="trnC-Glu"
FT                   /product="transfer RNA trnC-Glu"
FT   CDS_pept        68934..71414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="GK0057"
FT                   /product="stage II sporulation protein E (serine
FT                   phosphatase)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0057"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74342"
FT                   /db_xref="GOA:Q5L3T6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3T6"
FT                   /protein_id="BAD74342.1"
FT                   /translation="MERVERGTVRRSISEVPIHDTQATVSRWMRHVKLRLGHLFIHQGF
FT                   LLLLVGFLLGRALILSKLTPFALPFFVSVYMLRRDKAAFALISLLAGALTLSLDVALFV
FT                   GVSIFGFLFIYGWVRRVISESLKIVPFVVFVLSLSAKWLISYYWLGERSVYGAAMAVVE
FT                   AGLSLVLTLIFMQSIPLLTVQKHKHALRAEEIISLIILLASMLTGMIGWAVYGLSLEHV
FT                   MSRYLVLLFAFVAGAATGSTVGVVTGLVLSLANVGNLSEMSLLAFAGLLGGLLREGKKL
FT                   GVAFGLLVATLLLGLYGEGKSELVPTLFESGIAIMLFFGTSRSLTEKIAKYIPGTAEYI
FT                   NEQQQYVRKIRDMTVQRVSQFSNVFQALAESFSPEPLPDANEYSDREVDYFLSDITEKT
FT                   CQTCFKKTQCWADNFRTTYAYMKQMMGEADEKTLSQNHQLLREWERYCVKAGKVVDAIE
FT                   KEMVAYQANRKLKRQIHESRKLVAEQLLGVSQVMDDFAKEMQKEQENHYLQEEQIYHAL
FT                   QEFGIEVGHVDIYSLEKGNIDIEMSIPYCEGRGECEKLIAPMLSDILGETIVVKREECA
FT                   AYPNGYCRVAFGSTKAFVVETGVAFAAKGGGFISGDSYATIELATGKYAVAISDGMGNG
FT                   ERAHDESRETLRLLQKILQTGMDESIAIKSINSILALRTTEDMYATLDLAIIDLQNAAT
FT                   KFLKIGSTPSFIKRGDKVMKVEASNLPMGIIKEVEFDVVTEQLKSGDLLIMMSDGVFEG
FT                   PMNVENHDVWMKRKIQELKTNDPQEVADLIMEEVIRQCGGEIEDDMTVVVAKVRHNTPK
FT                   WATIPAYMYMKKAQ"
FT   CDS_pept        71480..72220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0058"
FT                   /locus_tag="GK0058"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0058"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74343"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3T5"
FT                   /protein_id="BAD74343.1"
FT                   /translation="MRKGTLRQILLITDGCSNHGEDPAAMAALAREQGITVNVIGILDQ
FT                   GAMDENGRREIEAIAAAGGGMSQVVYAKQLSQTVQMVTRQAMTQTLQGLVNRELKQIFG
FT                   SDVSLEDLPPDKRGQVMEVVDELGETVALDVLILIDTSGSMKTKLPTVKEALIDLSLSL
FT                   NARMGENRFSVFIFPGKRAHAEKMIDWTPRIEELSTIFPKLASGGLTPTGPALREAIAY
FT                   FERKRSLRSWIGDGDEPYIEESSL"
FT   CDS_pept        72183..73157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0059"
FT                   /locus_tag="GK0059"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0059"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74344"
FT                   /db_xref="GOA:Q5L3T4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3T4"
FT                   /protein_id="BAD74344.1"
FT                   /translation="MAMSHTSKNRLCNLPPGTVITGKWHGRSYRLLRRLGSGANGVVYL
FT                   AENGRTRVAVKLSDDYASLASEMNILRRFAKVQGAALGPSLLEADDWQSPFARETIPFY
FT                   VMEYIEGENFAAFIRRRGKEWAPVLVMQLLSVLDRLHQEGWVFGDLKPDNLIVTGSPPS
FT                   VRLLDVGGTTLQGRAVKEFTELYDRGYWGLGSRKAEPSYDLFAAAMVMISSCCPGPIEK
FT                   KGDGRAQLLSIIETDRFLTRYKEVLQKALDGRYRKAADMRRDLLAASSRHTSAENERKA
FT                   VPSRRSGRQVKRRRQARGIVETVVIAAALLGAYAFYIYWQLAM"
FT   CDS_pept        73226..74620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0060"
FT                   /locus_tag="GK0060"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0060"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74345"
FT                   /db_xref="GOA:Q5L3T3"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="PDB:3A2K"
FT                   /db_xref="PDB:3HJ7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3T3"
FT                   /protein_id="BAD74345.1"
FT                   /translation="MIDKVRAFIHRHQLLSEGAAVIVGVSGGPDSLALLHVFLSLRDEW
FT                   KLQVIAAHVDHMFRGRESEEEMEFVKRFCVERRILCETAQIDVPAFQRSAGLGAQEAAR
FT                   ICRYRFFAELMEKHQAGYVAVGHHGDDQVETILMRLVRGSTSKGYAGIPVKRPFHGGYL
FT                   IRPFLAVSRAEIEAYCRQMGLSPRCDPSNEKDDYTRNRFRHHIVPLLRQENPRLHERFQ
FT                   QYSEMMAEDEQFLEELAADALNKVMEKQHRDAALSIGPFLELPRPLQRRVLQLLLLRLY
FT                   GGVPPTLTSVHIGHILMLCERGRPSGMIDLPKGLKVIRSYDRCLFTFDAESGEKGYWFE
FT                   LPVPALLPLPNGYAIISEFGEHYPRKQAGNDWFVVDPASVSLPLRVRTRRRGDRMVLKG
FT                   TGGTKKLKEIFIEAKIPRMERDRWPIVEDADGRILWVPGLKKSAFEAQNRGQARYILLQ
FT                   YQAMNS"
FT   CDS_pept        74634..75215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0061"
FT                   /locus_tag="GK0061"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:GK0061"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74346"
FT                   /db_xref="GOA:Q5L3T2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3T2"
FT                   /protein_id="BAD74346.1"
FT                   /translation="MGMKDDIQKVLITEEEIQAKVKELGGLLTKEYEGRFPLAVGVLKG
FT                   AMPFMADLLKHIDTYLEMDFMDVSSYGNATVSSGEVKIVKDLNTSVEGRDILIIEDIID
FT                   SGLTLSYLVDLFRYRKANSIKIVTLLDKPSGRKADIQADYTGFTVPDEFVVGYGLDYAE
FT                   KYRNLPFIGVLKPEVYQSRTVAGRRPNCLY"
FT   CDS_pept        75273..77171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0062"
FT                   /locus_tag="GK0062"
FT                   /product="cell-division protein and general stress protein
FT                   (class III heat-shock)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0062"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74347"
FT                   /db_xref="GOA:Q5L3T1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3T1"
FT                   /protein_id="BAD74347.1"
FT                   /translation="MNRIFRNTIFYLLIFLVVIGVVSFFNGTNQRTEPMTYDAFITHLE
FT                   NGDVKSFSIKPERGVYEIKGQLKTYSEGQYFSTYVMNSDKVLDRIDAAAARTRVEVVPA
FT                   DETSGWVTFFTSIIPFVIIFILFFFLLNQAQGGGSRVMNFGKSRARLYTDDKRKVRFRD
FT                   VAGADEEKEELVEIVEFLKDPRKFAELGARIPKGVLLVGPPGTGKTLLARAVAGEAGVP
FT                   FFSISGSDFVEMFVGVGASRVRDLFETAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDER
FT                   EQTLNQLLVEMDGFNGNEGIIIIAATNRPDILDPALLRPGRFDRQITVDRPDVKGREAV
FT                   LRVHARNKPLDESVDLKTIAMRTPGFSGADLENLLNEAALVAARRNKKKIDMSDIDEAT
FT                   DRVIAGPAKKSRVISEKERRIVAFHEAGHTVIGMVLADAEMVHKVTIVPRGQAGGYAVM
FT                   LPKEDRYFMTKAELMDKITGLLGGRVAEEIVFNEVSTGAHNDFQRATNIARRMVTEFGM
FT                   SEKLGPLQFGQPSGQVFLGRDLHNEQNYSDKIAYEIDLEIQRIIKECYEKAKQILTQHR
FT                   DKLDLIANTLLEVETLDAEQIKHLFEHGTLPKDRNGREESGKSDGDVKINIQKKEE"
FT   CDS_pept        77299..78075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0063"
FT                   /locus_tag="GK0063"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0063"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74348"
FT                   /db_xref="GOA:Q5L3T0"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3T0"
FT                   /protein_id="BAD74348.1"
FT                   /translation="MIFVLDVGNTNTVLGVYDGDELKHHWRIETSRSKTEDEYGMMIKA
FT                   LLNHVGLQFSDIRGIIISSVVPPIMFALERMCLKYFHIKPLIVGPGIKTGLDIKYDNPR
FT                   EVGADRIVNAVAGIHLYGSPLIIVDFGTATTYCYINEHKQYMGGAIAPGIMISTEALFA
FT                   RAAKLPRIEIARPDDIIGKNTVSAMQAGILYGYVGQVEGIVSRMKAKSKIPPKVIATGG
FT                   LAPLIASESDIIDVVDPFLTLTGLKLLYEKNTEKKG"
FT   CDS_pept        78084..78974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0064"
FT                   /locus_tag="GK0064"
FT                   /product="chaperonin (heat shock protein 33) (HSP33)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0064"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74349"
FT                   /db_xref="GOA:Q5L3S9"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3S9"
FT                   /protein_id="BAD74349.1"
FT                   /translation="MKMGDYLVKALAYNGQVRAYAARTTETVAEAQRRHQTWPTASAAL
FT                   GRALTAGVMMGAMLKGEETLTIKIDGGGPIGVILVDSNARGEVRGYVTNPHVHFELNEH
FT                   GKLDVARAVGKNGMLTVVKDLGLRDFFTGQVPLISGELGDDFTYYFASSEQIPSSVGVG
FT                   VLVNPDHTIRAAGGFIIQLMPGTEENTITRIEERLKQIPPVSRMIERGLSPEQLLEQLL
FT                   GDGGVRVLETMPVSFVCRCSRERIADALISLGPEEIQDIIDKEGQAEASCHFCNETYHF
FT                   DKAELEQLKQLAKKE"
FT   CDS_pept        79061..79987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0065"
FT                   /locus_tag="GK0065"
FT                   /product="cysteine synthase(O-acetyl-L-serine
FT                   sulfhydrylase)"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:GK0065"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74350"
FT                   /db_xref="GOA:Q5L3S8"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="PDB:2EGU"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3S8"
FT                   /protein_id="BAD74350.1"
FT                   /translation="MARTVNSITELIGDTPAVKLNRIVDEDSADVYLKLEFMNPGSSVK
FT                   DRIALAMIEAAEKAGKLKPGDTIVEPTSGNTGIGLAMVAAAKGYKAVLVMPDTMSLERR
FT                   NLLRAYGAELVLTPGAQGMRGAIAKAEELVREHGYFMPQQFKNEANPEIHRLTTGKEIV
FT                   EQMGDQLDAFVAGVGTGGTITGAGKVLREAYPNIKIYAVEPADSPVLSGGKPGPHKIQG
FT                   IGAGFVPDILDTSIYDGVITVTTEEAFAAARRAAREEGILGGISSGAAIHAALKVAKEL
FT                   GKGKKVLAIIPSNGERYLSTPLYQFED"
FT   CDS_pept        80102..81523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0066"
FT                   /locus_tag="GK0066"
FT                   /product="para-aminobenzoate synthases component I"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:GK0066"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74351"
FT                   /db_xref="GOA:Q5L3S7"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3S7"
FT                   /protein_id="BAD74351.1"
FT                   /translation="MEQRRRRLKRTIDYRGRDWFRQYEQLAYSRPHHVLLESGQGGRYS
FT                   IIGLDPIGVIRADERRLIIKQRGVETVLDGSPLEGLRQWLRCFAVPDEGESLPCQGGLI
FT                   GFISYDAVRYMERLPVLAQDDLRLPLMYFFLFDDVAIYDHQTEQLHLLAYANEGEESEA
FT                   NRRLARHARMWLEDRNEALVWPLAASTAAPSVSMTKERFMDAVRRVQRYIAAGDVFQVN
FT                   LSVRQSQPLVTHPFAVYKQLRMLNPSPYMAYLHTPEFQVVSGSPELLVRKRGWRLETRP
FT                   IAGTRSRGRTAAEDEQIARKLLASEKERAEHAMLVDLERNDLGRVCAYGTVRVDEWMTV
FT                   EKYSHVMHIVSHVSGTMTMEHDAFSVIRAMFPGGTITGAPKVRTMEIIEELEPVRRGLY
FT                   TGSIGWIDFQGNMELNIAIRTMVVKDGLAHVQAGAGIVIDSNPEHEYKECVKKAAALWK
FT                   AKELSEAEALFPSMR"
FT   CDS_pept        81538..82104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0067"
FT                   /locus_tag="GK0067"
FT                   /product="para-aminobenzoate synthases component II"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:GK0067"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74352"
FT                   /db_xref="GOA:Q5L3S6"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3S6"
FT                   /protein_id="BAD74352.1"
FT                   /translation="MIDNYDSFTYNLVQYLGVLGEELIVKRNDEITVAEIERLRPDFIM
FT                   ISPGPCTPNEAGVSLEVIDRFAGQIPIFGVCLGHQAIAQAFGGRVVRAPRLMHGKTSSV
FT                   YHDGETIFCGVPNPFTATRYHSLIVEKETLPDCFVVSAWTKEDEVMAIRHKTLPVEGVQ
FT                   FHPESIMTSHGMQLLKNFINTYKKA"
FT   CDS_pept        82110..82985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0068"
FT                   /locus_tag="GK0068"
FT                   /product="4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0068"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74353"
FT                   /db_xref="GOA:Q5L3S5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3S5"
FT                   /protein_id="BAD74353.1"
FT                   /translation="MYVYINGAVVPREEAQLSAFDHGFLYGLGLFETFRTYSGHPFLLD
FT                   DHLARLNKGLSELHIERQFGRAEAVAIIEQLLEANGLRDAYVRFNVSAGVGDLGLPIER
FT                   YRNPTVIVYMKPLPPPVPPEGKEGVVLAARRNSPEGNERLKSHHYLNNMIGKWELGHRP
FT                   HAEGIFLNSDGAVAEGIVSNIFWVKDGIVYTPAPAVGILNGITRQFIIALLKQLRIPVE
FT                   EGVYPLSHLLQADEAFITNSVQEIVPLCRIGHCVYQGKNGPVVRALQHHYRRLTHRLWT
FT                   RNELAERMND"
FT   CDS_pept        82985..83836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0069"
FT                   /locus_tag="GK0069"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:GK0069"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74354"
FT                   /db_xref="GOA:Q5L3S4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3S4"
FT                   /protein_id="BAD74354.1"
FT                   /translation="MTTSMRPLRLQCRGHELDLNKKTLIMGIVNVTPDSFSDGGRFYDV
FT                   ENAVKHAKRLVAEGADIIDIGGESTRPGADPVPLDEELRRVIPAVKAIAKAVSVPISID
FT                   TYKAEVARQAMEAGAHIINDVWGAKADPDMARVAATYGAPIILMHNRRDMAYRDLISDM
FT                   IADLKESIRIVKEAGVKDENIILDPGIGFAKTVEHNLEVMRRLDEFAALGYPLLLGTSR
FT                   KRFIGHVLGVPVEERVEGTGATVCLGIMKGVHIVRVHDVLPIARMAKMMDAMLGKGESG
FT                   HR"
FT   CDS_pept        83844..84188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0070"
FT                   /locus_tag="GK0070"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:GK0070"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74355"
FT                   /db_xref="GOA:Q5L444"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L444"
FT                   /protein_id="BAD74355.1"
FT                   /translation="MQGMEFYGYHGVFREENILGQRFLVDVTLEIDLQPAGRSDCLEYT
FT                   VNYADVYERCRAIVEERTFALIEAVAEAIAADLLAAFPVVERCIVKVTKPNPPIRGHYQ
FT                   HVAVEIDRGR"
FT   CDS_pept        84189..84716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0071"
FT                   /locus_tag="GK0071"
FT                   /product="7,8-dihydro-6-hydroxymethylpterin
FT                   pyrophosphokinase
FT                   (2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase)"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:GK0071"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74356"
FT                   /db_xref="GOA:Q5L443"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L443"
FT                   /protein_id="BAD74356.1"
FT                   /translation="MENIAYLALGSNLGDRVSYLRSAIEALHHHQEIFITSSSSIYETD
FT                   PVGYVNQGKFLNMVIEVATTLSPFALLDVTQQIERQLGRKREIRWGPRTLDLDILLYNH
FT                   ENIETEQLTIPHPRMAERAFVLIPLFEVNSHVAIPNLSEPLIDIIGRLPDKKGVHVWKR
FT                   KDGEDVFALFES"
FT   CDS_pept        84668..84889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0072"
FT                   /locus_tag="GK0072"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0072"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74357"
FT                   /db_xref="GOA:Q5L442"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L442"
FT                   /protein_id="BAD74357.1"
FT                   /translation="MEAERWGRRIRAFRKLKGYTQERLAKELGISVSILGEIERGNRMP
FT                   SDSLVGQIAERLNISVEELAPPKLESNK"
FT   CDS_pept        84906..85907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0073"
FT                   /locus_tag="GK0073"
FT                   /product="transcriptional regulator involved in nitrogen
FT                   regulation (NifR3/Smm1 family)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0073"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74358"
FT                   /db_xref="GOA:Q5L441"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L441"
FT                   /protein_id="BAD74358.1"
FT                   /translation="MFRIGDVEIKNRVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSD
FT                   KGIVYNNEKTLNMLYIDEREKPISLQIFGGEKETLVKAAKFVDKNTNADIIDINMGCPV
FT                   PKITNCDAGAKWLLDPNKIYDVVAAIVDAVEKPVTVKMRIGWDEKHIYAVENAQAVERA
FT                   GGKAVAVHGRTRVQMYEGKADWNIIKQVKEAVNIPVIGNGDVKTPQDAKRMLEETGVDG
FT                   VMIGRAALGNPWMIYRTVRYLETGELIPEPTPREKIDVCLLHLDRLIALKGEYIAVKEM
FT                   RKHAAWYLKGIRGAAKIRNAINECETRDELAALLLRVAEEAEVQAAANAEAV"
FT   CDS_pept        85998..87482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0074"
FT                   /locus_tag="GK0074"
FT                   /product="lysyl-tRNA synthetase (lysine--tRNA ligase)"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:GK0074"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74359"
FT                   /db_xref="GOA:Q5L440"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L440"
FT                   /protein_id="BAD74359.1"
FT                   /translation="MSHEELNDQLRVRREKLKKIEELGVDPFGKRFERTHKAQELFELY
FT                   GDLSKEELEEKQIEVAVAGRIMTKRGKGKAGFAHIQDVTGQIQIYVRQDDVGEQQYELF
FT                   KISDLGDIVGVRGTMFKTKVGELSIKVSSYEFLTKALRPLPEKYHGLKDIEQRYRQRYL
FT                   DLIMNPESKKTFITRSLIIQSMRRYLDSRGYLEVETPMMHAVAGGAAARPFITHHNALD
FT                   MTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDI
FT                   MELTENLIAHIATEVLGTTKIQYGEHVVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEE
FT                   ARELAKEHGVEVAPHMTFGHIVNEFFEQKVESHLIQPTFIYGHPVEISPLAKKNPDDPR
FT                   FTDRFELFIVGREHANAFTELNDPIDQRQRFEAQLKEREQGNDEAHEMDEDFLEALEYG
FT                   MPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRHK"
FT   rRNA            87717..87820
FT                   /gene="rrn-5S-1"
FT                   /product="5S ribosomal RNA"
FT   tRNA            87829..87904
FT                   /gene="trnD-Val"
FT                   /product="transfer RNA trnD-Val"
FT   tRNA            88455..88530
FT                   /gene="trnD-Lys"
FT                   /product="transfer RNA trnD-Lys"
FT   tRNA            88541..88625
FT                   /gene="trnD-Leu1"
FT                   /product="transfer RNA trnD-Leu1"
FT   tRNA            88637..88711
FT                   /gene="trnD-Gly"
FT                   /product="transfer RNA trnD-Gly"
FT   tRNA            88728..88813
FT                   /gene="trnD-Leu2"
FT                   /product="transfer RNA trnD-Leu2"
FT   tRNA            88817..88890
FT                   /gene="trnD-Arg"
FT                   /product="transfer RNA trnD-Arg"
FT   tRNA            88895..88968
FT                   /gene="trnD-Pro"
FT                   /product="transfer RNA trnD-Pro"
FT   tRNA            88981..89053
FT                   /gene="trnD-Ala"
FT                   /product="transfer RNA trnD-Ala"
FT   rRNA            89412..90965
FT                   /gene="rrnC-16S"
FT                   /product="16S ribosomal RNA"
FT   rRNA            91352..94281
FT                   /gene="rrnC-23S"
FT                   /product="23S ribosomal RNA"
FT   rRNA            94689..94805
FT                   /gene="rrnC-5S"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        95070..95531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0075"
FT                   /locus_tag="GK0075"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GK0075"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74360"
FT                   /db_xref="GOA:Q5L439"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L439"
FT                   /protein_id="BAD74360.1"
FT                   /translation="MPNISDIIEQYLKQVLNMSDQDIVEIKRSEIANKFQCVPSQINYV
FT                   INTRFTLERGYIVESKRGGGGYIRIMKVKTKSEAQLIDQLLELVGHRISQSNAEDVVKR
FT                   LVEEKVISEREAKIMLSAMDRSVLYIDLPERDELRARMLKAMLTSLKYK"
FT   CDS_pept        95547..96095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0076"
FT                   /locus_tag="GK0076"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0076"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74361"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L438"
FT                   /protein_id="BAD74361.1"
FT                   /translation="MICQECKQRPATMHFTKIVNGEKTEFHLCEQCAREHGHMFTFYGN
FT                   DDFSLNNLLAGLLNFQAPMKEMTANAFPNPDVLQCETCQMTYHQFTQIGRFGCANCYRT
FT                   FARYLPPILKRLHSGNTAHSGKIPKRKGGVLHLRKQLAMLKQKLQELVAREEFERAAEV
FT                   RDQIRSLEDELRRRGEGDM"
FT   CDS_pept        96101..97192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0077"
FT                   /locus_tag="GK0077"
FT                   /product="creatine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0077"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74362"
FT                   /db_xref="GOA:Q5L437"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L437"
FT                   /protein_id="BAD74362.1"
FT                   /translation="MSFEKFFNTAVSAWMSQEGPDSDIVLSSRIRLARNIVDFRFPTLF
FT                   SSEEAMQIVALFERTFAHRSYGGAGRFELLKMSELQPIEKRVLVEKHLISPHLAEDSPF
FT                   GACLLSENEEISIMINEEDHIRIQCLFPGLQLAEALEAASELDDWIEGYVNYAFDERLG
FT                   YLTSCPTNVGTGLRASVMMHLPALVLTQQINRIIPAINQLGLVVRGTYGEGSEALGNIF
FT                   QISNQITLGKSEEDIVADLHTIVQQLIAQERAARQALVKTLGIQLEDKVFRSYGILANC
FT                   RVIESKEAAQCLSDVRLGIDLGYIKNISRNILNELMILTQPGFLQQYAGGALRPEERDV
FT                   RRAALIRERLKMEERRKMEGDER"
FT   CDS_pept        97189..99621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0078"
FT                   /locus_tag="GK0078"
FT                   /product="ATP-dependent Clp protease ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GK0078"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74363"
FT                   /db_xref="GOA:Q5L436"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L436"
FT                   /protein_id="BAD74363.1"
FT                   /translation="MMFGRFTERAQKVLALAQEEAIRLGHNNIGTEHILLGLIREGEGI
FT                   AAKALMALGLGPDKIQKEVESLIGRGSEVSHTIHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNESMSGHGGGASHVSTPTL
FT                   DSLARDLTAIAREGRLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLA
FT                   QQIVNNEVPETLRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDEL
FT                   HTLIGAGGAEGAIDASNILKPALARGELQCIGATTLDEYRKYIEKDAALERRFQPIYVD
FT                   EPTVEESIQILKGLRDRYEAHHRVSISDEAIVQAVKLSDRYITDRFLPDKAIDLIDEAC
FT                   SKVRLRSFTAPPKLKELEQKLEEVRKEKDAAVQSQEFEKAASLRDMEQRLREELEETKR
FT                   AWKEKQGQENLEVTVEDIAAVVSSWTGIPVSKLAETETERLLKLEEILHSRVVGQDEAV
FT                   KAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAEAMFGDEDALIRIDMSE
FT                   YMEKHSTSRLIGSPPGYVGYEEGGQLTEKVRRKPYSVVLLDEMEKAHPDVFNILLQVLE
FT                   DGRLTDSKGRTVDFRNTIIIMTSNVGADALKRNKYVGFNIQDGNQQYKDMKSKVMDELK
FT                   KAFRPEFLNRIDEIIVFHSLEKDHLKQIVRLMADTLVKRLKEQDIDLELTEAAIEKIAA
FT                   EGFDPEYGARPLRRALQKHVEDRLSEELLKGTIAKGQKVVVDVKDGEFVVLSKQAVV"
FT   CDS_pept        99699..101072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0079"
FT                   /locus_tag="GK0079"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0079"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74364"
FT                   /db_xref="GOA:Q5L435"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L435"
FT                   /protein_id="BAD74364.1"
FT                   /translation="MAKKKTKFVCQECGYESAKWLGRCPGCQTWNSFVEEIEQEKPTVR
FT                   GAFLHSERAGSAKPVPITAVEAVQEPRMKTNSAELDRVLGGGIVKGSLVLIGGDPGIGK
FT                   STLLLQTSAQLAAAGHQVLYVSGEESVKQVKLRAGRLRAECDQLYVLAEADLEYIVAAV
FT                   ETVQPACVIIDSIQTVYRTDISSAPGSVAQVRECTAELMKLAKTKGIAIFIVGHVTKEG
FT                   AIAGPRLLEHMVDTVLYFEGERHHTYRILRAVKNRFGSTNEIGIFEMRDIGLKEVENPS
FT                   EVFLEERSRGAAGSTVVAAMEGTRPVLVEIQALVSPTSFGNPRRMATGLDHNRVSLLMA
FT                   VLEKRVGLLLQNQDAYLKVAGGVKLDEPAIDLAVAVSIASSFRDRPTNPADVIIGEVGL
FT                   TGEVRRVSRIEQRVQEAVKLGFSRIIVPKNNLAGWQPPKGVQVIGVSHVAEALEHTMC"
FT   CDS_pept        101381..102475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0080"
FT                   /locus_tag="GK0080"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0080"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74365"
FT                   /db_xref="GOA:Q5L434"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L434"
FT                   /protein_id="BAD74365.1"
FT                   /translation="MVKRIVQLFFLAVGGTLGAMFFPDLLKVMNVSGMPLLNNSYTLAV
FT                   LGAVVFFLLTFWLVDYVVDMIRWVEETLVKAPAADVLFGSLGLIFGLIIAFFVVMPLQS
FT                   FHIQVLNTVLPIFLTVLLGYLGFRVGLKKRNELMNLFSLSNRMAKKKGGEAENEPSKGG
FT                   AVKILDTSVIIDGRIADICQTGFLEGPLVIPRFVLEELQHIADSSDVLKRNRGRRGLDI
FT                   LNRIQKEMAMKVEIHEADFSDVQEVDSKLVKLAKQLQGVVVTNDFNLNKVCELQNVRVL
FT                   NINDLANAVKPVVLPGEELNVHVIKDGKEHNQGVAYLDDGTMIVVEDGKEYIGKRVDVL
FT                   VTSVLQTSAGRMIFAKLKLLQKAL"
FT   CDS_pept        102497..103183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0081"
FT                   /locus_tag="GK0081"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase (MEP cytidylyltransferase)"
FT                   /EC_number="2.7.7.60"
FT                   /db_xref="EnsemblGenomes-Gn:GK0081"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74366"
FT                   /db_xref="GOA:Q5L433"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L433"
FT                   /protein_id="BAD74366.1"
FT                   /translation="MNYEAIVLAAGRGKRMNAGMNKQFLELGGEPLIVRTLNVFERDER
FT                   CTRIVLVVNPAERSRFEQLLARFRIQKVAALTDGGEERQHSVYNGLQALAGEEIVLIHD
FT                   GARPFVRVHHLHELVNAAVQYGAAIPAVRVKDTIKKANGLFVEQTIDRSSLWAVQTPQA
FT                   FRLSLIMEAHEAAKQAGYLGTDDASLVERIGKPVKIIEGDYRNIKLTTPEDLLFAEAIL
FT                   ASRMAE"
FT   CDS_pept        103198..103674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0082"
FT                   /locus_tag="GK0082"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase(MECDP-synthase)"
FT                   /EC_number="4.6.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:GK0082"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74367"
FT                   /db_xref="GOA:Q5L432"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L432"
FT                   /protein_id="BAD74367.1"
FT                   /translation="MFRIGQGFDVHQLVEGRPLIIGGVTIPYEKGLLGHSDADVLLHAV
FT                   ADACLGAIGAGDIGRHFPDTDPRFKDADSAELLAHVWALARQEGYRLVNADCTIIAQKP
FT                   KLAPYIEEMRAVIARLLEAERSQVNVKATTTEKLGFTGRGEGIAAQAVVLLQKS"
FT   CDS_pept        103876..105348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0083"
FT                   /locus_tag="GK0083"
FT                   /product="glutamyl-tRNA synthetase (glutamate--tRNA
FT                   ligase)"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:GK0083"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74368"
FT                   /db_xref="GOA:Q5L431"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L431"
FT                   /protein_id="BAD74368.1"
FT                   /translation="MAKEVRVRYAPSPTGHLHIGGARTALFNYLFARHHGGKMIVRIED
FT                   TDIERNVEGGEKSQLENLKWLGIDYDESIDQDGGYGPYRQTERLDIYRKYVNELLEQGH
FT                   AYKCFCTPEELEREREAQRAAGIAAPQYSGKCRHLTPEQVAELEAQGKPYTIRLKVPEG
FT                   KTYEFYDLVRGKVVFESKDVGGDWVIVKANGIPTYNFAVVIDDHLMEISHVFRGEEHLS
FT                   NTPKQLMVYEYFGWEPPQFAHLTLIVNEQRKKLSKRDESIIQFVSQYKELGYLPEAMFN
FT                   FFALLGWSPEGEEEIFTKDELIRMFDVSRLSKSPSMFDTKKLTWMNNQYIKKLDLDRLV
FT                   ELALPHLVKAGRLPADMTDEQRQWARDLIALYQEQMSYGAEIVPLSELFFKEEIDYEDE
FT                   ARQVLAEEQVPAVLSTFLESVRELEPFTADEIKAAIKAVQKATGQKGKKLFMPIRAAVT
FT                   GQTHGPELPFAIQLLGKEKVIERLERALQEKF"
FT   CDS_pept        105717..106391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0084"
FT                   /locus_tag="GK0084"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:GK0084"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74369"
FT                   /db_xref="GOA:Q5L430"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L430"
FT                   /protein_id="BAD74369.1"
FT                   /translation="MFKTLKEDIEVIFEQDPAARSYLEVILTYSGLHAIWAHRIAHALY
FT                   KRKFYFFARLISQISRFFTGIEIHPGAKIGRRFFIDHGMGVVIGETCEIGDNVTVYQGV
FT                   TLGGTGKEKGKRHPTIKDNCLIAAGAKVLGSITIGENSKIGAGSVVLKDVPPNSTVVGI
FT                   PGRVVVRDGVKVKKDLNHTDLPDPIADRFRELEEEIARLKSELEALKQQERKNEYEQHP
FT                   AL"
FT   CDS_pept        106369..107769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0085"
FT                   /locus_tag="GK0085"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:GK0085"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74370"
FT                   /db_xref="GOA:Q5L429"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L429"
FT                   /protein_id="BAD74370.1"
FT                   /translation="MSSIRLYNTLTRKKEPFEPLEPNKVKMYVCGPTVYNYIHIGNARA
FT                   AIVFDTIRRYLEFRGYDVTYVSNFTDVDDKLIKAARELGESVPAIAERFIEAYFEDIQA
FT                   LGCKKADIHPRVTENIDTIIEFIQALIDKGYAYEVDGDVYYRTRKFREYGKLSHQSIDE
FT                   LQAGARIEIGEKKDDPLDFALWKAAKEGEICWDSPWGKGRPGWHIECSAMARKYLGDTI
FT                   DIHAGGQDLTFPHHENEIAQSEALTGKPFAKYWLHNGYLNINNEKMSKSLGNFVLVHDI
FT                   IREIDPQVLRFFMLSVHYRHPINYSEELLESARRGLERLKTAYSNLQHRLQASTNLTDN
FT                   DEEWVSRIADIRASFIREMDDDFNTANGIAVLFELAKQANLYLQEKTTSEKVIHAFLRE
FT                   FEQLADVLGLTLKQDELLDEEIEALIQKRNEARKNRDFALADRIRDELRAKNIILEDTP
FT                   QGTRWKRG"
FT   CDS_pept        107779..108201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0086"
FT                   /locus_tag="GK0086"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0086"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74371"
FT                   /db_xref="GOA:Q5L428"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L428"
FT                   /protein_id="BAD74371.1"
FT                   /translation="MAEFETVNDVKQLNGLALAYIGDAVYEVYVRRHLLAGGSVRPHEL
FT                   HRRAVRYVSARAQARVILALLDEGVLTEEEKDIVRRGRNAKSGTIPKNTDVQTYRHSTA
FT                   FEALIGYHFLVNNEKRVDELIGRSFAIIEREERALE"
FT   CDS_pept        108201..108938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0087"
FT                   /locus_tag="GK0087"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0087"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74372"
FT                   /db_xref="GOA:Q5L427"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L427"
FT                   /protein_id="BAD74372.1"
FT                   /translation="MDYIIGKNPVIEALKAGRDINKIWIAEGAQRHTVEPVLEWAKRRG
FT                   VLVQYVPKRKLDQMAEGAHQGVIAQAAAYRYYEIDDLFARAAERGEAPFFLILDELEDP
FT                   HNLGAIMRTADAVGAHGLIIPKRRSVGLTQTVAKASTGAIEHVPVARVTNLARTIDELK
FT                   ERGVWVAGTDASAQDDYRSLDGTMPLALVIGSEGKGISRLVLEKCDFLFRLPMRGHVTS
FT                   LNASVAASLLMYEVYRKRYPLGE"
FT   CDS_pept        108942..109454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0088"
FT                   /locus_tag="GK0088"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0088"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74373"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L426"
FT                   /protein_id="BAD74373.1"
FT                   /translation="MNILIVDGYNMIGAWPELRRLKEEGDLAAARDLLIEKMADYKGFT
FT                   GDHVVIVFDAHLVQGNEKKYKHYDVDVIFTKEHETADERIERLAKTLMNARTKVYVATS
FT                   DYTEQWTVFGQGALRKSARELLDEVETVERDISQKVKAMRQRTPISKVPLNDRIAEIFE
FT                   KWRRGEK"
FT   CDS_pept        109524..110174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0089"
FT                   /locus_tag="GK0089"
FT                   /product="DNA-directed RNA polymerase sigma-30 factor
FT                   (sigma-H)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0089"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74374"
FT                   /db_xref="GOA:Q5L425"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L425"
FT                   /protein_id="BAD74374.1"
FT                   /translation="MGECLKAMKGKGYHQLDDEQLVALVHEGDGEALDFLIHKYQNFVR
FT                   AKARSYFLVGADREDIVQEGMIGLYKAVRDFKGDKLSSFKAFAELCITRQMITAIKTAT
FT                   RQKHIPLNSYVSLDKPIYDDESDRTLMDVLSGTQVTDPEQLIVNREEVDDIELKMAELL
FT                   SDLERKVLALYLDGRSYQEISEELNRHVKSIDNALQRVKRKLEKYLEYREISL"
FT   CDS_pept        110267..110416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="GK0090"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:GK0090"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74375"
FT                   /db_xref="GOA:Q5L424"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L424"
FT                   /protein_id="BAD74375.1"
FT                   /translation="MRQKVTLACVQCASRNYTAAKQIRRLGERLMANKFCSTCNKHTIH
FT                   RETK"
FT   CDS_pept        110454..110639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="GK0091"
FT                   /product="preprotein translocase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GK0091"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74376"
FT                   /db_xref="GOA:Q5L423"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L423"
FT                   /protein_id="BAD74376.1"
FT                   /translation="MMQRVINFLKEVVRELKKVSWPNRKELVNYTAVVLATVAFFTVFF
FT                   AVVDLGISELIRLVFE"
FT   CDS_pept        110752..111285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0092"
FT                   /locus_tag="GK0092"
FT                   /product="transcription antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:GK0092"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74377"
FT                   /db_xref="GOA:Q5L422"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L422"
FT                   /protein_id="BAD74377.1"
FT                   /translation="MEKNWYVVHTYSGYENKVKANLEKRVESMGMKDKIFRVVVPEETE
FT                   TDVKNGKRKTTKKKVFPGYVLVEMVMTDDSWYVVRNTPGVTGFVGSSGAGSKPTPLMEE
FT                   EVKMILKRMGMPLAEVDVDYEVNETVRIKEGPFANFTGKIEAIDPDKHKVKLLVDMFGR
FT                   ETRVELEFSQIEKI"
FT   CDS_pept        111520..111945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="GK0093"
FT                   /product="50S ribosomal protein L11 (BL11)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0093"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74378"
FT                   /db_xref="GOA:Q5L421"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L421"
FT                   /protein_id="BAD74378.1"
FT                   /translation="MAKKVIKVVKLQIPAGKANPAPPVGPALGQAGVNIMAFCKEFNAR
FT                   TADQAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDK
FT                   VREIAELKMPDLNAASIEAAMRMIEGTARSMGIVIED"
FT   CDS_pept        112126..112827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="GK0094"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:GK0094"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74379"
FT                   /db_xref="GOA:Q5L420"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L420"
FT                   /protein_id="BAD74379.1"
FT                   /translation="MPKRGKKYLEALKLVDRSKAYPIAEAIELVKKTNIAKFDATVEVA
FT                   FRLGVDPKKADQQIRGAVVLPHGTGKVARVLVFAKGEKAKEAEAAGADYVGDAEYINKI
FT                   QQGWFDFDVVVATPDMMGEVGKLGRILGPKGLMPNPKTGTVTFDVAKAVQEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFDNEKLAENFAAVYEAILKAKPAAAKGTYVKNVTITSTMGPGI
FT                   KVDPSTVAVAQ"
FT   CDS_pept        113086..113586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="GK0095"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:GK0095"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74380"
FT                   /db_xref="GOA:Q5L419"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L419"
FT                   /protein_id="BAD74380.1"
FT                   /translation="MSSAIELKKQVVAEIADKFRASKATVIVDYRGLNVAEMTELRKQL
FT                   REAGVEFKVYKNTLTRRALAEVGLEGLDEVFTGPNAIAFSNEDVVAPAKILSEFAKTHE
FT                   ALEIKGGVIEGNIASKEEIDALAKLPSREGLLSMLLSVLQAPIRNFALAIKAVADKQEE
FT                   QGA"
FT   CDS_pept        113638..114009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="GK0096"
FT                   /product="50S ribosomal protein L7/L12 (BL13)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0096"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74381"
FT                   /db_xref="GOA:Q5L407"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L407"
FT                   /protein_id="BAD74381.1"
FT                   /translation="MMTKEQIIEAVKNMTVLELNELVKAIEEEFGVTAAAPVVVAGGAA
FT                   AGAEAAAEKTEFDVILADAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPIKEGIAKE
FT                   EAEEIKAKLEEAGAKVEIK"
FT   CDS_pept        113939..114724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0097"
FT                   /locus_tag="GK0097"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0097"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74382"
FT                   /db_xref="GOA:Q5L406"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L406"
FT                   /protein_id="BAD74382.1"
FT                   /translation="MRKKKQKKSKQNSKKLARKSKSSNGCAIEKRGLPEARDGLFFVTL
FT                   YIRKAVQPVDKEEGMMMSEHYYSVNPTSERNPQTWTYVLRGHEFRFTTDSGVFSKREVD
FT                   FGTRLLIETFEEPGVAGDLLDVGCGYGPIGLALAKSFPNRRVHMIDVNERALELAQENK
FT                   QANGIDNAVIYKSDLFSEVGEQRFAAVVTNPPIRAGKRVVYAIFEQSRDHLLDHGELWV
FT                   VIQKKQGAPSALQKLNECFPAVEVVAKKKGYYIIKVKKC"
FT   CDS_pept        115138..118710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="GK0098"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:GK0098"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74383"
FT                   /db_xref="GOA:Q5L405"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L405"
FT                   /protein_id="BAD74383.1"
FT                   /translation="MTGRLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGL
FT                   REMFREISPIEDFSGNLSLEFIDYSLGEPKYTVEEAKERDVTYAAPLRVKVRLINKETG
FT                   EVKEQDVFMGDFPLMTETGTFIINGAERVIVSQLVRSPSVYYSDKVDKNGKRGYSATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFSSDQEIIDLLGDNEYLRNTLE
FT                   KDNTDSTEKALIEIYERLRPGEPPTLENAKNLLASRFFDPKRYDLASVGRYKINKKLHI
FT                   KNRLFNQRLAETIIDPETKEVIAEAGAMIDRRTLNRLLPYLEKGVGLQTYRPAEGVVDG
FT                   DISVQTIKIYAPNDPDGEKVINVIGNGFIAEDVKHITPADIIASISYFFNLLHGVGDTD
FT                   DIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNTITPQQLINIRPVIAAI
FT                   KEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPI
FT                   ETPEGPNIGLINSLSTYAKVNKFGFIETPYRRVDPETGRVTDQIDYLTADEEDNYVVAQ
FT                   ANVPLAEDGTFLEENVVARFRGENIVVKRDRVDYMDVSPKQVVSAATACIPFLENDDSN
FT                   RALMGANMQRQAVPLLEPEAPIVGTGMEYVSAKDSGAAVICKHRGIVERVEAKEIWVRR
FT                   LIEVDGKEVKGDLDKYRLLKFVRSNQGTCYNQRPIVKKGDIVEKGEILADGPSMDKGEL
FT                   ALGRNVLVAFMTWDGYNYEDAIIMSERLVKEDVYTSIHIEEYEAESRDTKLGPEEITRD
FT                   IPNVGEDALKNLDERGIVRIGAEVKDGDLLVGKVTPKGMTELTAEERLLHAIFGEKARE
FT                   VRDTSLRVPHGGGGIVLDVKVFNREDGDELPPGVNQLVRVYIVQKRKISEGDKMAGRHG
FT                   NKGVISRILPEEDMPFLPDGTPIDIMLNPLGVPSRMNIGQVFELHLGMAAKKLGLHIAS
FT                   PVFDGATEEDVWNILEEAGLARDAKTVLYDGRTGEPFDNRVSVGIMYMIKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRV
FT                   KTYEAIVKGENIPEPGVPESFKVLIKELQSLGMDVTILTSDEQEVNMENFDDDDDHAPD
FT                   AIMVDVKPAEREEAGEEKDAVTKE"
FT   CDS_pept        118803..122402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="GK0099"
FT                   /product="DNA-directed RNA polymerase beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:GK0099"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74384"
FT                   /db_xref="GOA:Q5L404"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L404"
FT                   /protein_id="BAD74384.1"
FT                   /translation="MLDVNKFEYMKIGLASPEKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPGDTPLEKKQLLSEKEYRAYREKYG
FT                   QSFQASMGAEAIKKLLQDIDLDKEVAALKEELKTAQGQRRARIIKRLEVLEAFRSSGND
FT                   PAWMVLDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVERGLAHNIKSAKRKIERVHPEVWD
FT                   VLEDVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTMEREGAIGEGMVFK
FT                   DTDEALLAYHNGYVHLHSRIAIHAGSLKNETFTEEQNNKLLLTTVGKLIFNEILPNSFP
FT                   YINEPTTENIEGRTPDKYFLDKGVNVREEIRKRELVPPFKKKVLGQIIAEVFKRFKITE
FT                   TSKMLDRMKDLGFQYSTKAGITIGVADIVVLPEKQEILDEAQAKVDTVLKQFRRGLITD
FT                   EERYERVISIWSAAKDKIQDRLMKSLDKRNPIFMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PAGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   VREEDCGTDRGILARALTDGTEVVVKLEERLVGRYAHKTVRHPETGEVIVRKDEMITED
FT                   IANEIMKAGITEVWIRSVFACNTRHGVCKKCYGRNMATGMDVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRVQELFEARNPKGQAVISEIDGTVISINKTRDNQY
FT                   EVVVQGEVETRTYVAPYNARLKVEEGQRVERGQELTEGSVDPKQLLRVRDITSVQEYLL
FT                   REVQKVYRMQGVEISDKHIEVMVRQMLRKVRVIDAGDTDVLPGTLLDVHQFTDVNAKAL
FT                   REGKRPATARQVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   IGKLVPAGTGMARYRKVKPAVKKETASDTVSSK"
FT   CDS_pept        122537..122785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0100"
FT                   /locus_tag="GK0100"
FT                   /product="ribosomal protein (L7AE family)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0100"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74385"
FT                   /db_xref="GOA:Q5L403"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR023460"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L403"
FT                   /protein_id="BAD74385.1"
FT                   /translation="MSYEKVLQAGKIVIGTKQTIRALKEGKAAEVIVAEDADLPIIEKV
FT                   TAAANEANVPVTKVDSMKKLGKACKIQVGAAAVAILR"
FT   CDS_pept        122882..123304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="GK0101"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:GK0101"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74386"
FT                   /db_xref="GOA:Q5L402"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L402"
FT                   /protein_id="BAD74386.1"
FT                   /translation="MPTINQLVRKGREKKVVKSKSPALNKGYNSFKKEQTNVSSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIIRGALDAAGVANRMQGRSKYGAKKPKAAKK"
FT   CDS_pept        123344..123814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="GK0102"
FT                   /product="30S ribosomal protein S7 (BS7)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0102"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74387"
FT                   /db_xref="GOA:Q5L401"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L401"
FT                   /protein_id="BAD74387.1"
FT                   /translation="MPRRGPVAKRDVLPDPIYNSKLVTRLINKIMIDGKKSKAQKILYT
FT                   AFDIIRERTGKDPMEVFEQALKNVMPVLEVRARRVGGANYQVPVEVRPDRRVSLGLRWL
FT                   VQYARLRNEKTMEERLANEIMDAANNTGAAVKKREDTHKMAEANRAFAHYRW"
FT   CDS_pept        123995..126073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fus"
FT                   /locus_tag="GK0103"
FT                   /product="translation elongation factor G (EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0103"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74388"
FT                   /db_xref="GOA:Q5L400"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L400"
FT                   /protein_id="BAD74388.1"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVHE
FT                   GAATMDWMEQEQERGITITSAATTAQWKGHRINIIDTPGHVDFTVEVERSLRVLDGAIT
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVKTLHDRLQANAHPVQ
FT                   LPIGAEDQFSGIIDLVEMCAYHYHDELGKNIERIDIPEEYRDMAEEYHNKLIEAVAELD
FT                   EELMMKYLEGEEITTEELKAAIRKATISVEFFPVFCGSAFKNKGVQLLLDGVVDYLPSP
FT                   VDIPAIRGVVPDTEEEVTREASDDAPFAALAFKIMTDPYVGKLTFIRVYSGTLDSGSYV
FT                   MNTTKGKRERIGRLLQMHANHRQEISKVYAGDIAAAVGLKDTTTGDTLCDEKHPVILES
FT                   MQFPEPVISVAIEPKSKADQDKMSQALQKLQEEDPTFRAHTDPETGQTIISGMGELHLD
FT                   IIVDRMRREFKVEANVGAPQVAYRETFRKSAQVEGKFIRQSGGRGQYGHVWIEFSPNER
FT                   GKGFEFENAIVGGVVPKEYVPAVQAGLEEAMQNGVLAGYPVVDIKAKLFDGSYHDVDSS
FT                   EMAFKIAASLALKNAATKCDPVLLEPIMKVEVVIPEEYLGDIMGDITSRRGRIEGMEAR
FT                   GNAQVVRAMVPMAEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKNIADEIIKKNKGE"
FT   CDS_pept        126202..127389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="GK0104"
FT                   /product="translation elongation factor Tu (EF-Tu)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0104"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74389"
FT                   /db_xref="GOA:Q5L3Z9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3Z9"
FT                   /protein_id="BAD74389.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEAK
FT                   AYDQIDAAPEERERGITISTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDF
FT                   PGDEVPVIKGSALKALEGDPQWEEKIIELMNAVDEYIPTPQREVDKPFMMPIEDVFSIT
FT                   GRGTVATGRVERGTLKVGDPVEIIGLSDEPKTTTVTGVEMFRKLLDQAEAGDNIGALLR
FT                   GVSRDEVERGQVLAKPGSITPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVT
FT                   GIITLPEGVEMVMPGDNVEMTVELIAPIAIEEGTKFSIREGGRTVGAGSVSEIIE"
FT   CDS_pept        127686..127994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="GK0105"
FT                   /product="30S ribosomal protein S10 (BS13)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0105"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74390"
FT                   /db_xref="GOA:Q5L3Z8"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3Z8"
FT                   /protein_id="BAD74390.1"
FT                   /translation="MAKEKIRIRLKAYDHRILDQSAEKIVETAKRSGAKVSGPIPLPTE
FT                   RTVYTILRAVHKYKDSREQFEMRTHKRLIDIINPTPQTVDSLMRLDLPSGVDIEIKL"
FT   CDS_pept        128015..128656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="GK0106"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:GK0106"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74391"
FT                   /db_xref="GOA:Q5L3Z7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3Z7"
FT                   /protein_id="BAD74391.1"
FT                   /translation="MTKGILGRKIGMTQIFAENGDLIPVTVIHATPNVVLQKKTIENDG
FT                   YEAIQLGFEDISEKRANKPQIGHAAKANTAPKRFIREIRGANIDEYEVGQEVKVDIFSE
FT                   GEIVDVTGISKGKGFQGAIKRHGQSRGPMAHGSRYHRRPGSMGSIAPNRVFKTKNLPGR
FT                   MGGERVTIQNLKIVKVDPERNLLLIKGNVPGPRKGLVIVKSAVKAAKKAK"
FT   CDS_pept        128686..129309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="GK0107"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:GK0107"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74392"
FT                   /db_xref="GOA:Q5L3Z6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3Z6"
FT                   /protein_id="BAD74392.1"
FT                   /translation="MPKVALYNQNGQTVGEIELNDAVFGIEPNKHVLFEAVIMQRASMR
FT                   QGTHKTKNRAEVSGGGRKPWRQKGTGRARQGSIRAPQWRGGGTVFGPVPRSYSYKLPKK
FT                   VRRLAIKSALSSKVLENDIVVLDQLSLEAPKTKEMVKILNNLSVDRKALIVTDELNENV
FT                   YLSARNIPGVKVVAANGINVLDVLNHDKLVITKAAVEKVEEVLA"
FT   CDS_pept        129309..129596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="GK0108"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:GK0108"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74393"
FT                   /db_xref="GOA:Q5L3Z5"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3Z5"
FT                   /protein_id="BAD74393.1"
FT                   /translation="MKDPRDIIKRPIITENTMNLIGQKKYTFEVDVKANKTEVKDAVEK
FT                   IFGVKVAKVNIMNYKGKFKRVGRYSGYTNRRRKAIVTLTPDSKEIELFEV"
FT   CDS_pept        129624..130454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="GK0109"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:GK0109"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74394"
FT                   /db_xref="GOA:Q5L3Z4"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3Z4"
FT                   /protein_id="BAD74394.1"
FT                   /translation="MAIKKYKPTSNGRRGMTVLDFSEITTDQPEKSLLAPLKKKAGRNN
FT                   QGKITVRHQGGGHKRQYRIIDFKRDKDGIPGRVATIEYDPNRSANIALINYADGEKRYI
FT                   IAPKNLKVGMEIMSGPDADIKIGNALPLENIPVGTLVHNIELKPGRGGQLVRAAGTSAQ
FT                   VLGKEGKYVIVRLASGEVRMILGKCRATVGEVGNEQHELVNIGKAGRARWLGIRPTVRG
FT                   SVMNPVDHPHGGGEGKAPIGRKSPMTPWGKPTLGYKTRKKKNKSDKFIIRRRKK"
FT   CDS_pept        130488..130766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="GK0110"
FT                   /product="30S ribosomal protein S19 (BS19)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0110"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74395"
FT                   /db_xref="GOA:Q5L3Z3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3Z3"
FT                   /protein_id="BAD74395.1"
FT                   /translation="MGRSLKKGPFCDEHLMKKIEKLNATGQKQVIKTWSRRSTIFPQFV
FT                   GHTIAVYDGRKHVPVYITEDMVGHKLGEFAPTRTFRGHAGDDKKTKR"
FT   CDS_pept        130785..131126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="GK0111"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:GK0111"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74396"
FT                   /db_xref="GOA:Q5L418"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L418"
FT                   /protein_id="BAD74396.1"
FT                   /translation="MQAKAVARTVRIAPRKARLVIDLIRGKEVGEAFAILRHTPKAASP
FT                   IIEKVLKSAVANAEHNYDMDVNNLVITQAYVDEGPTLKRFRPRAMGRASAINKRTSHIT
FT                   IVVSEKKEG"
FT   CDS_pept        131130..131786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="GK0112"
FT                   /product="30S ribosomal protein S3 (BS2)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0112"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74397"
FT                   /db_xref="GOA:Q5L417"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L417"
FT                   /protein_id="BAD74397.1"
FT                   /translation="MGQKVNPIGLRIGIIRDWESRWYAEKDYADLLHEDLKIREYISKR
FT                   LQDAAVSRVEIERAANRVNVTIHTAKPGMVIGKGGSEVEALRKALAQLTGKRVHINIVE
FT                   IKKPDLDARLVAENIARQLENRVSFRRAQKQAIQRAMRAGAKGIKTMVSGRLGGADIAR
FT                   SEHYSEGTVPLHTLRADIDYGTAEADTTYGKIGVKVWIYRGEVLPTKKKAEEGGK"
FT   CDS_pept        131789..132214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="GK0113"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:GK0113"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74398"
FT                   /db_xref="GOA:Q5L416"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L416"
FT                   /protein_id="BAD74398.1"
FT                   /translation="MLMPKRVKYRREHRGRMKGRAKGGTEVHFGEFGLQALESAWITNR
FT                   QIEAARRAMTRYMRRGGKVWIRIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVMF
FT                   EVGGVSEEVAREALRLASHKLPIKCKFVKREETGGEA"
FT   CDS_pept        132214..132414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="GK0114"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:GK0114"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74399"
FT                   /db_xref="GOA:Q5L415"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L415"
FT                   /protein_id="BAD74399.1"
FT                   /translation="MKAKEIRELTTAEIEQKIKALKEELFNLRFQLATGQLENTARIRQ
FT                   VRKDIARMKTIIRERELAANK"
FT   CDS_pept        132439..132702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="GK0115"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:GK0115"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74400"
FT                   /db_xref="GOA:Q5L414"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L414"
FT                   /protein_id="BAD74400.1"
FT                   /translation="MSQRNQRKVYVGRVVSDKMDKTITVLVETYKKHPLYGKRVKYSKK
FT                   YKAHDEHNIAKVGDIVKIMETRPLSATKRFRLVEVIEKAVVL"
FT   CDS_pept        132752..133120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="GK0116"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:GK0116"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74401"
FT                   /db_xref="GOA:Q5L413"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L413"
FT                   /protein_id="BAD74401.1"
FT                   /translation="MIQQESRLKVADNSGAREVLVIKVLGGSGRRYANIGDVVVATVKD
FT                   ATPGGVVKKGQVVKAVVVRTKRGVRRPDGSYIRFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELRDKDFMKIISLAPEVI"
FT   CDS_pept        133157..133468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="GK0117"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:GK0117"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74402"
FT                   /db_xref="GOA:Q5L412"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L412"
FT                   /protein_id="BAD74402.1"
FT                   /translation="MHVKKGDKVQVISGKDKGKQGVILAAFPKKNRVIVEGVNIVKKHA
FT                   KPSQANPQGGIIEKEAPIHVSKVMPLDPKTGEPTRIGYKIVDGKKVRYAKKSGEILDK"
FT   CDS_pept        133496..134035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="GK0118"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:GK0118"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74403"
FT                   /db_xref="GOA:Q5L411"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L411"
FT                   /protein_id="BAD74403.1"
FT                   /translation="MNRLKEKYLNEVVPALMSKFNYKSIMQVPKIEKIVINMGVGDAVQ
FT                   NPKALDSAVEELTLIAGQRPVVTRAKKSIAGFRLRQGMPIGAKVTLRGERMYEFLDKLI
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVNKVRGMDIVIVTTANTD
FT                   EEARELLALLGMPFQK"
FT   CDS_pept        134065..134250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="GK0119"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:GK0119"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74404"
FT                   /db_xref="GOA:Q5L410"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L410"
FT                   /protein_id="BAD74404.1"
FT                   /translation="MAKKSMIAKQKRTPKFKVRAYTRCERCGRPHSVYRKFKLCRICFR
FT                   ELAYKGQLPGIKKASW"
FT   CDS_pept        134290..134682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="GK0120"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:GK0120"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74405"
FT                   /db_xref="GOA:Q5L409"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L409"
FT                   /protein_id="BAD74405.1"
FT                   /translation="MTDPIADMLTRIRNANMVRHEKLEVPASKIKREIAEILKREGFIR
FT                   DYEYIEDNKQGILRIFLKYGPNNERVITGLKRISKPGLRVYVKAHEVPRVLNGLGIAIL
FT                   STSQGILTDKEARQKGTGGEVIAYVW"
FT   CDS_pept        134715..135251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="GK0121"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:GK0121"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74406"
FT                   /db_xref="GOA:Q5L408"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L408"
FT                   /protein_id="BAD74406.1"
FT                   /translation="MSRVGKKPIEIPAGVTVTVNGNTVTVKGPKGELTRTFHPDMTITV
FT                   EGNVITVTRPSDEKHHRALHGTTRSLLANMVEGVSKGYEKALELVGVGYRASKQGKKLV
FT                   LSVGYSHPVEIEPEEGLEIEVPSQTKIIVKGADKQRVGELAANIRAVRPPEPYKGKGIR
FT                   YEGELVRLKEGKTGK"
FT   CDS_pept        135285..135647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="GK0122"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:GK0122"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74407"
FT                   /db_xref="GOA:Q5L3S3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3S3"
FT                   /protein_id="BAD74407.1"
FT                   /translation="MITKVDRNAVRKKRHARIRKKIFGTAERPRLSVFRSNKHIYAQII
FT                   DDTKSSTIVSASTLDKEFGLDSTNNIEAAKKVGELVAKRALEKGIKKVVFDRGGYLYHG
FT                   RVKALADAAREAGLEF"
FT   CDS_pept        135667..136167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="GK0123"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:GK0123"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74408"
FT                   /db_xref="GOA:Q5L3S2"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3S2"
FT                   /protein_id="BAD74408.1"
FT                   /translation="MRRIDPNKLELEERVVAVNRVAKVVKGGRRLRFSALVVVGDKNGH
FT                   VGFGTGKAQEVPEAIRKAIEDAKKNLIEVPIVGTTIPHEVIGHFGAGEIILKPASEGTG
FT                   VIAGGPARAVLELAGISDILSKSIGSNTPINMVRATFDGLKQLKRAEDVARLRGKTVEE
FT                   LLG"
FT   CDS_pept        136181..136369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="GK0124"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:GK0124"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74409"
FT                   /db_xref="GOA:Q5L3S1"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3S1"
FT                   /protein_id="BAD74409.1"
FT                   /translation="MAKKLAITLTRSVIGRPEDQRVTVRTLGLRKMHQTVIHNDNPAIR
FT                   GMINKVAHLVKVKEIEE"
FT   CDS_pept        136394..136834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="GK0125"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:GK0125"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74410"
FT                   /db_xref="GOA:Q5L3S0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3S0"
FT                   /protein_id="BAD74410.1"
FT                   /translation="MKLHELQPAPGSRKKAVRVGRGIGSGNGKTSGRGQKGQNARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINRKEYAVVNLEKLNRFEDGTEVTPELLLETGVISK
FT                   LKSGVKILGKGQIEKKLTVKAHKFSASAKEAIEAAGGKTEVI"
FT   CDS_pept        136834..138126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="GK0126"
FT                   /product="preprotein translocase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GK0126"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74411"
FT                   /db_xref="GOA:Q5L3R9"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3R9"
FT                   /protein_id="BAD74411.1"
FT                   /translation="MFRTISNFMRVSDIRNKIIFTLLMLIVFRIGTFIPVPGVNADVLK
FT                   LQDELNAFGVLNIFGGGALQNFSIFAMGVMPYITASIIVQLLQMDVVPKFTEWSKQGEV
FT                   GRRKLAQFTRYFTVVLGFIQAIGMSYGFNNLAGGMLIRNPGIGTYLLIAVVLTAGTAFL
FT                   MWLGEQITAKGVGNGISIIIFAGIVSGIPTVLNQIYAQQFENVGEDVFLRIVRLLLVAL
FT                   AVVAVIVGVIYIQQAFRKIPIQYAKRLEGRSPVGGHSTHLPLKVNPAGVIPVIFAVSFL
FT                   IAPPTIASFFGTNDVTLWIRRTFDYTHPVGMIIYVVLIIAFTYFYAFVQVNPEQMADNL
FT                   KKQGGYIPGIRPGKNTQEYVTRILYRLTLVGSIFLAVVAVLPVFFVNFANLPSSARIGG
FT                   TSLLIVVGVALETMKQLESQLVKRHYRGFIK"
FT   CDS_pept        138170..138823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0127"
FT                   /locus_tag="GK0127"
FT                   /product="adenylate kinase (ATP-AMP transphosphorylase)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0127"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74412"
FT                   /db_xref="GOA:Q5L3R8"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3R8"
FT                   /protein_id="BAD74412.1"
FT                   /translation="MNLVLMGLPGAGKGTQAGKIVEAYGIPHISTGDMFRAAIKEGTPL
FT                   GLQAKQYMDRGDLVPDEVTIGIVRERLSKEDCQHGFLLDGFPRTVAQAEALETLLSEIG
FT                   RKLDYVIHIDVRQEVLMERLTGRRICRNCGATYHLVFHPPAKPGVCDKCGGDLYQRPDD
FT                   NEATVANRLEVNMKQMKPLLDFYEQKGYLRHINGEQEMEKVFADICEVLGGLAR"
FT   CDS_pept        138820..139587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0128"
FT                   /locus_tag="GK0128"
FT                   /product="methionine aminopeptidase (Peptidase M)"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:GK0128"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74413"
FT                   /db_xref="GOA:Q5L3R7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3R7"
FT                   /protein_id="BAD74413.1"
FT                   /translation="MIRCKTAQEIALMREAGKIVSLTLKELQKHIRPGITTKELDAIAE
FT                   EVIRSHGAIPSFKGYQGFPGSICASVNEELVHGIPSSRALREGDIITIDVGAQYEGYHA
FT                   DSAWTYPVGEIDAETKRLLDVTEQSLYVGLAEAKPGARLTNISHAIQTYVEAHHFSVVR
FT                   EYVGHGIGQHLHEDPQIPHYGPPNKGPILRPGMALCIEPMVNAGSRYVKTLADDWTVVT
FT                   ADGKRCAHFEHTIVITEDGCEILTHCGNESPTS"
FT   CDS_pept        139683..139901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="GK0129"
FT                   /product="translation initiation factor IF-I"
FT                   /db_xref="EnsemblGenomes-Gn:GK0129"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74414"
FT                   /db_xref="GOA:Q5L3R6"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3R6"
FT                   /protein_id="BAD74414.1"
FT                   /translation="MAKDDVIEVEGTVIETLPNAMFRVELENGHTVLAHVSGKIRMHFI
FT                   RILPGDRVTVELSPYDLTRGRITYRYK"
FT   CDS_pept        139938..140051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="GK0130"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:GK0130"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74415"
FT                   /db_xref="GOA:Q5L3R5"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3R5"
FT                   /protein_id="BAD74415.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRRGKVMIICENPKHKQRQG"
FT   CDS_pept        140072..140437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="GK0131"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:GK0131"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74416"
FT                   /db_xref="GOA:Q5L3R4"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3R4"
FT                   /protein_id="BAD74416.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYIYGIGKPTAQKILKEAGVSEDTRV
FT                   RDLTEEELGRIREIVGRLKVEGDLRREVSLNIKRLMEIGCYRGLRHRRGLPVRGQNTKN
FT                   NARTRKGPRRTVANKKK"
FT   CDS_pept        140463..140852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="GK0132"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:GK0132"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74417"
FT                   /db_xref="GOA:Q5L3R3"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3R3"
FT                   /protein_id="BAD74417.1"
FT                   /translation="MARRTNTRKRRVRKNIDTGIAHIRSTFNNTIVTITDVHGNAIAWA
FT                   SAGSLGFKGSRKSTPFAAQMAAEAAAKASMEHGMKTVEVNVKGPGAGREAAIRALQAAG
FT                   LEITAIKDVTPIPHNGCRPPKRRRV"
FT   CDS_pept        141003..141947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="GK0133"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:GK0133"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74418"
FT                   /db_xref="GOA:Q5L3R2"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3R2"
FT                   /protein_id="BAD74418.1"
FT                   /translation="MIEIEKPKIETVELSEDAKYGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSVQIDGVLHEFSTIDGVVEDVTAIILNIKKLALKIYSDEEKTLEIDVQGE
FT                   GVVTAADITHDSDVEILNPDLHIATLAEGGRLRMRMTAKRGRGYVPAEANKREDQPIGV
FT                   IPIDSIYTPVSRVSYQVENTRVGQVTDYDKLTIDVWTDGSIGPKEAISLGAKILTEHLN
FT                   IFVGLTDEAQNAEIMVEKEDDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELTQKT
FT                   EEDMMKVRNLGRKSLEEVKAKLAELGLSLRKDD"
FT   CDS_pept        142048..142410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="GK0134"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:GK0134"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74419"
FT                   /db_xref="GOA:Q5L3R1"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3R1"
FT                   /protein_id="BAD74419.1"
FT                   /translation="MSYRKLGRTTSQRKALLRDLATDLIINERIETTEARAKELRSVME
FT                   KMITLGKRGDLHARRQAAAFIRKEVANSETGQDALQKLFSDIAPRYQDRQGGYTRIMKL
FT                   GPRRGDGAPMVIIELV"
FT   CDS_pept        142528..143367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0135"
FT                   /locus_tag="GK0135"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0135"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74420"
FT                   /db_xref="GOA:Q5L3R0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3R0"
FT                   /protein_id="BAD74420.1"
FT                   /translation="MAEPILSIEGVSFRYPNQSDYAVQNVSFTAERGEWLAIVGHNGSG
FT                   KSTIARMLIGLLRPERGAIRLFGRLLNDATVWEVRRRVGLVFQNPDNQFVGATVEDDIA
FT                   FALENNGIPRLEMVERIREAIRQVHMEPFLHYEPHRLSGGQKQRVAIAGILALRPDMII
FT                   LDEATSMLDPRGREEVLETVRRLNRQQRITVLSITHDLEEAAKADRLIVMNKGEVMAEG
FT                   TPEQIFRLGSKLERIGLDLPFAVKMGSRLREQGIPLRAGYFTTEELVEELWTLYSKK"
FT   CDS_pept        143343..144215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0136"
FT                   /locus_tag="GK0136"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0136"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74421"
FT                   /db_xref="GOA:Q5L3Q9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3Q9"
FT                   /protein_id="BAD74421.1"
FT                   /translation="MDIVFEKVEHVYNARSPLARRALYDVNVAIRSGAYVAVVGHTGSG
FT                   KSTLLQHLNGLLQPTSGAVKIGEETITSHKRPKQLKPLRKKVGVVFQFPEHQLFEETVE
FT                   KDICFGPLNFGVPEDEAKRKARELIKLVGLSEDVLAKSPFDLSGGQMRRVAIAGVLALE
FT                   PEVLVLDEPTAGLDPRGRKEMMEMFYRLHREKQLTTVLVTHSMEDAARYADEIIVMHEG
FT                   TVWGHGTPEEMFRDADKLAAIGLSVPETVKLKQQLEKRFGVVIPSPCLTLEQTAEAIQQ
FT                   LFSKVSVHD"
FT   CDS_pept        144208..145005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0137"
FT                   /locus_tag="GK0137"
FT                   /product="cobalt transporter system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0137"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74422"
FT                   /db_xref="GOA:Q5L3Q8"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3Q8"
FT                   /protein_id="BAD74422.1"
FT                   /translation="MTNHLIIGQYVPGHSVIHRLDPRAKLLIVFAYVLIVFLANNAATY
FT                   ALLSLFAFAFAALSRIPFSFIARGLKPILWVVLFTLLLHLFMTKEGDVIYQIGALSVYE
FT                   GGIKQGVFISLRFLLLVLMTTMLTLTTTPIEVTDGVESLLGPLKKMRVPVHELALMMAI
FT                   SLRFIPTLMEETEKIMKAQAARGVDFSGGRFSERMKAIVSLLVPLFISSFKRADELATA
FT                   MEARGYRGGEGRTKFRQLAWKPVDIAFLAAVALLAVLLCLLRS"
FT   CDS_pept        145018..145794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0138"
FT                   /locus_tag="GK0138"
FT                   /product="pseudouridylate synthaseI"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:GK0138"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74423"
FT                   /db_xref="GOA:Q5L3Q7"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3Q7"
FT                   /protein_id="BAD74423.1"
FT                   /translation="MTQRIKCIIAYDGTHFSGYQIQPGKRTVQGEFEEVLRRMHKGTKV
FT                   RVAASGRTDAGVHAYGQVIHFDTPLSLSSEQWKKALNAQLPDDIVVRFVQEADADFHAR
FT                   FSAKAKEYRYKVWTAAERDVFRRHYCAWHPYSLHISAMNEALRLLHGTHDFTSFCSAKT
FT                   SIEDRVRTMYRAEVKADGPMLEFRFVGSGFLYNMVRIIVGTVLEIGQGKRSPADISTLL
FT                   AAKDRRLAGPTAPAEGLYLWRVYYEDECLVHSLVDG"
FT   CDS_pept        145974..146411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="GK0139"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:GK0139"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74424"
FT                   /db_xref="GOA:Q5L3Q6"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3Q6"
FT                   /protein_id="BAD74424.1"
FT                   /translation="MRTTYMAKPNEVERKWYVVDAAGKTLGRLASEVAALLRGKHKPTF
FT                   TPHVDCGDHVIVINADKVELTGKKLTKKLYYRHSLYPGGLKVRTALEMRTNYPEQMIER
FT                   AVRGMLPKGSLGRQMFKKLHVYRGSEHPHQAQKPEVYELRG"
FT   CDS_pept        146432..146824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="GK0140"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:GK0140"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74425"
FT                   /db_xref="GOA:Q5L3Q5"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3Q5"
FT                   /protein_id="BAD74425.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVPGDGRIIVNKRDIREYIPTEALI
FT                   EMVKQPLVLTETLGSYDVLVNVQGGGFAGQAGAIRHGIARALLEVDPEFRTVLKRAGLL
FT                   TRDARVKERKKYGLKGARRAPQFSKR"
FT   CDS_pept        146944..147384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0141"
FT                   /locus_tag="GK0141"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0141"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74426"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3Q4"
FT                   /protein_id="BAD74426.1"
FT                   /translation="MTVITSLAEKRQEKQLRYERNMLRELSLEKLRTKALEHFVPFYTA
FT                   YRMFPSVVEEGCIDLAIEAYLLGARYSRFGYYGEPAASVRCRCAQEEKYLIDTLFDFLC
FT                   FWGNIDNDFLSQSLYDACEQYIGNWWTEGFERGKKRRRLKLR"
FT   CDS_pept        147451..148167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0142"
FT                   /locus_tag="GK0142"
FT                   /product="germination-specific N-acetylmuramoyl-L-alanine
FT                   amidase (cell wall hydrolase) (autolysin)"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:GK0142"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74427"
FT                   /db_xref="GOA:Q5L3Q3"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3Q3"
FT                   /protein_id="BAD74427.1"
FT                   /translation="MREKWKWLVAFAAVALMSTLLFPSLFSDLTSTKPWNLPLSGRIIV
FT                   LDPGHGGPDGGAVGGEAVEKDIALNVAKKLRDYLQQQGALVLMTRETDRDLASPSTRGY
FT                   SRRKTEDLLERTAFVNRSNADLFISIHLNAIPSPRWRGAQTFYYGSFIENERLARFIQA
FT                   ELRRNLENTHRLAKMIDTVYLLKHAKIPGALVEVGFLSNPDERELLVSDGYQTKLAASI
FT                   YKGVLRYFSNEHTPRE"
FT   CDS_pept        148362..149378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0143"
FT                   /locus_tag="GK0143"
FT                   /product="ATPase involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:GK0143"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74428"
FT                   /db_xref="GOA:Q5L3Q2"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3Q2"
FT                   /protein_id="BAD74428.1"
FT                   /translation="MLTETEVRAILEKMKDPFLNKTFKETNAIQEIKIKEEKNHVSVKI
FT                   ALAKTGTPEQLRVQTAIVEQLKDAGAATVGLRFAELPRDVVEKYSENKQKTTYIAIASG
FT                   KGGVGKSTVSVNLAVALARLGKKVGLIDADIYGFSVPDMMGITERPTVRGDKIIPVERF
FT                   GVKVISMAFFVEDNAPVIWRGPMLGKMLNNFFKEVEWGDLDYLLLDLPPGTGDVALDVH
FT                   TLLPSCKEIIVTTPHPTAAFVAARAGAMALRTEHEIIGVIENMSYYESRKTGEREYVFG
FT                   KGGGEKLAKELQTELLGQLPLQQPDWNDDDFAPSVYAEDHPIGKIYMDIARKIVAKY"
FT   CDS_pept        complement(149464..149931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0144"
FT                   /locus_tag="GK0144"
FT                   /product="spore germination protein"
FT                   /note="similar to C-terminal region of spore germination
FT                   protein precursor (gerD 205 aa) of Bacillus subtilis
FT                   (GK0144 and GK0146 are divided by IS-like element
FT                   (GK0145))"
FT                   /db_xref="EnsemblGenomes-Gn:GK0144"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74429"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="PDB:4O8W"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3Q1"
FT                   /protein_id="BAD74429.1"
FT                   /translation="MSEDQMKQQLVIDQKAVKETLQQMLTSDQGKKFWESALKDPKFAE
FT                   SFAKGLQAEHEKMMKALMKDPDYQALMIDILKDPEMEKAMVDVLKSKEFRQHLQKVITE
FT                   TLNSPLYQAKIQDMLMKAAEKVQQGGEKQEEGGGEGGEGEESTGNQQGGGG"
FT   CDS_pept        complement(150099..151757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0145"
FT                   /locus_tag="GK0145"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0145"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74430"
FT                   /db_xref="GOA:Q5KUP9"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KUP9"
FT                   /protein_id="BAD74430.1"
FT                   /translation="MNVQVKKVYRNDYLNIISALFKKLGLPQLIDHLVPVDPQCQTRVS
FT                   DAVQAIIYNLFDGRQALVHVERWAQEIDLEKLIRPGLHPSWLNDDALARHLDRLYEADI
FT                   HKVISTCLIHIYRKEGLSLRAFHADTTDKTVYGAYESASLEALQITHGYNRHHRWQKQI
FT                   GFGLVGNEDGIPFYGDVHDGNLPDKTWNPEVLSRVHEQLKQAKMEDEWIYVADSAAMTK
FT                   DTLAQTKAANAFLITRGPSSLRIVKRALAEADSPHIPWSEPFTLAERNGATYRVWETSS
FT                   TYEGHPVRLIVVESSALDQRKGKTLEKERTKEAELLREEQAHWERHPFSCREDAEQALA
FT                   SLKASLRPRFHRVEAAVEEIVRPKKRRGRPKKGAEPEVETLYFLHLDVEFDQDAWEQAR
FT                   RKASRFVLVTTVPKEWKGQPMDAQEILKLYKGQISVEMNFAFLKDPFFTDEIYVKKPER
FT                   VAVLGYLFLLALAIYRVFQRRVRQFITPEHPLKGPGGRKLTRPTGQAIFQLFQYVNVVL
FT                   FKLPDGRIQRSLDRSLTPDQRRILQGLGLDESIYV"
FT   CDS_pept        complement(151789..151974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0146"
FT                   /locus_tag="GK0146"
FT                   /product="hypothetical protein"
FT                   /note="similar to N-terminal region of spore germination
FT                   protein precursor (gerD 205 aa) of Bacillus subtilis
FT                   (GK0144 and GK0146 are divided by IS-like element
FT                   (GK0145))"
FT                   /db_xref="EnsemblGenomes-Gn:GK0146"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74431"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3P9"
FT                   /protein_id="BAD74431.1"
FT                   /translation="MLPLLLLSFLVLGSCAPQEISPPPPDYDETKKMVVDILKLTFRTL
FT                   PTKIGRIFSFRCRMNP"
FT   CDS_pept        152132..152731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0147"
FT                   /locus_tag="GK0147"
FT                   /product="KinB signaling pathway activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0147"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74432"
FT                   /db_xref="GOA:Q5L3P8"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3P8"
FT                   /protein_id="BAD74432.1"
FT                   /translation="MNSRKWVRLFLSTLLIGGIATAAVGIVFNWEEFGRLLLRLEMVEF
FT                   MAVLLWHIGVGFIFSVISQAGFFAYLTVHRFGLGIFRSLWNAVQVVLIMFVLFDLVYFR
FT                   YMAFADKGDSIIPYLLTALFILVVGLVVAYVKSAQTNKGAFVPALFFMVVVTVIEWFPV
FT                   LRINDRDWLYLMLIPLLVCNAYQLLILHKLTGSAKQ"
FT   CDS_pept        complement(152867..153622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0148"
FT                   /locus_tag="GK0148"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0148"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74433"
FT                   /db_xref="GOA:Q5L3P7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014132"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3P7"
FT                   /protein_id="BAD74433.1"
FT                   /translation="MFYALNGRTLKKALIIICSAFFTAVVLYAYEMNRPVFSLPSGPKA
FT                   VYKVDNARNEVALTFDISWGDENADKILDVLKQHGIQNATFFLSASWAERHPAVVKRIK
FT                   EEGHEIGSMGYNFVNYTELENAKIRQDLIMAKKVFDMLGIKQVELLRPPGGNFNKNVLK
FT                   VAQSLGYTVVHWSIDSKDWLNPGTDQIVENVTRDLEPGDIVLLHASDSAKQTAKALPKI
FT                   IASMKENGYKNVNLSELLANGEAESRGIE"
FT   rRNA            154302..155855
FT                   /gene="rrnD-16S"
FT                   /product="16S ribosomal RNA"
FT   rRNA            156521..159450
FT                   /gene="rrnD-23S"
FT                   /product="23S ribosomal RNA"
FT   rRNA            159688..159804
FT                   /gene="rrnD-5S"
FT                   /product="5S ribosomal RNA"
FT   tRNA            159961..160035
FT                   /gene="trnE-Asn"
FT                   /product="transfer RNA trnE-Asn"
FT   tRNA            160043..160118
FT                   /gene="trnE-Thr"
FT                   /product="transfer RNA trnE-Thr"
FT   tRNA            160129..160200
FT                   /gene="trnE-Glu"
FT                   /product="transfer RNA trnE-Glu"
FT   tRNA            160315..160389
FT                   /gene="trnE-Gln"
FT                   /product="transfer RNA trnE-Gln"
FT   tRNA            160555..160630
FT                   /gene="trnE-Lys"
FT                   /product="transfer RNA trnE-Lys"
FT   tRNA            160635..160706
FT                   /gene="trnE-Gly"
FT                   /product="transfer RNA trnE-Gly"
FT   tRNA            160712..160787
FT                   /gene="trnE-Ala"
FT                   /product="transfer RNA trnE-Ala"
FT   CDS_pept        160933..161832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0149"
FT                   /locus_tag="GK0149"
FT                   /product="arginase"
FT                   /EC_number="3.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:GK0149"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74434"
FT                   /db_xref="GOA:Q5L3P6"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3P6"
FT                   /protein_id="BAD74434.1"
FT                   /translation="MKPISIIGVPMDLGQTRRGVDMGPSAMRYAGIIERLERLHYDIED
FT                   LGDIPIGKAERLHEQGDSRLRNLKAVAEANEKLATAVDQVVQRGRFPLVLGGDHSIAIG
FT                   TIAGVAKHYERLGVIWYDAHGDVNTEETSPSGNIHGMPLAASLGFGHPALTQIGGYSPK
FT                   IKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETITYLKERTDGVH
FT                   LSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPILDERNK
FT                   TASVAVALMGSLFGEKLI"
FT   CDS_pept        162033..162596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0150"
FT                   /locus_tag="GK0150"
FT                   /product="DNA-directed RNA polymerase ECF-type sigma factor
FT                   (sigma-W)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0150"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74435"
FT                   /db_xref="GOA:Q5L3P5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3P5"
FT                   /protein_id="BAD74435.1"
FT                   /translation="MDLFIKKRIKAIQKGDQNAYADLVDLYKDKIYRLCYRMLGNRHEA
FT                   EDAAQEAFIRAYIHIDTYNPEMKFSTWLYRIATNLTIDKLRKRKPDVYLDEEVGGTDGL
FT                   TMQAQLPSREASPEEAVESLELQETVQRAIEQLPEKYRSVIVLKYMEDLSLQEISEILG
FT                   LPVGTVKTRLHRGREALRRQLGHL"
FT   CDS_pept        162611..163222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0151"
FT                   /locus_tag="GK0151"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0151"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74436"
FT                   /db_xref="GOA:Q5L3P4"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3P4"
FT                   /protein_id="BAD74436.1"
FT                   /translation="MECPKEIVLLMHSYFDGDLQPEGEQQLKEHLRSCAACAAHFHELK
FT                   KTVAFLQYAAHVAAPPSFAAKVMEAMPKERKTARLRRFLHRHPLLTAASLFLALTLGSL
FT                   ASSWGERGAFSVSADEHVIIRDHTVIVPKGETVKGDIVVRNGSIRIEGTVDGDVTVIHG
FT                   KKYMASAGQVTGEVEEINQVFEWIWYNIKERFNRALQSIE"
FT   CDS_pept        163295..164116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0152"
FT                   /locus_tag="GK0152"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0152"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74437"
FT                   /db_xref="GOA:Q5L3P3"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3P3"
FT                   /protein_id="BAD74437.1"
FT                   /translation="MSFGELPIVSYLLKVVDILVVWYVIYKLIMMIRGTKAIQLLKGIF
FT                   LIILVRFVSNYLGLTTLQWLMDQAIIWGFLAIIIIFQPELRRALEQLGRGRLFTRNTVN
FT                   EDEERMRMVEAIVKATEYMAKRRIGALISIERETGMNDYVETGIMLNAHVSPELLINIF
FT                   IPNTPLHDGAVIIQKNQIAAAACYLPLSESPFISKELGTRHRAALGISEVTDSVTVVVS
FT                   EETGAVSLTKNGELYRDLTIDEFRELLTGELAPATKAPASSRWQWRGKKHG"
FT   CDS_pept        164109..165347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0153"
FT                   /locus_tag="GK0153"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0153"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74438"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3P2"
FT                   /protein_id="BAD74438.1"
FT                   /translation="MDKLMDHPWFIRVVSLLLAIMLYMSANVGAKTGETRNTFGQEDTE
FT                   TLIDIPVVAYYDEDNLVVSGVPKYVNVTLQGPASIVKPTALQRNFEVYVDLTELPLGTY
FT                   TVPIKYRDISDKLKVTIQPSSAKVTIREKVSKRFPVGVEFFNRNKMPDGYSVGEPTVKP
FT                   VAVTITGAKELIDEIAFVKAIVDLDGATETLTREARVRVYDRRGNELDIEPEPSSVEVT
FT                   VPVKSPSKTVPVQVRTTGELPDGVHLVSITPEPDRVTIYGPKEVLNHIDKLEGLTVDLD
FT                   DITDDATVELDAPLPDGAKNVDPDKIKVHIDVEKDVTQTWKDVPIAVVGLPDSYKAEFV
FT                   KPLEGKITVRLVGPPDVVRGLTKDDVRLYVDVSGLGIGEHQVPIQWNHPEQVQWQPSAE
FT                   TAMVHISDKATAQ"
FT   CDS_pept        165375..166724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0154"
FT                   /locus_tag="GK0154"
FT                   /product="phosphoglucomutase (glycolysis)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0154"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74439"
FT                   /db_xref="GOA:Q5L3P1"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3P1"
FT                   /protein_id="BAD74439.1"
FT                   /translation="MGKYFGTDGVRGVANRELTPELAFQIGRCGGYVLTKSAERPKVLI
FT                   GRDTRISGHMLEGALVAGLLSIGAEVMRLGVISTPGVAYLTKALGAQAGIMISASHNPV
FT                   QDNGIKFFGPDGFKLSDEQEAEIEALIDSAEDMLPRPIGAGLGQVNDYFEGGQKYLQYL
FT                   KQTIDEEDFSGMKIALDCAHGATSSLATYLFADLDADVVTMGASPNGLNINEGVGSTHP
FT                   EALAAFVKEKGADVGLAFDGDGDRLIAVDERGNIVDGDQIMYICAKYLKETGRLKQQTV
FT                   VSTVMSNLGFYKALEAQGIKSVQTAVGDRYVVEEMKKNGYNLGGEQSGHIIFLDYNTTG
FT                   DGMLTALQLVNIMKIKGKPLSELAGEMKKYPQLLVNVRVADKEKAMENEQVKKVIQEVE
FT                   AEMNGNGRVLVRPSGTEPLVRIMAEAQTEEACRAYVERIADVVRREMGVE"
FT   CDS_pept        167275..169077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0155"
FT                   /locus_tag="GK0155"
FT                   /product="L-glutamine-D-fructose-6-phosphate
FT                   amidotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:GK0155"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74440"
FT                   /db_xref="GOA:Q5L3P0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3P0"
FT                   /protein_id="BAD74440.1"
FT                   /translation="MCGIVGYIGYQDVKEILLRGLEKLEYRGYDSAGIAVLNESGVHVF
FT                   KEKGRIADLRRIVDPNVNATVGIGHTRWATHGAPSRVNAHPHQSASGRFTLVHNGVIEN
FT                   YEMVKRDYLADVAFQSDTDTEVIVQLVEKFVRDGLTTEEAFRKTLSLLKGSYAIAMIDA
FT                   QDENTIYAAKNKSPLLVGLGDGFNVVASDAMAMLQVTNQFVELMDGELVIVTSENVTIQ
FT                   TLNGETVKRKPFTAELDASDIEKGTYPHYMLKEIDEQPFVIRRIIQKYQDDNGELAIDK
FT                   AIINEVLNADRLYIVACGTSYHAGLVGKQLIESWAKIPVEVHIASEFSYNMPLLSEKPL
FT                   FIFISQSGETADSRAVLVQTNKLGYKAITITNVPGSTLSREADYTLLLHAGPEIAVAST
FT                   KAYTAQIAVLAILAAAAAKAKGFELDFDLTKELAIVANVMEMLCDAKEEMEKIASDYLT
FT                   LTRNCFFIGRAVDYYVCLEGALKLKEISYIQAEGFAGGELKHGTIALIEDGTPVIALAT
FT                   QEHVNLSIRGNVKEVVARGANPCVISMRGLEGDGDRFIIPAVHPDLTPLVSVVPLQLIA
FT                   YYAALHRGCDVDKPRNLAKSVTVE"
FT   CDS_pept        169582..169719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0156"
FT                   /locus_tag="GK0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0156"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3N9"
FT                   /protein_id="BAD74441.1"
FT                   /translation="MSVDWKSVEHRIYTMCMIQNEDKVLCKLAHYFRIPFSNYFERIRK
FT                   "
FT   CDS_pept        complement(169853..170653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0157"
FT                   /locus_tag="GK0157"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0157"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74442"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3N8"
FT                   /protein_id="BAD74442.1"
FT                   /translation="MYKTFYSLSREPFSKETNPPEAYQGASYQEALAALDYVKRTRGIG
FT                   LLIGEPGAGKTFALRAFKESLNPSLYHVVYFPLSTGSVMDFYRGLAFGLGEEPKYRKVD
FT                   LFYQIQQGIERLYHEQRVTSVFILDEMHLAKDAFLQDIAILFNFHMDSTNPFVLILAGL
FT                   PHLQAKLRLNQHRPLHQRIIMRYQMGPLDKEEVVGYIEHRLKQAGAKHSIFTPAALEAI
FT                   ALQSQGWPRIINNLATTCLLYGAQLKKHMIDEDIVRMAAEEVGY"
FT   CDS_pept        complement(170646..171695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0158"
FT                   /locus_tag="GK0158"
FT                   /product="transposase of IS1604-like element"
FT                   /note="similar to C-terminal region of transposase (CDC1551
FT                   417 aa) of Mycobacterium tuberculosis (GK0158 and GK0161
FT                   are divided by IS-like element (GK0159 and GK0160))"
FT                   /db_xref="EnsemblGenomes-Gn:GK0158"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74443"
FT                   /db_xref="GOA:Q5L3N7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3N7"
FT                   /protein_id="BAD74443.1"
FT                   /translation="MSSAFLDNVSSFHYPNKQLKKVGIFHTVYLTGICSPVTVFYQHLI
FT                   EQGEIQSISYFTIYRLLKKYNLVGKEILPIPERKRFAYDQVNELWQGDLSHGPLIRVNG
FT                   KTQKTFLIAYIDDCSRVVPYAQFFSSEKFDGLRIVTKEALLRYGKPKRIYSDNGKIYRA
FT                   EPLQYACAELGITLIHTQPYDPQSKGKIERFFRTVQTRFYPLLEMNSPKSLEELNERFW
FT                   KWLEEDYHRKPHASLNGKTPHEVFQSQVHLVSFVEDSDWLDSIFLKREYRKVKADGTVT
FT                   LNKQLYEVPPRFIGQSIELRYDEQGVYVYEDGQRVAEAVLVRFEDNAYVKRHRSPFATV
FT                   PVEGGENDV"
FT   CDS_pept        complement(171770..172633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0159"
FT                   /locus_tag="GK0159"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0159"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74444"
FT                   /db_xref="GOA:Q5L3N6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3N6"
FT                   /protein_id="BAD74444.1"
FT                   /translation="MKPKERFSIIQELSNTYPIAWLCQLAGVSRSGYYRWMNQQGIVTE
FT                   KQKENEQIKQMILECHQKVNGIYGYYRVKAWIKRNYGKTVNHKRVYRLMKELGVQAKIR
FT                   RKKPKYKAGKENIVASNVLNRDFVATAANQKWVTDITYVPFQGTYLYLSAIKDLYNNEI
FT                   IAYRISRSNDLKLVIETVKDAIKKRDARGVLLHSDQGSQYTSRQYHQLLKAHHIIPSMS
FT                   RRGNCLDNACMENFFGHLKSEMVDLPTFETEEEMIEAIDQYMYFYNYERCQKKLDYLSP
FT                   VEYRIA"
FT   CDS_pept        complement(172630..172956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0160"
FT                   /locus_tag="GK0160"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0160"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74445"
FT                   /db_xref="GOA:Q5KUB1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR030514"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KUB1"
FT                   /protein_id="BAD74445.1"
FT                   /translation="MFETKQTPKGKTTYSVEFKWRAVQMYIEEGWGYKRICQELGIPCT
FT                   KTIRLWVKRYHEHGLKGLEERRGTSKSPFKGRPRKKECSLEEENRRLKAENDYLKKLRE
FT                   LARR"
FT   CDS_pept        complement(173028..173336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0161"
FT                   /locus_tag="GK0161"
FT                   /product="hypothetical protein"
FT                   /note="similar to N-terminal region of transposase (CDC1551
FT                   417 aa) of Mycobacterium tuberculosis (GK0158 and GK0161
FT                   are divided by IS-like element (GK0159 and GK0160))"
FT                   /db_xref="EnsemblGenomes-Gn:GK0161"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74446"
FT                   /db_xref="GOA:Q5L3N4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3N4"
FT                   /protein_id="BAD74446.1"
FT                   /translation="MNESMRQEIALFRYGLIAPLVNGQVDPKTYLKEVAERIHQVPHHG
FT                   EKRIAAKTILDWCTQYKKGGFEALKPKRRSDRGHSRRLSPEEEDHILALRKKHPHMP"
FT   CDS_pept        complement(173479..174042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0162"
FT                   /locus_tag="GK0162"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0162"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74447"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KZ96"
FT                   /protein_id="BAD74447.1"
FT                   /translation="MIRFHDFQVDVQTYAQRGKQNDFPLLKRCPHCQAKRPLYRHGYYE
FT                   RNAVTSHQSYRIWIARYRCPECRRTVAVLPSFLLPYFQYTLPTIWRVVKERLGLTPKRG
FT                   MEEAPLLPTDEGVLFYVRRLFRNLNHLHWFFAERWRKIGPAIAQARERALWWIQTMEEI
FT                   GLFFVIQEIWEHRSTHLFARTFSS"
FT   CDS_pept        complement(174102..174791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0163"
FT                   /locus_tag="GK0163"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0163"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74448"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3N2"
FT                   /protein_id="BAD74448.1"
FT                   /translation="MQEHFHFTTDPAKLQKQYAAIFCFVSAQLSLIQMYLHRRNRHLVK
FT                   QEDEVVMAVHLLGKLLGFSSERAWHRFVTGNLFTNGSFLERSRYNRRCRALGFAIKWIR
FT                   HELAKRGQHHAYAVVDSLPLPLCHPARMQRVKRFRGITDMGYCASKKQWYYGFKLHLQV
FT                   TNQGLAMGYVVTEASCHDVKAAETVMTQIPHPYNFGCKLSLYFRTKKTLFCTFLRNIPL
FT                   PLSERMC"
FT   CDS_pept        complement(174906..176003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0164"
FT                   /locus_tag="GK0164"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0164"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74449"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR017996"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3N1"
FT                   /protein_id="BAD74449.1"
FT                   /translation="MMIPMLPSEKYFGNFELVYPFYGAMPTGVTVSETGRIFVCFPRWG
FT                   DDVKFTVAEIVEDKLLPYPNLQTNLVNPENITRTFISVQSVVADGRGTLWVLDTAAPNF
FT                   SEPIKGGAKLVAVDLETNTIRKVYTFTEDVVLPTTYLNDVRFDFRVGKAGYAYITDSSS
FT                   TGPGAIIVVDLADGNAFRRLNGANSTSPDPYFIPKVEGKVLMNRNKDGSTSPFRLASDG
FT                   IAISPDGRVLFFCPLTSRHLFSITTEALRDRSIPDMELPYYVEYWGEKGASDGMITDAK
FT                   GNVYAGDYEHNCIRKILPNGTMETIIHDPRMLWPDTLSIGPDQYLYVIVNQLHRQPRFH
FT                   YGKDLRQKPYSLLRIKIDEFPAPTF"
FT   CDS_pept        complement(177247..177786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0165"
FT                   /locus_tag="GK0165"
FT                   /product="hypothetical protein"
FT                   /note="similar to N-terminal region of transposase of IS
FT                   653 (BH0434 427 aa) of Bacillus halodurans (GK0165 divided
FT                   by frame shift is possibly continued to 176,383 bp)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0165"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74450"
FT                   /db_xref="GOA:Q5L3N0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3N0"
FT                   /protein_id="BAD74450.1"
FT                   /translation="MLKKPFPVLQSREGLEWLYQCIVEAMKEFGKTEVIVGIEPTGHYW
FT                   LNLAYFLDEKGIPLVMTNPMHVKRSKELDDNLPTKHDAKDALVIARLVKDGRFSYPRIL
FT                   KGMEADLRVGATFRSKLVEEQGAIRNQMIRWLDRYFPEFSQVFPSFGKMALAVLEYTPF
FT                   PSDLAGKELYRCNLKL"
FT   CDS_pept        178398..178970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0167"
FT                   /locus_tag="GK0167"
FT                   /product="transposase of IS653-like element"
FT                   /db_xref="EnsemblGenomes-Gn:GK0167"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74451"
FT                   /db_xref="GOA:Q5L3M9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3M9"
FT                   /protein_id="BAD74451.1"
FT                   /translation="MKRLKITNDHGWTPRTLRKQERKIKNTLLRQRVMAVRLVMEGYLG
FT                   KEVASMVNVCRQTVSHYVSLFNEGGLELLLHRDFAPGREPFLTEEQQEEIKQLVLTTTP
FT                   AELGWDVASAWNTKLLQSYVEKHFGVCISREALRKLLHRKGLSWTRPTYTLAKGNPDEQ
FT                   KQLEKQMDLIKKLDHQGHRRCRSSVHR"
FT   CDS_pept        178924..179148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0166"
FT                   /locus_tag="GK0166"
FT                   /product="hypothetical protein"
FT                   /note="similar to N-terminal region of transposase of IS
FT                   642 (BH2520 188 aa) of Bacillus halodurans (GK0166 divided
FT                   by frame shift is possibly continued to 179,465 bp)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0166"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74452"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3M8"
FT                   /protein_id="BAD74452.1"
FT                   /translation="MITKDTEDAVLLYIDETHIRSYHVLRSTWSEVGRQKQVPTFGHHA
FT                   HVSRFGAVNIHDGETVLHQTTAAPMPRRS"
FT   CDS_pept        179528..179734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0168"
FT                   /locus_tag="GK0168"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0168"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74453"
FT                   /db_xref="GOA:Q5L3M7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3M7"
FT                   /protein_id="BAD74453.1"
FT                   /translation="MNKIGKISLLLFCNLITAIIMGTFAYKTYNESKIVQSVIFAAACI
FT                   STFIVVILSLVPNRNDNKRRSKL"
FT   CDS_pept        179979..181112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0169"
FT                   /locus_tag="GK0169"
FT                   /product="transposase of IS5377-like element"
FT                   /db_xref="EnsemblGenomes-Gn:GK0169"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74454"
FT                   /db_xref="GOA:Q5L3M6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3M6"
FT                   /protein_id="BAD74454.1"
FT                   /translation="MNKHTTLPNLMQKLVSDEEIQLIAEAVGYRDSSRTFTLRELIHFF
FT                   LLAAMHQWKSFRHGADVGPLYGLPRFHYSTVSKKAKEVPYDIMKRLLALIISKCNRQTR
FT                   RSLRFPKPLRVVDSTTVTVGKNRLPWAPYHGERAGVKLHVAYSPGSSLPADVVETIGLR
FT                   HDGPVGEQLTNAQQVLVEDRAYFKIERLDRFVEQHQLFVIRMKDNIELHQKKSLKRLSS
FT                   TSSSVQADFTCQLGTKQCRSTKRHRVVIFRDANGRDIRVVTNLFHASAETIADMYQQRW
FT                   TVEVFFRWVKQYLNVPTLFGTTENAVYNQLFAAFIAYVLLRWLYDQTKKQTNVSLSFIS
FT                   FVRRFFSGQLPLDWKSGMAAALFEYAQIYGRRMYNFG"
FT   CDS_pept        181231..182115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0170"
FT                   /locus_tag="GK0170"
FT                   /product="transcriptional regulator (AraC/XylS family)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0170"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74455"
FT                   /db_xref="GOA:Q5L3M5"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3M5"
FT                   /protein_id="BAD74455.1"
FT                   /translation="MSYSPIIQKTIEYIETNLHEELSLENIAQFAGFSKYHFHRIFQKE
FT                   VGVTVSEYVRYRRIANSANMLLYTDKKIIDIAFYYRFETQESFTRSFKKYYQLPPGQYR
FT                   KIMGKLTLQREDVMLKNEQLKGWKLSGSHPFNYKMGIDREIFHKGKASGFLKAVTVQSQ
FT                   AEFATMMQQFKAEKYLGKRIKLSGFIKSKGVDGFCGFWMRVDDALGDVLQFDNMSDRPI
FT                   VGDTEWNHYYIVLDVPKNSAVISFGVLLSGKGQVWIDELKFEEVDERTPTTNIDFTVDL
FT                   LDEPTNLSFEEWE"
FT   CDS_pept        182500..182955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0171"
FT                   /locus_tag="GK0171"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0171"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74456"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR040890"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3M4"
FT                   /protein_id="BAD74456.1"
FT                   /translation="MDCCAPTNRGETTETNCPKCGQNGRRVPLITLKSLLKPAALATLV
FT                   PDRDYVFCPNPFCETVYFALDGSLAFFVGDLKVPVFQKDSAMDVPVCYCFDWTRERIAE
FT                   AVRHGGEPLQEIKAHVQAGRCGCEVNNPQGACCMGNVAEFIRQVNGN"
FT   CDS_pept        183001..183732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0172"
FT                   /locus_tag="GK0172"
FT                   /product="Hnh endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:GK0172"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74457"
FT                   /db_xref="GOA:Q5L3M3"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3M3"
FT                   /protein_id="BAD74457.1"
FT                   /translation="MFYNEPLEISTAVWIKMLQDKEVTTENDLKILKLVYESKNHEIRA
FT                   SEIASRLNIPHHGPINLQISRFSKRVIHNTGVQPPLRKDGKPRWWHVPFLGYEKSGRFP
FT                   WIMRPELVIACEEIFGQNDTEFVYSVEVSREDVSSLTEGTVRQVFVNHYERNRRARRIC
FT                   INHYGSKCVVCGFDFEKTYGPIGKDKIHIHHLVPLSEIQKEYEVDPIRDLRPVCPNCHF
FT                   IIHSKREPFTIEEVRRMMLGK"
FT   CDS_pept        183729..183944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0173"
FT                   /locus_tag="GK0173"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0173"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74458"
FT                   /db_xref="GOA:Q5L3M2"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3M2"
FT                   /protein_id="BAD74458.1"
FT                   /translation="MRKDGHRKIIGAFTTFSTFKLESVNLFRRGEGKTSLLYMGMTYLL
FT                   GIGAAWLVFCKKKVQSIAVYKFVYTA"
FT   CDS_pept        184248..184805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0174"
FT                   /locus_tag="GK0174"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0174"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74459"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3M1"
FT                   /protein_id="BAD74459.1"
FT                   /translation="MNPYYIHPYNRMQWCYPMPAYWPPQQDWRYWQPYAGGIIQYTRND
FT                   ENPLVELKDYGGQPFVVNIEQAAKRNPNYRTAIWTGKHLQVTLMSIDVGGDIGLEVHPD
FT                   VDQFIRIEQGQGLVQMGGRKDRLEFERNVSEDDAIMIPAGTWHNVTNTGHVPLKLYSIY
FT                   APPEHPFGTVHRTKAEAMAVHR"
FT   CDS_pept        185011..186669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0175"
FT                   /locus_tag="GK0175"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0175"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74460"
FT                   /db_xref="GOA:Q5L3M0"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3M0"
FT                   /protein_id="BAD74460.1"
FT                   /translation="MNVQVKKVYRNSCLNIISALFKKLGLPQLIDHLVPVDPQCQTRVS
FT                   DAVQAILYNVFDGRQALVHLEHWAQEVDCEKLIRPDLHPSWLNDDALARHLDRLYEAGI
FT                   HNVISTCLIHIYRKEGLSLRAFHADTTDKTVYGAYESASLEALQITHGYNRHHRWQKQI
FT                   GFGLVGNEDGIPFYGDVHDGNLPDKTWNPEVLSRVHEQLKQAKIEDEWIYVADSAAMTK
FT                   ETLAQTKAANAFLITRGPSSLRIVKTALAEADAEDTTWSDPFTLAERNGATYRVWETAS
FT                   TYEGHPVRLIVVESSALDQRKGKTLEKERTKEAELLREEQARWERHPFSCREDAEQALA
FT                   SLKASLRPRFHRVEAAVEEIVRLKKRRGRPKKGAEPEVETLYFLHLDVEFDQDAWEQAR
FT                   RKASRFVLVTTVPKEWKGQPMDAQEILKLYKGQISVEMNFAFLKDPFFTDEIYVKKPER
FT                   VAVLGYLFLLALAIYRVFQRRVRQFITPEHPLKGPGGRKLTRPTGQAIFQLFQYVNVVL
FT                   FKLPDGRIQRSLDRSLTPDQRRILQGLGMDESIYV"
FT   CDS_pept        186825..187346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0176"
FT                   /locus_tag="GK0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0176"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74461"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3L9"
FT                   /protein_id="BAD74461.1"
FT                   /translation="MKDIRMTVVLTLLLLLVLVGCAKPKVEQTVKLGGAVKTIGDLVVL
FT                   SGNSNLPKGAVVQIVMKEIEGGKQVLEEKVNVGEDGSYSWSAKRPERAKEYELDVMFLP
FT                   ELQPKHVKEKYGEKGELIKKDSSGRVEYQTDGQTYVGIKMYDRILKIGDGMGGQQSMLA
FT                   ETLPPPAPSY"
FT   CDS_pept        187428..188309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0177"
FT                   /locus_tag="GK0177"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0177"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74462"
FT                   /db_xref="GOA:Q5L3L8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3L8"
FT                   /protein_id="BAD74462.1"
FT                   /translation="MKKWKLALTVLADLLLTIFTIMAIIAFAQSYSLFPSPQMVTVFWQ
FT                   QFQQLFWSFFSIRDITVSLSQWHNAPLLSTMMEPYAYSLIILWGALAVSFLIAVTGAYI
FT                   CFLLPRPLQKMVKGIAFFLESIPDVIFIFSTQLFVIWVFKKTDLLIVNPVAGFDNVYVL
FT                   PIVMISILPSILLFQMTFLAFTEEKDKPYVEYALAKGLSKTAVLWRHMFRNALITVFSN
FT                   VQYLFWFMLSNLLVAEYLFNMHGLFRFLYEQLHTPEVVAIGLAMLFLPFYIIDVAGKRV
FT                   IAYLTGIERGVA"
FT   CDS_pept        188309..189322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0178"
FT                   /locus_tag="GK0178"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0178"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74463"
FT                   /db_xref="GOA:Q5L3L7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3L7"
FT                   /protein_id="BAD74463.1"
FT                   /translation="MRAFRNVYFTIGFIIAAGLLLASFLYSYWLKDIIPQPPKQIYNEA
FT                   GRLVDVPPYPPSWAHPFGVDRQGEDVFWKVIDGAKYTIFTALAVSLLRLAFGTVGGIMY
FT                   AFYLQKFRFIAESIVRAFRFVPAIFLTMLFFAFIPLEEQGAGMGVLIKQLLVLAAVALP
FT                   PLMLVIGNDIAVFLQNEFVVSSRLMGADNVWLIRKHVLPYMRPRLFLLFTQQTVQSLLL
FT                   LVHLGAFQILLGGVKVIYDSDGLGPPEKVAFSLSNEWSGLIGLSYREMMLDQWIVVGPC
FT                   VAFIVAIFAFKLMGKGLEQVIAGKGKRKQRKKQWSSSGKPASFPPQQGDFEFVLYR"
FT   CDS_pept        189349..189954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0179"
FT                   /locus_tag="GK0179"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0179"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74464"
FT                   /db_xref="GOA:Q5L3L6"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3L6"
FT                   /protein_id="BAD74464.1"
FT                   /translation="MELRDRIDFLCKTILAIKTAGRLVLGIDGLSRSGKTTLANQLSQT
FT                   LREQGISVCVFHMDDHIVERAKRYHTGNEEWFEYYYLQWDVEWLTHQLFRQLKASHQLT
FT                   LPFYDHETDTHSKRTVYLSDSDMIMIEGVFLQRKEWRPFFDFVVYLDCPREIRFAREND
FT                   QVKQNIQKFINRYWKAEDYYLETEEPIKRADVVFDMTS"
FT   CDS_pept        190475..190954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0180"
FT                   /locus_tag="GK0180"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0180"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74465"
FT                   /db_xref="GOA:Q5L3L5"
FT                   /db_xref="InterPro:IPR021354"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3L5"
FT                   /protein_id="BAD74465.1"
FT                   /translation="MKRETLFLKASLVLIGLPVLALCLFLVPALAKVAVKLVPTFPWIK
FT                   YFVYLVFEASALPFYFALYQAFRLLVYIDRNDAFSEASVKALKTIKHCAVAISGLHLLV
FT                   LPLFYLFAEKDDAPGVIFVGLIVPFASLVIAVFAAVLQKLLQQAIEIKQENELTI"
FT   CDS_pept        190965..191189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0181"
FT                   /locus_tag="GK0181"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GK0181"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74466"
FT                   /db_xref="GOA:Q5L3L4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3L4"
FT                   /protein_id="BAD74466.1"
FT                   /translation="MPIIVNLDVMLAKRKMSVTELSEKVGITMANLSILKNGKAKAIRF
FT                   STLEAICKALDCQPGDILEYRSEEGESNP"
FT   CDS_pept        191206..192108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0182"
FT                   /locus_tag="GK0182"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0182"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74467"
FT                   /db_xref="GOA:Q5L3L3"
FT                   /db_xref="InterPro:IPR008535"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3L3"
FT                   /protein_id="BAD74467.1"
FT                   /translation="MKGEKHEVAVNECPPFCLMIVRVRQFCRKSWLIKAFVQLIRFGWA
FT                   QALSCVFPVVIFASLALTKLAPLPLLPRYDWLLIICLLMQWWMVRSGMETRDELKVITL
FT                   FHVIGLALELFKVRMGSWSYPEEGYTKIFGVPLYSGFMYASVASYLCQAWRRLKVELVQ
FT                   WPPFWMVVPLASAIYLNFFTHHYWVDVRWWLSSLVMLVFWRSWVTYEVGGVRYRMPLVL
FT                   SFLLIGFFIWIAENIATFFGAWQYPNQVKAWSLVHLGKVSSWCLLVIVSFLIVATLKQV
FT                   KTMAVTGAVERSHEDGKSL"
FT   CDS_pept        complement(192173..192661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0183"
FT                   /locus_tag="GK0183"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0183"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74468"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3L2"
FT                   /protein_id="BAD74468.1"
FT                   /translation="MMDHNEQVRQQLIKSVSGLSDEQLNTRVADGSWTIAQVLEHLYLI
FT                   ETSIAAMIAYTLKHGESQPVEEKPIHLTVDRSKKVEAPDFARPDNRFFTRHELEEKLHQ
FT                   SRQRLRQITEQANPADLEAKSFPHPIFGPLNLKQWVEFVGYHEQRHLAQMEEIKAQLP"
FT   CDS_pept        complement(192711..193463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0184"
FT                   /locus_tag="GK0184"
FT                   /product="deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:GK0184"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74469"
FT                   /db_xref="GOA:Q5L3L1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3L1"
FT                   /protein_id="BAD74469.1"
FT                   /translation="MIDAHIHLDQYTDIDEQINRWQEAGITGVVAVSTDLRSSCRTLEL
FT                   KQRFPSFVYAAIGFHPEQPLPSEADWNEWTELVKQERPLLAAIGEVGLPYYSAEACAKL
FT                   PAYQERLTEIAAIAADASLPLALHAVYDRAETALAILLQAGVRQAHFHWLKAEPAVVKQ
FT                   IVQCGYYISVTPEVCYRERDKQLLSLVPIEQLLLETDGPWPFAGPFAGKLTTPLWLLDS
FT                   ARAVAAHYGRDIEQVKTMITANTKRLYG"
FT   CDS_pept        complement(193521..194894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0185"
FT                   /locus_tag="GK0185"
FT                   /product="transcriptional regulator (NtrC/NifA family)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0185"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74470"
FT                   /db_xref="GOA:Q5L3L0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3L0"
FT                   /protein_id="BAD74470.1"
FT                   /translation="MNRDMETLLSMYEQILEMIDLGVHAVDQHGKTVIYNRKMRDIEGM
FT                   NIEDVLDKNILDVFRFNPEQPSTLLEALRTGESILNKQQTYFNNKGQAVTTVNQTHPLQ
FT                   KDGRIIGAVEIAKDITKFRKLIQEHHQRGEAGRTFADIIGQSEAMQKAIRLARHAARSE
FT                   ASVLLIGEKGTGKDLLASCIHHESERRAKPFFAQTCLSLPDDWMETMLFGSEEDGEIQP
FT                   GLFEQADGGTVLLDDIDSLSLPLQQKLARFLQEKQFVRAHGQEPVRADVRLIASTSGDP
FT                   IDAVQNGELIKSLYYQIAVHCIVLPPLRERKEDILPLAIHFIRQGNERYGLHVEGLGDD
FT                   VQEAFLAYSWPGNVRELEAVILETMATMEQEQTITLAHLPAPFRAKLAPDETKTDFLFD
FT                   TEDILPLDKYMEEVEIYYIRKALQHHGFNITKTAKALGLSRQNLQYRIRKYQIDKEWG"
FT   CDS_pept        195130..196542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0186"
FT                   /locus_tag="GK0186"
FT                   /product="amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:GK0186"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74471"
FT                   /db_xref="GOA:Q5L3K9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3K9"
FT                   /protein_id="BAD74471.1"
FT                   /translation="MQPVQELKRELKSRHLFMIALGGVIGTGLFLGSGYTIHEAGPGGA
FT                   VVAYLFGGLVMYLTMLSLGELAVRIPDAGSYQTYATKFISPAVGYCIGWLSWLNWSVTV
FT                   GIELLTVSILMKRWFPDVPTWVFCAVFALLLFLINALSVKGFGEVEFWFSSIKVLTVIA
FT                   FIVLGLAAMFGVIHMKNGQPAPFFSNFTDHGGLFPNGFWAIFTTMILVNFSFQGTELVG
FT                   VAAGESREPEKTVPVALRNTVWRILIFFILAIFVLAGLFPWEKAGVVESPFVEVFDNIG
FT                   IPYAADIMNFVIITAVLSVANSGLYATSRVLWSMSRQGMVTPFFSKLSKRGVPINALIA
FT                   SIAIGCLSLLCSVYAEDTVYVWLTAIAGFGAVTVWASIALSSYFGRKAFLREGGDVRDL
FT                   KYRTPLYPFVPLAAFALNMATIIGLAFIPDQRIALYCGIPFLLACYGYYHLVAKKRVQP
FT                   LAAEEGELKAAK"
FT   CDS_pept        196638..198185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0187"
FT                   /locus_tag="GK0187"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0187"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74472"
FT                   /db_xref="GOA:Q5L3K8"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3K8"
FT                   /protein_id="BAD74472.1"
FT                   /translation="MVQPYRHEPLTDFTVEANREAFLAALKKVESELGRDYPLVIGGER
FT                   VMTEDKIISINPANKTEVVGRVAKANKELAERAMKTADEAFRTWSRTSPEARADILFRA
FT                   AAIVRRRKHEFSAWLVKEAGKPWREADADTAEAIDFMEYYGRQMLKLKDGIPVESRPGE
FT                   TNRFFYIPLGVGVVISPWNFPFAIMAGTTVASLVTGNTVLLKPASATPVVAYKFVEVLE
FT                   EAGLPAGVLNYIPGSGAEVGDYLVDHPRTRFISFTGSRDVGIRIYERAAKVHPGQIWLK
FT                   RVIAEMGGKDAIVVDKEADLELAAQSIVASAFGFSGQKCSACSRAIIVEDVYDQVLSRV
FT                   VELTKQLNVGDPAEQATFMGPVIDQNAYNKIMEYIEIGKQEGRLMTGGEGDDAKGFFIQ
FT                   PTVFADVDPNARIMQEEIFGPVVAFAKARDFDHALEIANNTEYGLTGAVISRNRANLEK
FT                   ARHEFHVGNLYFNRGCTGAIVGYQPFGGFNMSGTDSKAGGPDYLILHMQAKTVSEMF"
FT   CDS_pept        198302..199501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0188"
FT                   /locus_tag="GK0188"
FT                   /product="ornithine aminotransferase"
FT                   /EC_number="2.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:GK0188"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74473"
FT                   /db_xref="GOA:Q5L3K7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034757"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3K7"
FT                   /protein_id="BAD74473.1"
FT                   /translation="MTTKSQQLIEQTERYGARNYHPLPIVISEAEGVWVKDPEGNRYMD
FT                   MLSAYSAVNQGHRHPKIIEALKKQADRVTLTSRAFHNDQLGPWYEKVCRLTKKEMVLPM
FT                   NTGAEAVETALKAARRWAYDVKGVPDNQAEIIVCEGNFHGRTLAAVSLSSEPAYKRGFG
FT                   PLLSGVKIIPYGDIEALKAAITPNTAAFLVEPIQGEAGIRIPPQGFLKAAYDVCKANNV
FT                   LFIADEIQTGLGRTGKLFACDWEEVVPDMYILGKALGGGVFPISCVVANRDILSVFEPG
FT                   SHGSTFGGNPLACAVSIAALEVIEEERLAERSLELGEYFLSKLKQIRNDDIKEIRGRGL
FT                   FIGVELHVPARPYCEALKEQGLLCKETHETVIRFAPPLIITKEELDWAFERIANVLSRP
FT                   "
FT   CDS_pept        199459..200766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0189"
FT                   /locus_tag="GK0189"
FT                   /product="NAD-specific glutamate dehydrogenase (NAD-GDH)"
FT                   /EC_number="1.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:GK0189"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74474"
FT                   /db_xref="GOA:Q5L3K6"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3K6"
FT                   /protein_id="BAD74474.1"
FT                   /translation="MGVRTDCECLVPSINRVKEANETMEENMFLSTQRVIKEALAKLGY
FT                   GEEMYELLKEPLRVLTVRIPVRMDDGTVKVFTGYRAQHSDAVGPTKGGIRFHPDVTEEE
FT                   VKALSMWMTIKAGIVGLPYGGGKGGIVCDPRNMSMGELERLSRGYVRAISQIVGPSKDI
FT                   PAPDVFTNSQIMAWMMDEYSRIREFDSPGFITGKPLVLGGSQGREKATALGVTICIEEA
FT                   AKKAGIELQGARVIIQGFGNAGSFLAKFLHEAGARVIGISDAYGALYDPNGLDIPYLLD
FT                   RRDSFGTVTTLFENVITNQELLEKECDILVPAAVANQITRDNAANIRAKIVVEAANGPT
FT                   TLEATKILTERGVLLVPDVLASAGGVTVSYFEWVQNNQGYYWTEEEVVEKLKEKLTSAF
FT                   HRVYELAESRRVDMRMAAYMIGLRQTAEAARYRGWV"
FT   CDS_pept        201003..201611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0190"
FT                   /locus_tag="GK0190"
FT                   /product="alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0190"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74475"
FT                   /db_xref="GOA:Q5L3K5"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3K5"
FT                   /protein_id="BAD74475.1"
FT                   /translation="MQAWITDFMEQFGYIGIFFMIALENIFPPIPSEVILPFGGFMTTY
FT                   TSLTVPGVIAAATAGSVAGALVLYGIGRLLSVERLERIVDRWGGWLRVKPEDIAKANLT
FT                   FHRYGVWAVFFGRMVPLVRSLISIPAGMAKMNIGLFVWLSVLGTLIWNTILISIGAALG
FT                   ESWGKVSEVIGMYAEVVYVIIAAIILIGAVRFWKRRRAS"
FT   CDS_pept        complement(201810..202799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0191"
FT                   /locus_tag="GK0191"
FT                   /product="ferrichrome ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0191"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74476"
FT                   /db_xref="GOA:Q5L3K4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3K4"
FT                   /protein_id="BAD74476.1"
FT                   /translation="MRMRITAVLGMLLLLIAATAAIALGTGEAPLSYGRIAPTLFGYGS
FT                   MQEAFILFSLRLPRIVITLLAGMALALSGAMLQGTTRNELADPGILGINAGAGAGVAIF
FT                   FLFFPIEAGTFLYALPLVALVGALLTAAAMYAVSYHQTTGLQPVSFVLTGIGFSMALSG
FT                   LMIILISAADRTKVDFIARWLSGNIWGDDWPFVWAMLPWLVIGALIGLYRAKRLNLLHL
FT                   GDPVAIGVGVHVRRERLVLMATAVAVAAAAVAVTGGISFIGLMAPHIAKMIIGPRHERA
FT                   IPAAMLIGGWLLLAADTIGRNVLAEPLPAGVVVSFIGAPYFIYLLLKR"
FT   CDS_pept        complement(202796..203803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0192"
FT                   /locus_tag="GK0192"
FT                   /product="ferrichrome ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0192"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74477"
FT                   /db_xref="GOA:Q5L3K3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3K3"
FT                   /protein_id="BAD74477.1"
FT                   /translation="MEANRRLWPFRYTFLFSLILLMAIWFGSMAIGVADTTWSDVWRAL
FT                   FSDEQGKQLDLIRELRLPRETAAAFVGAGLAVAGAIMQGMTRNPLADPGLLGLTAGANA
FT                   ALAITMAFFPSAHYLAITIACLLGAAVGAGTVFGIGAARKGGFSPLRIVLAGSAVSALL
FT                   FAVAEGVGLYFHISKDVSMWTSGGVAGTSWKQLSVIIPLIVIGLAIAVWYSRQLTILSL
FT                   SEDVAVGVGQKTTAVKTWLFSAVFLLTGASVAIAGNITFIGLMIPHLVRAIAGADYRFI
FT                   IPLSATVGATGMIVADTAARTVNAPFETPVAAIVAVIGLPFFLFVVRKKGRGFE"
FT   CDS_pept        complement(203871..204797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0193"
FT                   /locus_tag="GK0193"
FT                   /product="ferrichrome ABC transporter (ferrichrome-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0193"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74478"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3K2"
FT                   /protein_id="BAD74478.1"
FT                   /translation="MRKTWLSLLLLLALVLSACGNAADDNKNSSASPKEKKPETITYQS
FT                   ENGPVEVPADPKRVVVLSTFAGHVLALDVPIVGVDSWSKMSPLFQEKLKDAEVVTDEDI
FT                   EKIMALKPDLIIGLSNTKNVDKLSKIAPTVTFTYGKVDYLTQFLEIGKLLNKEKEAKAW
FT                   IDDFKQRAQQAGEDIRAKIGENATVTVAENFDKQLYVFGNNWARGTEILYQEMKLKMPK
FT                   AVEEQALKPGYYAVSLEALPQFVGDYLILSKNGDGDTSFMETNTFKNIPAVKNGRMFVA
FT                   DAKAFYFNDPITLDYQLDFFKKHFLGQ"
FT   CDS_pept        complement(204804..205595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0194"
FT                   /locus_tag="GK0194"
FT                   /product="ferrichrome ABC transporter (ATP-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0194"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74479"
FT                   /db_xref="GOA:Q5L3K1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3K1"
FT                   /protein_id="BAD74479.1"
FT                   /translation="MVRLYAEELTVRYDDRTIFERLSVRIPDRQITAIIGPNGCGKSTL
FT                   LKTLTRIISPQSGAVILDGRAISQQPTKELAKKIAILPQTPEATSGLTVAELVSYGRFP
FT                   YQRGWGRLTKQDYEAIDWALAVTKTADLKHRPVDALSGGQRQRVWIAMALAQETDIIFL
FT                   DEPTTYLDIAHQLEVLELLERLNKEEGRTIVMVLHDINQAARFSDYVIAMKAGTIVKAG
FT                   PSEDVICRDVLRDVFGIDADIGRDPRTNKPICFTYQLLREA"
FT   CDS_pept        205733..206035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0195"
FT                   /locus_tag="GK0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0195"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74480"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3K0"
FT                   /protein_id="BAD74480.1"
FT                   /translation="MDKVCGRHSPAVKRTPDYISQAYRCIPRCNLTDIRPVRPQKARPF
FT                   ASQLSSAMLLRKRNDPGCLNGKNTTHSAGLLRFCNKSLLFCNGRFDTMENGDVFF"
FT   CDS_pept        206111..208174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0196"
FT                   /locus_tag="GK0196"
FT                   /product="sigma-L-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GK0196"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74481"
FT                   /db_xref="GOA:Q5L3J9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3J9"
FT                   /protein_id="BAD74481.1"
FT                   /translation="MTIEDIMWKTTAAVWESDSLEQAARTLAKQGMAGAIACDSEGEMV
FT                   GVVAAEDVLFGLAQGRKTVREVMRPPQPLPVHARLEEVAFGGSPLRAVVDESGRLAGLL
FT                   TKEQYLAAQAKASRLRLKQLEAMFNAAHNGILSIDAKGRITSINPAAERMARTTKEEAL
FT                   GRLLTDVVVPSGLLDVVRTGQGCTEKYRVGKRVYITNRSPIVDDGKVVGAVGVFQDISE
FT                   IEFISSELETVKRIANELQTVMDAATDGIAIADRNGAITRQNQKWAALFPDAGQGRIPA
FT                   PLDQVVRQALDRCQPCSMLHQGAETGNTLIVSAVPIIEEDGRAERVVLYVKDMTEMEQL
FT                   RSELEETKRLLHMLGRQEEDHLIYRAPAMAHVVNIARQAAAVDVTLLLTGESGTGKEEL
FT                   ANYIWKQSARRARPFVKVNCGAIPETLMESELFGYEPGAFTGAAKKGKKGYFEQADGGT
FT                   IFLDEISEIPLHLQVKLLRVLQSMEIMRLGAEAPKRIDVRVIAATNKPLEELVAAGRFR
FT                   ADLFYRLNVMPIAIPPLRDRKEDIPLLVDHYRKRFAEKYQKPLVFTDGALAAMMDYHWP
FT                   GNVRELVNAVERMFVTAVSPVIDEHQVAKWLHLEPEPAASPVAVGEIIPLKQATAEVER
FT                   QLIIKALHKAKTYRRAAKLLGVDASTLVRKAQKYGIQSWGGEEDGFHAASRD"
FT   CDS_pept        208146..209306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0197"
FT                   /locus_tag="GK0197"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0197"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74482"
FT                   /db_xref="GOA:Q5L3J8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3J8"
FT                   /protein_id="BAD74482.1"
FT                   /translation="MDFTLPAEIEFLKENVRKFVREVVEPVAMDIEENDQIPQDIIEKS
FT                   KEMGLFGLSIPEEYGGLGLSMVGKCAIYEELGKTHNGYTTLIGAHTGIGTVGIVELGTE
FT                   EQKQRYLPKMATGEWIGAFALTEPSAGSNAAAIKTTAVRKGDRYIINGSKHYITNAVDA
FT                   HVFTVMAVTDPSKGPKGITSFIVEKDFPGFIVGKVERKMGLRGSHSAELFFDNLEVPAE
FT                   NVLGREGEGYVNALKILANGRAGLAARNLGSCIRLLEYCMEYAEQREQFGKPIIEQQAI
FT                   QHMLAEMSMLIEVLRSTVYRVAWMVDQKMRVVKEAAIAKLFGSEVYNKIADMAVQIHGG
FT                   LGYMKDYPIERYFRDARITKIYEGTSEIQRNIIASELRKEYGKVRA"
FT   CDS_pept        209695..209949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0198"
FT                   /locus_tag="GK0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0198"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74483"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3J7"
FT                   /protein_id="BAD74483.1"
FT                   /translation="MRRAEPLVTTGSRGLQEDSFPFRLYQKAKRLEAAAHDSIFGPDHH
FT                   ADIMNFTARQLATRMEVLKKAQEKPFDELFGLEESENVG"
FT   CDS_pept        209987..211528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0199"
FT                   /locus_tag="GK0199"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0199"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74484"
FT                   /db_xref="GOA:Q5L3J6"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3J6"
FT                   /protein_id="BAD74484.1"
FT                   /translation="MTTHVQVHHFPLFIDGQWQPATSGETFHVYNPATGEVVATVAKAT
FT                   ADDVDRAVKAARKAFDETDWKAMKPKERARVLNAIAQAIAANAQELAYLEAISSGGTIR
FT                   RISSIDILQTVDLFQTMANIVQEYPFSETLPIPPFPGPAHNFVWREPIGVCAAITPWNL
FT                   PLMIASWKIAPALAAGNTIVVKPASYTPLSTLKLAEIISSFVPPGVINVVAGPGADVGE
FT                   ALVRHPQVDKVAFTGSTEVGRRIMALAAETVKNVTLELGGKSPNILLEDADLDLAVPGS
FT                   LFGVFLHSGQLCESGTRLFVPDRLHDEVVERLVALTKTLQIGHPLDPATDVGPVISKRQ
FT                   KETVLSYIEAGKQEGATIVCGGHEVEVPGCEGGHFVAPTIFSNVTNDMKIAQEEIFGPV
FT                   LSIIRYHDVEEAVTMANDTIYGLAAGVWTRDVNKAYAIAGRLQAGVVWINDWHMLRNDA
FT                   PFGGYKQSGIGREMGKYSLDAYTQLKHVHTSMVPELGKRKWYQVLFSRLHTMMKK"
FT   CDS_pept        211545..212756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0200"
FT                   /locus_tag="GK0200"
FT                   /product="alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0200"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74485"
FT                   /db_xref="GOA:Q5L3J5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3J5"
FT                   /protein_id="BAD74485.1"
FT                   /translation="MTTLANFWLRTAIYTGSNTRALVPDLFRGLGAKRVLLLSDRGLEQ
FT                   AGVVEKVASLFDLTTHGVGPELVGIFLDIRQDAESECVNEAVRYARAVGADALLAVGGG
FT                   SVLDTAKGVKYALFKGLRDIKEAIPGGLRYESFPQAQFMPIPHIAIPTTAGTGSEVSPI
FT                   AVIYNEELRLKTNIINPFINADVAVLDPDLTVGLPPKVTAFTGMDALTHAIEALASPMA
FT                   TALTDACALQAIRLIRDYLPEAVRDGGDIRARLEMLHASLLGITAFSFALNAIPVHNFA
FT                   HAYGAMFRIPHGLANAVFLPVVMEAIPELYLPKAKLLAQALGIYDHGQGNEALLVKSIE
FT                   RIRQLRDDIGLPADFADYPMTEEQFAATIPAVASDPAAISFPMPPELIRAIGERVVKLT
FT                   VEKG"
FT   CDS_pept        complement(212861..213262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0201"
FT                   /locus_tag="GK0201"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0201"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74486"
FT                   /db_xref="GOA:Q5L3J4"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3J4"
FT                   /protein_id="BAD74486.1"
FT                   /translation="MHSHELGAFLLRIVTGFIFFAHGWVKWQRGLEAAADSFVAMGLPG
FT                   WLAYIVTIIELAGGWAMMLGLGTRPIAAAFAVIMVGAIATAKVDAGLLGNGRETGYEFN
FT                   LALLAMSVYLWLNGSRLWSLDTVIGRPRG"
FT   CDS_pept        213404..214111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0202"
FT                   /locus_tag="GK0202"
FT                   /product="protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0202"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74487"
FT                   /db_xref="GOA:Q5L3J3"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3J3"
FT                   /protein_id="BAD74487.1"
FT                   /translation="MKIEVWSDFVCPFCYIGKRRLEQALEQFPHREDVEVVFRSFELDP
FT                   NAKKETPLTIHEIIANKYGISIEEAKRANADVGRQAEAVGLTFRFETMKPTNTFDAHRL
FT                   AHYAKEKGKLNEMVERLFYAYFTESKRISDRDVLLAIAEATGLDRAEAEEVLASGRYTE
FT                   EVRRDEEEAAALGVRGVPFFVLNGKYAISGAQPVDVFRRALEKVWEEEQQASPLRSLAG
FT                   EGGMCADGSCSID"
FT   CDS_pept        complement(214222..214686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0203"
FT                   /locus_tag="GK0203"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0203"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74488"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3J2"
FT                   /protein_id="BAD74488.1"
FT                   /translation="MSRAKKWVQYFLSHRHVTMELIHKIDEAHYDYKPTPTSMTAKQLA
FT                   THMLFSFYNFANTAKHGDPSLFRQKIEEPETNLAKLAETYTEKTRQLIESMSDDDFDRT
FT                   LDLTAIFGTQMSTVQFLQLAMDHEIHHKGQLFVYVRGMGHTDLPLFVKRG"
FT   CDS_pept        complement(214705..214995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0204"
FT                   /locus_tag="GK0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0204"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74489"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3J1"
FT                   /protein_id="BAD74489.1"
FT                   /translation="MPLREMSQSKRFQIQASASRRSICLFCSIDFTAQMKPEREIAGEP
FT                   DWVLPLPKNSYRLTAEQSMSIAPLAKGPPFGSSFPADDREDVYGKMENRIP"
FT   CDS_pept        215095..215760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0205"
FT                   /locus_tag="GK0205"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GK0205"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74490"
FT                   /db_xref="GOA:Q5L3J0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3J0"
FT                   /protein_id="BAD74490.1"
FT                   /translation="MEHHSSSHVPRIKVLIADDNPFVREGLRIILSTYDEFDVAATVGD
FT                   GKEAVEYCRHHEVDVALLDVRMPNMNGVEATKLLCEQTKTKPLILTTFDDDEYILDAIQ
FT                   YGAKGYFLKNTDPERIREAIKAVYHGQVVMQEIVMDKIKSNLKEETEAAPKIDKSLFTE
FT                   RELDIMALIAKGLSNKEIAKQLFLSEGTVANYITSILDKTGLQHRTQIAVYYLTGKVG"
FT   CDS_pept        215770..216468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0206"
FT                   /locus_tag="GK0206"
FT                   /product="hypothetical conserved protein"
FT                   /note="similar to N-terminal region of istidine kinase-like
FT                   ATPase (CAC0239 368 aa) of Clostridium acetobutylicum"
FT                   /db_xref="EnsemblGenomes-Gn:GK0206"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74491"
FT                   /db_xref="GOA:Q5L3I9"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3I9"
FT                   /protein_id="BAD74491.1"
FT                   /translation="MESLLIIYKLIVWGYAAFDYISSKQRTGAGFVLVSLIYFCLQLFA
FT                   LIVRHMSWKRGAAFGSVVLLVLAAAFVEPLWALLLPLNGYELASVYIHRVWGIGAVLLT
FT                   PMIWLDPSAGKLYGFVALFSFVSVTAVKRHIERMEQQEDRLDQMRNDLHRLTRRISEYH
FT                   QYIKQSEYTLQLEERNRLSQRIHDQIGHSLAGALIQMEAAKRLMDGDRDKAKQLLENAI
FT                   HISKEGMEHR"
FT   CDS_pept        216465..216872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0207"
FT                   /locus_tag="GK0207"
FT                   /product="hypothetical protein"
FT                   /note="similar to C-terminal region of ABC transporter
FT                   (ATP-binding protein) (BA-2299 311 aa) of Bacillus
FT                   anthracis A2012"
FT                   /db_xref="EnsemblGenomes-Gn:GK0207"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74492"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3I8"
FT                   /protein_id="BAD74492.1"
FT                   /translation="MKKLNEMGCTIIYTSHYMEEVEEICTRIAIIDHGKIIAEGTKEQL
FT                   EAIITDTKDIWLEIRGMDRLNKQHLQDIPGVKAVQCEENMIKISSDISVNNLNEIVQCL
FT                   INDGVEIRSLEDKSPNLETVFLALTGRNLRD"
FT   CDS_pept        217071..218150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0208"
FT                   /locus_tag="GK0208"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0208"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74493"
FT                   /db_xref="GOA:Q5L3I7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3I7"
FT                   /protein_id="BAD74493.1"
FT                   /translation="MLYFGTPLAAILLSLFAAGGNPVKEVRIGIVNEDQGRITDDTIRF
FT                   LKSLDHLSVKSVKLSAVDEQITSQKMDGVLIFRQGFSESVQHGQPRPIELVSLKGTEIT
FT                   MFIKSYLHEYIDHLATLGRLANGDRDLFWKMYERYQQAPFRLSVHSLPDTAKQKGVTYQ
FT                   TIGYLVMIMLMSAGNLTEIIIKEKEERTYSRLLTTPIQARTYVLSNIVVNLLIMTAQII
FT                   VTIVAMKNIFHIDPNISMWQMALVLLLFSLSAIGLSLITVMFANSSASAGALQPLITVP
FT                   TCMLAGCFWPVELMPKFLQKAAYFIPQRWALDFLVKLQEGRSFGSLYWHLLILLAFALT
FT                   FFLLAVYKFSRSQQSGQFV"
FT   CDS_pept        218361..219044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0209"
FT                   /locus_tag="GK0209"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:GK0209"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74494"
FT                   /db_xref="GOA:Q5L3I6"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3I6"
FT                   /protein_id="BAD74494.1"
FT                   /translation="MVKIFLDPGHGGNDTGAVGNGLLEKDITLFIALEINRLLQNEYEG
FT                   VSVQLSRTKDETVPLDERTDRANRWGANLYVSIHVNAGGGTGYEDYIYNRLDDNSATAR
FT                   IRDAIHEEVVKAAGFRDRGKKKANFHVLRETAMPAVLTENGFIDREEDAEKLNDTQFLR
FT                   TVARGHVNGIARAFGLQKKRKTALTRVIVDGTQVVVFAERENVLRQVEHYLGRAKRIVL
FT                   EQVEE"
FT   CDS_pept        219174..220502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0210"
FT                   /locus_tag="GK0210"
FT                   /product="intracellular alkaline serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:GK0210"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74495"
FT                   /db_xref="GOA:Q5L3I5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3I5"
FT                   /protein_id="BAD74495.1"
FT                   /translation="MFGYSIVQLARRHAGRLDRPLRHALVNMYKPMTRMPCIFHRWIER
FT                   WLRKWRTLSVLIEVENAEGMEAVAKAERDHFRMKVRHHFRHVPFYSARVTPAALEQLLE
FT                   HPKVKKVYFNRTVKALLNNAVPSANAKRVAVNGTELSGKGVTIAIVDTGIYPHPDLEGR
FT                   IAAFVDFVNGRTTPYDDNGHGTHCAGDAAGNGRMSDGLYAGPAYEANLIGVKVLDRSGS
FT                   GTLETIMRGIEWCIDYNERHPSKRIDIISLSLGGEPQPFPIENDDPLVQVAEQAWEQGI
FT                   VVCAAAGNEGPNYGTISSPGISDRIITVGALDDHDTATTRADDDVASFSSRGPTEYGVT
FT                   KPDLVVPGVNIISLRAPRSFLDKMNKQSRVGDHYISMSGTSMATPICAGIVALMLQAKP
FT                   NATPDEIKRALKDGADLWKGRDPNVYGAGYVNGKRAIEQLLQR"
FT   CDS_pept        complement(220521..222476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0211"
FT                   /locus_tag="GK0211"
FT                   /product="sulfatase"
FT                   /EC_number="3.1.6.-"
FT                   /db_xref="EnsemblGenomes-Gn:GK0211"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74496"
FT                   /db_xref="GOA:Q5L3I4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3I4"
FT                   /protein_id="BAD74496.1"
FT                   /translation="MKAIWEKWLKKCRSLPNQYIGFFIFAVLLFWLKTYAAYLAEFNLG
FT                   ISNSMQEFLLFINPISSAVFFLGLALLAKETRVYKWLIIINFVLSFILYANIVYYRFFS
FT                   DFITFPTLTQTKNFGDLGRSIWELLRWYDVFYFLDTIILAVIVFSKRFSLPEVQAGRFK
FT                   KGAIFASAILMFSINLALAETDRPQLLTRTFDRNYIVKYLGVYNYLIYDAFQSMKSSTQ
FT                   RAFANKSDITTVLNYVQATYAKPNPKYFGVAKGKNVIYIHLESLQNFVINYKLNGEEVT
FT                   PFLNSLTRDPNTFYFDNFFHQTGQGKTSDAEFMLENSLFGLPQGAVFTTKGQNTYQAAP
FT                   AILHQYGYTSAVFHGNYKTFWNRDEIYKSFGFDHFFDASYYDMNDEDVLNYGLKDKPFF
FT                   RESIPLLETLKEPFYVKFITLSNHFPYPISEEDATIPPATTGDGSVDRYFQTARYLDEA
FT                   VKEFFDYLKKSGLYDRSVIILYGDHYGISENHNKAMAQILGKEITPYEHAQLQRVPLFI
FT                   HVPGIKGGVIHEFGGQIDLLPTLLHLLGIDTKNYVHFGTDLLSPDHQEIIPFRNGDFVT
FT                   PTVTAVNGKYYDTKTGEPLEETPEIQRLEQIIRTKLDLSDKVVYGDLLRFYTPKGFEPV
FT                   DPSKYDYNNREEGSDQ"
FT   CDS_pept        222927..224264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0212"
FT                   /locus_tag="GK0212"
FT                   /product="K+ uptake transporter (Trk family)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0212"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74497"
FT                   /db_xref="GOA:Q5L3I3"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3I3"
FT                   /protein_id="BAD74497.1"
FT                   /translation="MNTNRKFFDPPKVLVSGFALIILVGAFLLMLPTATVDGKGLPFLD
FT                   ALFTATSATCVTGLVVVDTGTTFTLFGQLVILALIQVGGLGFMTFATLFAFLLGKRISL
FT                   KERLLLQEALNQLSIEGIVRLVKRILVFTVVIEGIGGLLLAIRFSFDMPFWKAVYFGFF
FT                   HAISNFNNAGFDLMGEFRSLTGYVDDPVVSLVVPILIILGGIGFIVMNEVYEYRQTSRL
FT                   SLHTKVVAITTAWLLVASMALILLLEWNNPKTMGPLSLSGKFLSAFYQAVTPRTAGSNT
FT                   LNIPDLTQPTLFLIVFLMFVGASPGSTGGGIKTTTFTTLLGAVWSQIRGKEDVILFRKR
FT                   IVYDTVYKSLTVTMSGLFIVMFVTMVLTITESGKDFLMILFEATSAFGTVGLSMGLTPE
FT                   LSPLGKAVIILTMFAGRVGPLTIAYAVTLRRQPDPFRYPKGKIMIG"
FT   CDS_pept        224649..226484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0213"
FT                   /locus_tag="GK0213"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0213"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74498"
FT                   /db_xref="GOA:Q5L3I2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3I2"
FT                   /protein_id="BAD74498.1"
FT                   /translation="MASLKRLLIGKPMETKRLKHEKLPKWKALAVFSSDALSSVAYATE
FT                   EILLVLALLGTSVFFYSLPIAVAILVLLLLVTLSYRQIIYAFPSGGGAYVVARDHLGTK
FT                   ISLVAGAALMIDYILTVAVSISSGVAALTSAFPGLLPWKVELAVALVLLLMVLNLRGIT
FT                   ESATVFAYPTYVFIGFVLVMIAVGGWQLWQEGWHGFTMHEHASTAHMFASGYSLFILLR
FT                   AFSSGCSAMTGVEAISNGVPAFRPDSSKNAAITMGWMSTLLGVMFLGITVLAAGFGVTP
FT                   TEHQTVISQIGRHVFGNGLLFYLFQLATMVILVLAANTSFAGFPQLTSIMAKDGFLPRS
FT                   LAARGDRLVFSNGIILLSVLAIALIIAFHAKTHSLIPLYAVGVFLSFTIGQSGLIKKLW
FT                   NREEGRKFGVLLTVGTGAVVTGIVTLVTMIAKFTQGAWIVIVAIPLFVWMFIRIHEHYK
FT                   KLGEQLRLDEREWQQRGKLLKPKVIIPISGVSKVVAQSVQYARSISDDITALSIIFDEK
FT                   DEQKLRQKWEKFYPDIPLKVIYSPYRTILSPLLEYITKAEKEADRAPVTVLLPQFIVKK
FT                   WWHTFLHNQTAIILRFFLIMKKDVVIATLPYHLRE"
FT   CDS_pept        226590..227228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0214"
FT                   /locus_tag="GK0214"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0214"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74499"
FT                   /db_xref="GOA:Q5L3I1"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR014205"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3I1"
FT                   /protein_id="BAD74499.1"
FT                   /translation="MWLWVSMILLAFSVSMDSLSVGITYGMGGVRFSCFSLALIACMSG
FT                   MMVFVSMNIGRLLALVLPLQVERGLASVILMALGGWAIYNVYKPKGDGSDSSMECDGTG
FT                   EANRFSGAVQVLKRPELGDLDRSGTISQKEALLIGIALSMDSFGAGISSSLLHFPPLSF
FT                   SLLVGVFTLMFIRVGLSLGYMVSKTGIMKKATMLPGVVLIVLGLIKLFR"
FT   CDS_pept        227296..228279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0215"
FT                   /locus_tag="GK0215"
FT                   /product="sporulation-control protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0215"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74500"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3I0"
FT                   /protein_id="BAD74500.1"
FT                   /translation="MWKKFLSKFGIGAAKVDLVLHRPHVRLGETLEGEFLLEGGSVAQH
FT                   IRNLDVVLQLEVHAEGKAYRRTAAVIPVASSFTIQPGERKVLPFSYALPLHLPISRPTV
FT                   RYTFVTRLDIADGADAYDQDAIHILPPTALEQVFSALAALGFREKATSGSITPHGQEFA
FT                   FFPTSEFQGIVQEVEFFALVEGEGVRLYMEIDVRHGFGGEREMKRELLITHEQLRDSAT
FT                   AARLLREAIEEAVRAAGAFGQLSGHPLATPHSPIYSHPVGHYPPVHHSHHGGHGWAGAI
FT                   GGFAAGMLAGMVAEELLDDVIDDVADGLDVDDWFDGGDGFDGGDWL"
FT   CDS_pept        228411..228914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0216"
FT                   /locus_tag="GK0216"
FT                   /product="spore coat protein F"
FT                   /db_xref="EnsemblGenomes-Gn:GK0216"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74501"
FT                   /db_xref="InterPro:IPR012851"
FT                   /db_xref="InterPro:IPR016493"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3H9"
FT                   /protein_id="BAD74501.1"
FT                   /translation="MNDTYGHRHLAWHETLELHELIAFQANGLIKMKKAVGKIDCPELK
FT                   GLYLETIQGLETNLRELLAFIPAAPMMEESRDHDDGDRALHAGDLLGFSKTAVRNYAAA
FT                   ITEAATPVLRKTFVKHLLKAIDTHEKAFNYMYERSYYPAYDLVQLLHNDVRNAQKALSM
FT                   GYER"
FT   CDS_pept        229068..230006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0217"
FT                   /locus_tag="GK0217"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GK0217"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74502"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3H8"
FT                   /protein_id="BAD74502.1"
FT                   /translation="MRYYIVFDIGGTYVKHAVMNEHGDFFEKGRYRSERHDFHQFRDDL
FT                   LNAVRQAQANYELSGIAISSAGSVDSDLGIIGGSSALPCIHGPNFKEVFGGATGLPVEL
FT                   ENDANCAALGELWKGAGRHCRDIAFVIVGTGIGGAIVKDGRIHKGAHLHGGEFGYMLMD
FT                   VRYGNGRIECKTWSELAATSALIRMAAEEKGMPERELDGEKVFALAERGDEAAQKAIDR
FT                   FYFSLAQGIFNLQYAYDPEKIILGGAISSRPDFVDEINKRLSVLLSLVPIAKVQPVVET
FT                   CQFKNDANLLGALYHYLERRGELGEASGPSH"
FT   CDS_pept        230190..231011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0218"
FT                   /locus_tag="GK0218"
FT                   /product="bacitracin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0218"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74503"
FT                   /db_xref="GOA:Q5L3H7"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3H7"
FT                   /protein_id="BAD74503.1"
FT                   /translation="MHWMELWKAIILGMVEGLTEFAPVSSTGHMIMVDDLWLKSTEFLG
FT                   KYAANTFKVVIQLGSILAAVVVFKDRFLDLLGVRGRHPGGHPRLNLIHVIIGLLPAGVL
FT                   GVLFEDYIDEHLFSTKTVLIGLVLGALLMIAADKFAKKAARTQTVDQITYKQAFFVGLM
FT                   QCLSLWPGFSRSGSTISGGVLVGMSHRAAADFTFIMAVPIMAGASGLSLLKNWQYVTAA
FT                   DIPFFIAGFFSAFVFALLAIRFFLELINRIRLVPFAVYRIVLAVVIYFLYF"
FT   CDS_pept        complement(231312..232385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0219"
FT                   /locus_tag="GK0219"
FT                   /product="UDP-N-acetylglucosamine-N-acetylmuramyl-(pentape
FT                   ptide) pyrophosphoryl N-acetylglucosamine transferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:GK0219"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74504"
FT                   /db_xref="GOA:Q5L3H6"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3H6"
FT                   /protein_id="BAD74504.1"
FT                   /translation="MRKKIILTGGGTAGHVMVNVALIPKLKELGWDIVYIGSHQGIERE
FT                   IIGRIDGVPYYSVSTGKLRRYFDWKNFKDPFNVLKGVWQAYRLIQKEKPDVVFSKGGFV
FT                   SVPVILGAWLNGVPSVIHESDLTPGLANKIAMPFATKICLTFPETKQYVNADKAVYVGA
FT                   VVRDELKDGNAEQGRKMCQFDGKKPVLLAMGGSLGSKKINDALRANLSTLLAEFDIIHI
FT                   CGKGNIDPSLAGQKGYKQFEYVNEELPHLLALADIVVSRAGANAIFELLSLRKPMLLIP
FT                   LSKAASRGDQIANARSFEKAGYAEVLMEEDLTNESLQAAIHRLYENKDRYQKNMEKAGA
FT                   SDPLQTLLAIIQDTARL"
FT   CDS_pept        232629..233387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0220"
FT                   /locus_tag="GK0220"
FT                   /product="chitooligosaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0220"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74505"
FT                   /db_xref="GOA:Q5L3H5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3H5"
FT                   /protein_id="BAD74505.1"
FT                   /translation="MVKYNQEVNAMWVWLFVCFIVGIAIYGIVPTIIIRKKRVRLFREG
FT                   TASDCLALTFDDGPDPYYTPKLLDLLKKYGVKATFFVVGRKVERYPDIVRRMAEEGHEI
FT                   GIHNYRHISNWLLPPIWLDWGVRRAAAAIERATGQRPVYYRPPWGHFNAWTPIVQKRYT
FT                   TVLWSHILGDWNEKIGTMELFRRLRSSIRGGAVIVLHDNGDALGADKRAPEQMLSALEL
FT                   LFKDEAAKKMRWVTITELRNVQTNTQISAM"
FT   CDS_pept        233398..233994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0221"
FT                   /locus_tag="GK0221"
FT                   /product="alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0221"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74506"
FT                   /db_xref="GOA:Q5L3H4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3H4"
FT                   /protein_id="BAD74506.1"
FT                   /translation="MDTSVWLPYVQSYGYVMLFFFLFCGIVGIPAPEESLLFLVGVMVA
FT                   KEQLLLGPSLASCWGGAMAGMVTAYGAGRWWGAPFVQKYGKCVGITAERWERARRWFGR
FT                   YGKWGILFGCYAPGVRQICPYMAGVSRFPFGPFLLLSALGTAGWAVPLTAAGLWLGQRI
FT                   HIPLISFPLAGLALFLLFLLAAWVGQRRRKKSFES"
FT   CDS_pept        234007..235149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0222"
FT                   /locus_tag="GK0222"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0222"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74507"
FT                   /db_xref="GOA:Q5L3H3"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3H3"
FT                   /protein_id="BAD74507.1"
FT                   /translation="MMKVLFLPLFQMNTGHHKVADTLMDFLRRQFPAVESKKIDFLSYC
FT                   NELMEKMVSEAYLRWIRSHPASYHRVYKTLMYQEPPRFEFISFEPWLPYFESKMKKMVE
FT                   EEQPDLIVCTHSFPSRILQRLKRKRVLTVPVVNVYTDFFMNSIWGKRFIDYHFVPHQEA
FT                   KWELITKYGVDKGRIIVTGIPVHDVFMNRSEARRKRDLAHVLVAGGNQGLGNMLAFLRA
FT                   ARTSTLFRYSVLCGANRQLYEEIASWQLPHIRPLPYIADPEEMNRLYEEADAVITKPGG
FT                   VTVSELLHKRIPIFTIDCLPGQERINLQYLQQNGLIYHLVGPESGEQHMLRLLMDDVEK
FT                   NRLFRRVSDYFAGVEKTGQEALAEVVAAMPQRMAWRVLHP"
FT   CDS_pept        235403..236506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0223"
FT                   /locus_tag="GK0223"
FT                   /product="D-alanine-D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:GK0223"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74508"
FT                   /db_xref="GOA:Q5L3H2"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3H2"
FT                   /protein_id="BAD74508.1"
FT                   /translation="MKTKVGVLYGGKSPEHQVSLSTAMAVMNAIDPHKFDVIPIYITPE
FT                   GQWIKGEQLTGPIEEIKQLQFTSAATALIPVSLNQVPAADSAAGGNEETIDVIFPLLHG
FT                   PNGEDGTVQGLLEILNIPYVGNGVLASAVGMDKVMMKNLFAQAGLRQAKYIAVTKYDWQ
FT                   KRGETVYDRIERELGYPCFVKPANAGSSVGISKCKQRGDLKAAFIEAFQYDRKIIIEEA
FT                   IVGREIEIGVIGNDEPICSVVGEIVPKKEFYDYEAKYEDGQTELIIPADVTKEQYETIK
FT                   QMAITAFQVLDLSGLARVDFFLAEDGAVYINEVNTMPGFTPYSMFPLLWQHSGVPYPEL
FT                   IERLIALALERHQEKQTITYTFKKEKR"
FT   CDS_pept        236513..237889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="GK0224"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanyl
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:GK0224"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74509"
FT                   /db_xref="GOA:Q5L3H1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3H1"
FT                   /protein_id="BAD74509.1"
FT                   /translation="MIKRTVRQIAEMADGQCLKPEWENMVVSGVSTDTRTIQAGNLYVP
FT                   LRGATFNGHDFVQEAVQKGAAAVLWAEREGTPPEGVPVVVVDDTLLALQRLAARYREQL
FT                   GMKVIGVTGSNGKTTTKDMIAALLSTHYRVQKTEGNLNNHIGVPLTLLSLDEGTEMAVV
FT                   EMGMSGFGEIERLTMIARPDAAVITNIGEAHLQELGSREGIAKAKLEILAGLHHDGLFV
FT                   YHGDEPLLTERVPKLPLPRHVVTFGAGEQNDYYPTDVRIEAGGTSFVINALPGRTLFMP
FT                   VLGKHYVYNALAAIAVARFFGIDWEGIDASLSRLQVTRMRTEVVKTKYGFTVINDAYNA
FT                   SPTSMRAALMLLQELSGYRQKIAVLGDMLELGDEEVAFHREIGEVLRPGMVDYVFTYGP
FT                   LSHHIAAAAAPFFDDGRVREFDDKAALAEAVRSVATSDDIVLLKASRGMKLEELLRYWV
FT                   "
FT   CDS_pept        237962..238684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0225"
FT                   /locus_tag="GK0225"
FT                   /product="carboxylesterase precursor"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:GK0225"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74510"
FT                   /db_xref="GOA:Q5L3H0"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3H0"
FT                   /protein_id="BAD74510.1"
FT                   /translation="MIGCLCIHGFTGSPEEVAPLADYLRERTDWMIETPTLPGHGSELR
FT                   LKGITYDQWIAAAEQAFLALHHRCSVVYVIGFSMGGVIAVYLAEKYPVAKLVLLSAAFY
FT                   YVNPRQLWRDIREMFANGWKGAREHPLFLRYRNKMMATPFSAVREFRKLVRDVRPRLPR
FT                   VAAPALIVQGEKDGIVPLKSAYYLYEQIGSAEKKLLLLPNSFHHVCHSIDRHVLFAEVE
FT                   TFLRAAHAHHCKSPHNMV"
FT   CDS_pept        238745..240148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0226"
FT                   /locus_tag="GK0226"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0226"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74511"
FT                   /db_xref="GOA:Q5L3G9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3G9"
FT                   /protein_id="BAD74511.1"
FT                   /translation="MTTFQELGLSQEVMKAIERMGFEETTPIQAKTIPLSLQNKDVIGQ
FT                   AQTGTGKTAAFGIPIVEKVNVKNSAVQALVVAPTRELAIQVSEELYKIGAVKRVRVLPI
FT                   YGGQDIERQIRALKKHPHVIVGTPGRIIDHINRGTLRLEHVHTVVLDEADEMLNMGFIE
FT                   DIEAILSHVPAERQTLLFSATMPDPIRRIAERFMNEPELVKVKAKEMTVPNIQQYYLEV
FT                   HEKKKFDILTRLLDIQAPELAIVFGRTKRRVDELAEALNLRGYAAEGIHGDLSQAKRLS
FT                   VLRKFKEGAIEILVATDVAARGLDISGVTHVYNFDIPQDPESYVHRIGRTGRAGKTGVA
FT                   MTFVTPREIGQLHHIERTTKRKMERMKPPTLDEALEGQQRIAIEKLLNVVETENLSFYK
FT                   RAAEELLEEHDSVTIVAACLKMLTREPDTTPVQLTEEPPLAVKREKKRGGRPDGSARSR
FT                   TKKRRITAH"
FT   CDS_pept        complement(240160..240777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0227"
FT                   /locus_tag="GK0227"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0227"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74512"
FT                   /db_xref="GOA:Q5L3G8"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3G8"
FT                   /protein_id="BAD74512.1"
FT                   /translation="MFQHASDVRSFVRLYPVVAALLLVHIAAWLLFSLPLTALEPIWQY
FT                   AVGTNGAIRHGEYWRLVSPIVLHRDFHHMAVNSLSLWLFGPWLEHALGKRKFLFLYIGG
FT                   GIGANVATLFLLPPLYTHVGASGAIFALFGMYSYLALFRRDLVAPRHAQLLLSVMAVHL
FT                   LLGIMTPDGNLLAHLFGFAVGGLLAPFLSIRPKRPSFYMPRL"
FT   CDS_pept        240891..241280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0228"
FT                   /locus_tag="GK0228"
FT                   /product="holo-[acyl-carrier protein] synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0228"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74513"
FT                   /db_xref="GOA:Q5L3G7"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3G7"
FT                   /protein_id="BAD74513.1"
FT                   /translation="MIVGIGIDIVELERIRSLLERSRKFPERILTPREKAQFGELPPAR
FT                   QAEFLAGRFAAKEAYAKALGTGIGRHLSFQDIEIVSDEHGKPSIAARRDGETVHLSISH
FT                   SRDYAVAQVVIERLGPMTPADACHG"
FT   CDS_pept        241360..242316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0229"
FT                   /locus_tag="GK0229"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0229"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74514"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3G6"
FT                   /protein_id="BAD74514.1"
FT                   /translation="MGRNVLMALVGIIFLFALAGCGSKSQEEVLKALDEKVDEMTGYQA
FT                   EAKMTFRTGEKPQVYHVEVWHKQPSYYRVSLKNADKGQSQMILRNDEGVFVFTPALNKT
FT                   FKFVSDWPKNSSQAYLYESLVKDILSDSKAKFKATDDYYVFETKTNYPNSEVIPTQEIT
FT                   LRKKDLAPVSVKVMDTDRKALLTVEFSNVEFNKKFDDDAFDTKKNMTGARLEVPTMAEG
FT                   KEQVMAVMYPSQLPKGVQALEEKEVKGENGTRVIMTFGGKKSFTLVQEKADVLPATSMP
FT                   VLVNGDPVDLGFTIGALTDRTLTWWYNGAEFTLASDD"
FT   CDS_pept        complement(242294..242521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0230"
FT                   /locus_tag="GK0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0230"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74515"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3G5"
FT                   /protein_id="BAD74515.1"
FT                   /translation="MSGGKMRKTAENIGDRNDSSTGLPSLLLHKNKKQLLRFNAESRLF
FT                   ANPHCHFAAFSCTELATITISSGVNRPRRA"
FT   CDS_pept        242621..243775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0231"
FT                   /locus_tag="GK0231"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:GK0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74516"
FT                   /db_xref="GOA:Q5L3G4"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3G4"
FT                   /protein_id="BAD74516.1"
FT                   /translation="MDEFHRDTWVEIDLDAIYDNVANLRRFLPEGTQIMAVVKANAYGH
FT                   GDAQVAATALEAGASRLAVAFLDEALALRKKGIDAPILVLGASRPEDVALAAEHRIALT
FT                   VFRSDWLEKASSLYNGSTPIHFHLKMDTGMGRLGVKDEEETKRIAALIDRHPPFVLEGV
FT                   YTHFATADEVNTDYFSYQYARFLHMLDWLPSRPPLVHCANSAAALRFSDRAFNMVRFGI
FT                   SMYGLAPSPDIKPLLPYELKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQTEEWIGTIP
FT                   IGYADGWLRRLQHFHVLVGGQRAPIVGRICMDQCMIRLPEPLPVGTKVTLIGRQGDEVI
FT                   SIDDVARHLGTINYEVPCTIGYRVPRIFFRNKRIMEVRNAVGRG"
FT   CDS_pept        243902..244183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0232"
FT                   /locus_tag="GK0232"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0232"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74517"
FT                   /db_xref="GOA:Q5L3G3"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3G3"
FT                   /protein_id="BAD74517.1"
FT                   /translation="MSESGATAEIVVRLPQSLLTELDVLVKQENGNRNELIYQATKMYI
FT                   RERKKRQIREAMRRGYMEMAKINLSIASEAFHAEYEADHTVERLVSGG"
FT   CDS_pept        244188..244538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0233"
FT                   /locus_tag="GK0233"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0233"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74518"
FT                   /db_xref="GOA:Q5L3G2"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3G2"
FT                   /protein_id="BAD74518.1"
FT                   /translation="MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVA
FT                   AITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVD
FT                   EALQISLGLIDF"
FT   CDS_pept        244804..246969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0234"
FT                   /locus_tag="GK0234"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0234"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74519"
FT                   /db_xref="GOA:Q5L3G1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3G1"
FT                   /protein_id="BAD74519.1"
FT                   /translation="MANEQRLIEVIAAEQQLAAKQVENVIALHREGNTIPFIARYRKEM
FT                   TGALDEVQIREVLERWEYLQHLEQRKEEVLRLIDEQGKLTGELKRDILEATKLQQVEDL
FT                   YRPYRQKRRTKATIAKERGLEPLAEWLLSCPPAPTPEQQAEMFVNEDKGVATVEEALQG
FT                   AKDIIAEKVADDAALRQWVRDETRRKGTIASVAKAPEKDEKSVYEMYYDYEEPLAKIVP
FT                   HRVLALNRGEKEEVLRVSIKAPVEDIIRYLRRKTVADESSPAAPIVAEAIEDGYKRLME
FT                   PAIERDIRNELTEKAEERAIHIFAENLRKLLLQPPLKGKTVLGIDPAYRTGCKLAVVDE
FT                   TGKLLRIDVIYPHPPQERKEEARAKLLRLLDDYHVDMIAIGNGTASRETEQFVADTLKH
FT                   VQRDIFYLIVNEAGASVYSASDLARAEFPDLQVEERSAVSIARRVQDPLAELVKIDPKS
FT                   VGVGQYQHDVSQKKLAESLRFVVETVVNQVGVNVNTASVSLLQYVSGLTKTVAENIVKR
FT                   REEQGKFRNREELKTIPRLGAKTYEQCIGFLRIVDGDEPLDRTPIHPERYAEVKQLLRK
FT                   LGFTTAAIGSDELRQALQAIDIEATAAELGIGELTLRDIIDALRRPERDPRDELPKPLL
FT                   RKDVLKMEDLKPGMELEGTVRNVVDFGAFVDIGVKQDGLVHISKLSKQYVRHPLDVVSV
FT                   GDVVKVWVEHVDVAKGRISLSMVPPKE"
FT   CDS_pept        247191..247640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0235"
FT                   /locus_tag="GK0235"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0235"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74520"
FT                   /db_xref="GOA:Q5L3G0"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3G0"
FT                   /protein_id="BAD74520.1"
FT                   /translation="MDQKQLQALVEQISIRVFGKPFRHTAFFNPRLRTTGGRYMLQTHN
FT                   IELNKKHYEQFGEEELIAIIKHELCHYHLHLEGKGYRHRDRDFRELLQKVGAPRYCRPL
FT                   ARNTKAPKTIYTYICTSCGLTYRRKRRINIDRYVCGRCRSKLKLS"
FT   tRNA            248280..248354
FT                   /gene="trnF-Asn"
FT                   /product="transfer RNA trnF-Asn"
FT   tRNA            248363..248454
FT                   /gene="trnF-Ser"
FT                   /product="transfer RNA trnF-Ser"
FT   tRNA            248474..248545
FT                   /gene="trnF-Glu"
FT                   /product="transfer RNA trnF-Glu"
FT   tRNA            248578..248653
FT                   /gene="trnF-Asp"
FT                   /product="transfer RNA trnF-Asp"
FT   tRNA            248668..248742
FT                   /gene="trnF-Gln"
FT                   /product="transfer RNA trnF-Gln"
FT   tRNA            249036..249111
FT                   /gene="trnF-Lys"
FT                   /product="transfer RNA trnF-Lys"
FT   tRNA            249117..249198
FT                   /gene="trnF-Leu1"
FT                   /product="transfer RNA trnF-Leu1"
FT   tRNA            249214..249296
FT                   /gene="trnF-Leu2"
FT                   /product="transfer RNA trnF-Leu2"
FT   tRNA            249373..249449
FT                   /gene="trnF-Arg"
FT                   /product="transfer RNA trnF-Arg"
FT   tRNA            249454..249527
FT                   /gene="trnF-Pro"
FT                   /product="transfer RNA trnF-Pro"
FT   tRNA            249697..249770
FT                   /gene="trnF-Gly"
FT                   /product="transfer RNA trnF-Gly"
FT   rRNA            249894..251447
FT                   /gene="rrnE-16S"
FT                   /product="16S ribosomal RNA"
FT   rRNA            252124..255051
FT                   /gene="rrnE-23S"
FT                   /product="23S ribosomal RNA"
FT   rRNA            255295..255411
FT                   /gene="rrnE-5S"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        255641..256099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0236"
FT                   /locus_tag="GK0236"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0236"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74521"
FT                   /db_xref="GOA:Q5L3F9"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3F9"
FT                   /protein_id="BAD74521.1"
FT                   /translation="MKKIEILVHSPEETKSVARRLAEHLERGMVIALEGDLGAGKTTFT
FT                   KGLAEGLGITQTVNSPTFTIIKQYDGRLPLYHMDVYRLEDEWEDLGFDEYFAGDGVTVV
FT                   EWAHLIAGQLPEERLTVFLFHRGGDERLLRFEPSGERYEQLCKEIFPS"
FT   CDS_pept        256096..256836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0237"
FT                   /locus_tag="GK0237"
FT                   /product="glycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0237"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74522"
FT                   /db_xref="GOA:Q5L3F8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3F8"
FT                   /protein_id="BAD74522.1"
FT                   /translation="MKVLGIDTSNMPLGIALVDGDVVKGEFITNVKKDHSSRAMPAIEL
FT                   LLRRCDVAPKDLDLIVVAKGPGSYTGVRIGVTIAKTLAWSLGIPIAGVSSLEVLAANGR
FT                   YFPGVIVPLFDARRGQIYTGLYRYEGGALRCLEEDRIVAADEWARRLSEREEDVLFIGA
FT                   DAPLYRDLFRSHLGERVHVAPPSLALPRPSELVMLGKQKERENAHVFVPNYLRLAEAEA
FT                   KWLAKQKGEQNDGDQCSISANDHS"
FT   CDS_pept        256796..257248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0238"
FT                   /locus_tag="GK0238"
FT                   /product="ribosomal protein (S18)-alanine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0238"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74523"
FT                   /db_xref="GOA:Q5L3F7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3F7"
FT                   /protein_id="BAD74523.1"
FT                   /translation="MGINVQFRPMTIHDIDEVVQVERASFTSPWSRESFYNELMYNRYA
FT                   KYIVMVYNGRIIGYGGMWLVIDEAHVTNVAVLPQFRGQKLGEALMRRLMDMARQHGAAT
FT                   MTLEVRVSNHVAQSLYRKLGFRNGGIRKRYYPDNFEDALVMWVKLR"
FT   CDS_pept        257230..258258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0239"
FT                   /locus_tag="GK0239"
FT                   /product="glycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0239"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74524"
FT                   /db_xref="GOA:Q5L3F6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3F6"
FT                   /protein_id="BAD74524.1"
FT                   /translation="MGEAEMNEDVYVLGIETSCDETAAAVVKNGREVLSNVVASQMESH
FT                   RRFGGVVPEIASRHHVEQITLVIEEAMQQAGVSFASLDAVAVTAGPGLVGALLVGVNAA
FT                   KALAFAHGLPLIGVHHIAGHIYANQLVAEMKFPLLALVVSGGHTELVFMKEHGNFAVIG
FT                   ETRDDAAGEAYDKVARALGLPYPGGPHIDRLAHEGEPVIDLPRAWLEEGSYDFSFSGLK
FT                   SAVLNALHNAKQRGEEIDPRQMAASFQASVVDVLVTKTVQAAKEYRVRQVLLAGGVAAN
FT                   RGLRAALQDKMKELPDVELVIPPLSLCTDNAAMIAVAGTVLYQQGKRADLALNANPSLP
FT                   LV"
FT   CDS_pept        complement(258581..260506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0240"
FT                   /locus_tag="GK0240"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0240"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74525"
FT                   /db_xref="GOA:Q5L3F5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3F5"
FT                   /protein_id="BAD74525.1"
FT                   /translation="MIILQVHGLTKYFGADLILSNIKLEIQSHDRIALVGRNGAGKSTL
FT                   LKIIAGELSFDSGKIIKPNHIKIGYLAQNSGLDSPRSIWDEMLEVFTPLLGLEKQLAEL
FT                   SMQLGDPDVLADPARYEKTLKTYDELQEQYKEQGGYQYEADIRSVLHGLQFSSYDYKTT
FT                   PISSLSGGQRTRLALGKLLLSKPDLLILDEPTNHLDLETLSWLEQYLQAYPGAVLVVSH
FT                   DRYFLDKIVTDVYELSNATLKHYAGNYSRYLELRAEQYEQELRRYEKQQEEIARLQDFI
FT                   QRNIARASTAKRAQSRRKQLEKIERLERPVGDEKSASFSFSIDRPSGYEVLTAEDIAVG
FT                   YGDGAPIIRQISFRITRGESVALVGPNGIGKSTLLKAIARKLPIQTGELRYGANVQIGY
FT                   YDQDQADLSSNKRVLDELWDAYPEKTEKEIRTVLGNFLFSGDDVLKPVSALSGGEKARL
FT                   SLAKLMLQKANVLLLDEPTNHLDLDSKEVLEQALIDYPGTILFVSHDRYFINRIATKVF
FT                   ELSSGGLTEYLGDYDYYIAKKEEMRELALLNVRPTETASDSAKTTYEQEKEEKKRRRQR
FT                   QRRLDEIEAEIATLEAQIAEIEQQLCDPSVYGDYETMQRLTQENDERKQRVEMLLAEWE
FT                   QLYTSL"
FT   CDS_pept        260604..261092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0241"
FT                   /locus_tag="GK0241"
FT                   /product="molybdopterin precursor biosynthesis (molybdenum
FT                   cofactor biosynthesis protein C)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0241"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74526"
FT                   /db_xref="GOA:Q5L3F4"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="PDB:2EEY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3F4"
FT                   /protein_id="BAD74526.1"
FT                   /translation="MSSFTHFNEQGRAKMVDITHKEDTVRVAVAQTSVTVSREIYEKMT
FT                   SNAIEKGDVLAVAQVAGVMAAKKTADLIPMCHPLMLKGVDIAFAWENDGEAHKLVITAT
FT                   VKTKGSTGVEMEALTAASVCALTVYDMCKALDKGMVIGPTYLVEKTGGKSGHYRRKTD"
FT   CDS_pept        261108..261749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0242"
FT                   /locus_tag="GK0242"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0242"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74527"
FT                   /db_xref="GOA:Q5L3F3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3F3"
FT                   /protein_id="BAD74527.1"
FT                   /translation="MSNEQPKIPQATAKRLPLYYRFLKNLHASGKQRVSSAELSEAVKV
FT                   DPATIRRDFSYFGALGKKGYGYNVNYLLSFFRRTLEEDEVTEVALFGVGNLGTAFLNYN
FT                   FSKNNNTKIVMAFDVDERKVGTTVGGVPVYHLDELEERLHENIPVAILTVPAAAAQALT
FT                   DRLVVQGIKGILNFTPARLNVPNHIRVHHIDLAIELQSLVYFLKNYPSPS"
FT   CDS_pept        261766..261918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0243"
FT                   /locus_tag="GK0243"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0243"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74528"
FT                   /db_xref="GOA:Q5L3F2"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3F2"
FT                   /protein_id="BAD74528.1"
FT                   /translation="MKYLLLVAAILLLFGTKKLPELGRSFGQSLREFKDATKGLADDEE
FT                   TKTDR"
FT   CDS_pept        261939..262682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0244"
FT                   /locus_tag="GK0244"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0244"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74529"
FT                   /db_xref="GOA:Q5L3F1"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3F1"
FT                   /protein_id="BAD74529.1"
FT                   /translation="MNDKEMSVYEHLGELRKRLIIVLIFFAAALVVSFFFVDDVILYLQ
FT                   RTAEAKHLTMNAFRLTDPIKVYFQFAFVIAAVLSAPVLLYQIWAFVSPGLYEKERKVTL
FT                   SYIPASIVLFLAGVSFAYFVLFPFVVRFMSQLADQLGVQQMIGINEYFQFLLQLVLPFG
FT                   IVFQLPIVVLFFTRLGLITPQLLVRIRKYAYLALLILAAVITPPDVLSQVIVMIPLTIL
FT                   YEGSIWVARIGYRKAQRAVEQEGNE"
FT   CDS_pept        complement(262866..263042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0245"
FT                   /locus_tag="GK0245"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0245"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74530"
FT                   /db_xref="GOA:Q5L3F0"
FT                   /db_xref="InterPro:IPR025426"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3F0"
FT                   /protein_id="BAD74530.1"
FT                   /translation="MRNPRLFSLLYFVLGSMFTYLAIESAHETVWNVSTIALAALAAFD
FT                   FGTALRLLFASKR"
FT   CDS_pept        complement(263042..263776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0246"
FT                   /locus_tag="GK0246"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0246"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74531"
FT                   /db_xref="GOA:Q5L3E9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3E9"
FT                   /protein_id="BAD74531.1"
FT                   /translation="MKRNHWYVIITYIVMQLSAFVGVPLLRALGVGQGTESRLEAAKLA
FT                   SGYWAVISFLLAFVVILWLLRGDRNERMMRRLPLASSWMWAVLGVFLALAAQSIAANIE
FT                   WRLLGIKPGSENTRQIIDIIRLTPLLVVVTSVIGPILEELIFRKIIFGSLYEKYNFWLA
FT                   ALVSSLLFAIVHMEPEHLLLYTSMGMVFAFLYAKTGRIFVPIFAHVAMNTFVVVMQTLL
FT                   ADEIEKMMRQSELPLAVWRVWL"
FT   CDS_pept        complement(263801..263965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0247"
FT                   /locus_tag="GK0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0247"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74532"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3E8"
FT                   /protein_id="BAD74532.1"
FT                   /translation="MFCLYSPSARSPFSLFHIPRTDKRLRLIFFTAVRWDARMQFSYYF
FT                   RHTCATIRI"
FT   CDS_pept        264136..264417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0248"
FT                   /locus_tag="GK0248"
FT                   /product="chaperonin (GroES protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0248"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74533"
FT                   /db_xref="GOA:Q5L3E7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3E7"
FT                   /protein_id="BAD74533.1"
FT                   /translation="MKPLGDRIVIEVVETEEKTASGIVLPDTAKEKPQEGRVVAVGAGR
FT                   VLDNGQRIAPEVEVGDRIIFSKYAGTEVKYDGKEYLILRESDILAVIR"
FT   CDS_pept        264522..266138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0249"
FT                   /locus_tag="GK0249"
FT                   /product="chaperonin (GroEL protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0249"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74534"
FT                   /db_xref="GOA:Q5L3E6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3E6"
FT                   /protein_id="BAD74534.1"
FT                   /translation="MAKQIKFSEEARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLK
FT                   NVAAGANPMGIRRGIEKAVAVAVEELKAISKPIKGKESIAQVAAISAADEEVGQLIAEA
FT                   MERVGNDGVITLEESKGFTTELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITD
FT                   KKVSSIQELLPVLEQVVQQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGD
FT                   RRKAMLEDIAILTGGEVISEELGRELKSTTIASLGRAAKVVVTKETTTIVEGAGDSERI
FT                   KARINQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALN
FT                   STRAAVEEGIVAGGGTALMNIYNKVAAIEAEGDEATGVKIVLRAIEEPVRQIAQNAGLE
FT                   GSIIVERLKNEKPGIGFNAATGEWVDMIEAGIVDPTKVTRSALQNAASVAAMVLTTEAV
FT                   VADKPEENKGNNNMPDMGGMM"
FT   CDS_pept        266579..267949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0250"
FT                   /locus_tag="GK0250"
FT                   /product="fumarate hydratase"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:GK0250"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74535"
FT                   /db_xref="GOA:Q5L3E5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3E5"
FT                   /protein_id="BAD74535.1"
FT                   /translation="MNERIERDSLGEVRVPADKYWGAQTERSRQNFRIGKETMPLELIY
FT                   AYAELKKAAAIVNHRAGKLSEAKQRAIVAACEEILAGQWDDHFPLVVWQTGSGTQTNMN
FT                   VNEVVARRANELLPDGEERIHPNDDVNMSQSSNDTFPTVMHIAIYTKIQTHLLPAIDRL
FT                   IGTFAAKERRYEKTIKVGRTHLQDATPLTFGQEISGWRTMLEKSKTMIVEATDKLLDLA
FT                   IGGTAVGTGINAPPGFGEQVAEQLKTQTGYPFRSSTNKFHALTSHDEIVYVHGALKALA
FT                   ADLMKIANDIRWLASGPRSGLGEITIPANEPGSSIMPGKVNPTQSEAMTMVAVQVFGND
FT                   ATIGFAASQGNFQLNVFKPVIAYNAIQSVQLLGDVIRSFDERCAQGLEANEAKMKEYVD
FT                   RSLMLVTALSPHIGYDRAAEIAKLAHREGLTLKEAALKTGYVTAEQYEEWVRPEKMI"
FT   CDS_pept        268139..269095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0251"
FT                   /locus_tag="GK0251"
FT                   /product="methanol dehydrogenase regulatory protein (MoxR
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0251"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74536"
FT                   /db_xref="GOA:Q5L3E4"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3E4"
FT                   /protein_id="BAD74536.1"
FT                   /translation="MTINEPLLSPLEQVVRNIEQVIVGKRNVIVLSLTALLAKGHVLLE
FT                   DVPGVGKTMLVRALAKSFSAELKRIQFTPDLLPSDVIGVSVYNPKEQQFEYKPGPIVAH
FT                   IVLADEINRTSPKTQSALLEAMEEGSVTVDGVTRALPQPFFVMATQNPIEYEGTYPLPE
FT                   AQLDRFLLKLHMGYPSPDEEIEMLNRLEKTAPLAEIGPVMSLDELLALQRKVADVHVSD
FT                   TVKRYIVDLIQQSRQHEAVYLGVSPRGSAALMKAAQAYAFIHGRDFVIPDDVQQLAPYV
FT                   LAHRLLVRPEAKWDKFDAEAIIGQLIARTPVPVPGRR"
FT   CDS_pept        269098..270273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0252"
FT                   /locus_tag="GK0252"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0252"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74537"
FT                   /db_xref="GOA:Q5L3E3"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3E3"
FT                   /protein_id="BAD74537.1"
FT                   /translation="MRGKWNGRRWPAFLHLLILAAVLFSYAMFQGGFVSWFLFYSFLPF
FT                   GLYAFLVAMYPLRRAAVSRTVPARRYHAGESIPVMVRIELPWAVPLAALAVAEEGRKHG
FT                   GEMIAIAWPFRRHLSCTWPLSLPRGRHQLEAVRLEARDVFGWVNKTASFYVPCTVIVYP
FT                   RYIQWPPEMVREWFAQGKAARTLAYRRDMAVAAGAREYVPGDKMSWVHWKASARRQELM
FT                   TKEFDEQRNDDWIVVLDGAASPWFEELVTLAASVSKALMDEGVPVGLLVAGKERSFLAP
FT                   RRHDGQWQSILLRLAEVDVGGQEPLAHVLAEEASWRTAAGCIIVTSALSAQLAGQLRAM
FT                   APKRHIVLYVVSREWGEDERNWADRLRRSGVYVSRIDPQALQTVRQGGGDG"
FT   CDS_pept        270270..272432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0253"
FT                   /locus_tag="GK0253"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0253"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74538"
FT                   /db_xref="GOA:Q5L3E2"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3E2"
FT                   /protein_id="BAD74538.1"
FT                   /translation="MRPLGANMLSTVLPNALAAWLLTEWLWPLEAVTDTAHIGVFVSFV
FT                   ALCFGLHLLRVPIWLSALGKMVYIWWALSRLFSFASIAALPHALWRDSTVWLSGDWSSM
FT                   PGDALRTFVFFLLLWAVSFLLHWLIVRRNRWFVPYALTVGYIAVLDTFLPYSGNGAILR
FT                   LVALGFFAFVWFQGEELQAKAPSFRIGKWRAAALFIPAVALAVGYAGPKLPPQWPDPVA
FT                   FIRSYHAQPEETNDDSPSPGVAKVGYGQNDSRLGGPFIADDTVVFIAKDQGRHYWRVET
FT                   KDIYTGKGWEAFQSEQVQSFGNGELIRYEWWSDKVKTVEQTAEITRQDQAFHLVYPLGL
FT                   QQVQTSDHIVYRMHMATEKIYTSDQNANALPIRQYMLTYMEPDFPIEVLRAAPPVQNPP
FT                   FLKRYTQLPETLPQRVRELAKQITDGKETVYDKVKAIEQYFHLNGYTYETTDVAVPGPD
FT                   QDYVDQFLFETKQGYCDNFSTSMAVLVRTLGIPARWVKGYTSGRLVGEQDGQSVYEVRN
FT                   NDAHSWVEVYFEGIGWVPFEPTQGFVNPYAFSLAASNPEEPEPQLQPEERETPRVPLDQ
FT                   LLEQPSTAQGEHWWEKLADVWSWKMGLTALVVLAVLGGAAYATRRKWWPRFTLFRFRRR
FT                   KLDGAAWLISAYGALLRHLQDYGLKRRPHETLRQYAAEVDRLFETDEMNRLTKLYERAV
FT                   YGTGIKEANVREAVELWENLIKRTIS"
FT   CDS_pept        272636..274168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0254"
FT                   /locus_tag="GK0254"
FT                   /product="GMP synthetase (glutamine amidotransferase)"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:GK0254"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74539"
FT                   /db_xref="GOA:Q5L3E1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3E1"
FT                   /protein_id="BAD74539.1"
FT                   /translation="MNQEMIVVLDFGSQYNQLITRRIREFGVYSELHPHTIRAEEIRAL
FT                   NAKGIIFSGGPNSVYDEQAFTCDPAIFELGLPILGICYGMQLMAHHLGGKVEKATHREY
FT                   GKALIQVKNDSLLFHGLPDEQVVWMSHGDLVTAPPAGFAVDATSPSCPIAAMSDERRKW
FT                   YGVQFHPEVRHSVYGNDLLKKFVFEVCGCRGDWTMENFIDEQVRRIREQVGGKKVLCAL
FT                   SGGVDSSVAAVLVHRAIGDQLTCIFVDHGLLRKGEAESVMKTFREQFQMNVIKVDAKDR
FT                   FLAKLKGVTDPEQKRKIIGNEFIYVFDDEAAKLEGIEFLVQGTLYTDIIESGTATAQTI
FT                   KSHHNVGGLPEDMKFELIEPLNTLFKDEVRALGTQLGIPDEIVWRQPFPGPGLGIRVLG
FT                   EVTEEKLEIVRESDAILREEVKKAGLDREIWQYFTVLPDIRSVGVMGDARTYDYTVAIR
FT                   AVTSIDGMTADWARIPWDVLERISTRIVNEVPHVNRVVYDITSKPPATIEWE"
FT   CDS_pept        274459..275784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0255"
FT                   /locus_tag="GK0255"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0255"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74540"
FT                   /db_xref="GOA:Q5L3E0"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3E0"
FT                   /protein_id="BAD74540.1"
FT                   /translation="MRKYFQFDELGTNYRTEIIAGLTTFLSMAYILFVNPFTLSLGAVK
FT                   DFPDELRIDQGAVFVATALAAAYGSILMGVLARYPIALAPGMGLNAFFAFTVVLHMGIP
FT                   WQTALAGVFVSGIIFTILSLTGIREKIIDAIPVELKYAVSAGIGLFITFIGLQNAGIIV
FT                   DNKATLVGLSSLKDGNTLLAIFGLFITVVLMVRKVNGGVFYGMVITAIVGMIFGLIKVP
FT                   HQIVGAIPDISPTFGVAIKHLPDIFSWKMLGVVLTFFIVDFFDATGTLLAVANQAGLLK
FT                   NNKLPRAGKALLVDATAVMVGAVFGTSTTTSYIESSAGVAAGGRSGFSAVVTGILFLLA
FT                   LFFSPLLSVITAPVTAPALIIVGVLMASSIGEIDWKKFEVAVPAFFTLITMPLSYSIAT
FT                   GIAVGFIFYPITMILKGRGKDVHPLLYVLFVVFICYFVFLRE"
FT   rRNA            276548..278101
FT                   /gene="rrnF-16S"
FT                   /product="16S ribosomal RNA"
FT   rRNA            278442..281369
FT                   /gene="rrnF-23S"
FT                   /product="23S ribosomal RNA"
FT   rRNA            281613..281729
FT                   /gene="rrnF-5S"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        complement(281982..282431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0256"
FT                   /locus_tag="GK0256"
FT                   /product="small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0256"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74541"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3D9"
FT                   /protein_id="BAD74541.1"
FT                   /translation="MTNENPFMPFSDWTKHWQQFFQNDFWGSIQPLLPSSNSNKPSSGM
FT                   NIYKKDNELLVVISLPGLEKIEDAEVYVSYKTLEVKATINLNFKGFELVEEGLFQGQFQ
FT                   KTIPLPFAVKEDRIEATYHNGLLFIHLHRLIPDEPKKKIVIKKSE"
FT   CDS_pept        282792..283280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0257"
FT                   /locus_tag="GK0257"
FT                   /product="phosphoribosylaminoimidazole carboxylasecatalytic
FT                   chain"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:GK0257"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74542"
FT                   /db_xref="GOA:Q5L3D8"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3D8"
FT                   /protein_id="BAD74542.1"
FT                   /translation="MSPLVGVIMGSHSDWETMKHACAILAELGVPFEKKVVSAHRTPDE
FT                   MFRYAETAEERGIRVIIAGAGGAAHLPGMIAAKTTLPVIGVPVQSKALNGLDSLLSIVQ
FT                   MPGGVPVATVAIGKAGATNAGLLAASILGLLEPRYMEALKARREAIRKQIVESSDQFD"
FT   CDS_pept        283273..284421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0258"
FT                   /locus_tag="GK0258"
FT                   /product="phosphoribosylaminoimidazole carboxylasecarbon
FT                   dioxide-fixation chain"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:GK0258"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74543"
FT                   /db_xref="GOA:Q5L3D7"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3D7"
FT                   /protein_id="BAD74543.1"
FT                   /translation="MTKQRIVPGQTIGIIGGGQLGRMMALAAREMGFRIAVLDPTPDSP
FT                   CGQVADVEITAPYHDLDAIAELARVSDVITYEFENIDARALEWLEANAYVPQGSRLLAV
FT                   TQDRALEKAAIVDASLPVAPYVEVNGAEELEQAVQTIGFPCVLKTRRGGYDGKGQYVLR
FT                   GEGDLAKAADLLGLGPCILEGWVPFVKEMSVIVARNLDGETAVFPVAENIHIENILHQT
FT                   IVPARIPESVQERAIRYAEVLAASFSLVGTLAVEMFLTADGDIYINELAPRPHNSGHYT
FT                   INACATSQFAQHIRAVCNWPLGSTELLKPAVMVNILGEHVEPVIRHIGAFDGGTYVHLY
FT                   GKHEAKPKRKMGHVTVLADDVEAALARIESWQIWHDRRLERG"
FT   CDS_pept        284418..285713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0259"
FT                   /locus_tag="GK0259"
FT                   /product="adenylosuccinate lyase (glutamyl-tRNA synthetase
FT                   regulatory factor)"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:GK0259"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74544"
FT                   /db_xref="GOA:Q5L3D6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3D6"
FT                   /protein_id="BAD74544.1"
FT                   /translation="MIERYTRPEMGAIWTEENRFKAWLEVELLACEAWAELGVIPKEDV
FT                   RRLRENASFDVNRIKEIEEETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTALGY
FT                   LLKQANAILRRDLENFIQVLKEKAREHKYTVMMGRTHGVHAEPTTFGLKLALWYAEMVR
FT                   NLERFEQAAKMVEVGKISGAVGTYANVDPFVEQYVCEKLGLTPAPISTQTLQRDRHAYY
FT                   MATLALIATSIEKFAVEIRGLQKSEVREVEEFFAKGQKGSSAMPHKRNPIGSENMTGMA
FT                   RVIRGYMVTAYENVPLWHERDISHSSAERIILPDATIALNYMLNRFANIVKHLLVYPEN
FT                   MKKNMERTFGLIYSQRVLLALIDKGMTREEAYDLVQPKAMEAWERQVPFRSLLEADERI
FT                   MSRLTKEELDDCFDYRYHLKHVDTIFARLGLE"
FT   CDS_pept        285789..286517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0260"
FT                   /locus_tag="GK0260"
FT                   /product="phosphoribosylaminoimidazole succinocarboxamide
FT                   synthetase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:GK0260"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74545"
FT                   /db_xref="GOA:Q5L3D5"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="PDB:2YWV"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3D5"
FT                   /protein_id="BAD74545.1"
FT                   /translation="MPTKQQLLYEGKAKKIYATDEPDVLWVEYKDSATAFNGEKKATIA
FT                   GKGRLNNEISSLLFLKLREAGIANHFIEKLSPTEQLVRRVTIIPLEVVVRNVVAGSLAK
FT                   RIGLEEGTPLEAPLVEFYYKNDDLGDPLLLEDHIFILKLASREEVAALKQAALAVNDVL
FT                   RLHFAERNVRLIDFKLEFGRTADGAILLADEISPDTCRLWDAKTNEKLDKDVFRRDLGS
FT                   LTDAYEVILQRLGGESACTK"
FT   CDS_pept        286505..286759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0261"
FT                   /locus_tag="GK0261"
FT                   /product="phosphoribosylformylglycinamidine (FGAM)
FT                   synthasePurS component"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:GK0261"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74546"
FT                   /db_xref="GOA:Q5L3D4"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3D4"
FT                   /protein_id="BAD74546.1"
FT                   /translation="MYKVKVYVTLRESVLDPQGTAVKGALHSLSYTEVKDVRIGKFMEL
FT                   VMEESDRDINELVREMCEKLLANPVIEDYRYEIEEAVAR"
FT   CDS_pept        286756..287442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0262"
FT                   /locus_tag="GK0262"
FT                   /product="phosphoribosylformylglycinamidine (FGAM)
FT                   synthasecomponent I (glutamine amidotransferase domain)"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:GK0262"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74547"
FT                   /db_xref="GOA:Q5L3D3"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3D3"
FT                   /protein_id="BAD74547.1"
FT                   /translation="MKFAVVVFPGSNCDVDMYHAIADELGEEVEYVWHDEDNLDRFDAV
FT                   LLPGGFSYGDYLRSGAIARFSKVMAAVKKAAEAGKPVLGVCNGFQILLEAGLLPGAMRR
FT                   NQGLKFICRPVQLTVENHETMFTSAYEKGEVITIPIAHGEGNYYCDEQTLERLVENRQI
FT                   VFRYHGENPNGSLADIAGIVNEQGNVLGMMPHPERAVDALLGSADGLKLFRSIVNYWRE
FT                   THVVTA"
FT   CDS_pept        287426..289654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0263"
FT                   /locus_tag="GK0263"
FT                   /product="phosphoribosylformylglycinamidine (FGAM)
FT                   synthasecomponent II (synthetase domain)"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:GK0263"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74548"
FT                   /db_xref="GOA:Q5L3D2"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3D2"
FT                   /protein_id="BAD74548.1"
FT                   /translation="MSLLLEPSAAMIKEQKLYREMGLTDEEFARIEAILGRLPNYTETG
FT                   IFAVMWSEHCSYKNSKPVLKKFPTDGPHVLQGPGEGAGIVDIGDGLAVAFKIESHNHPS
FT                   AIEPYQGAATGVGGIIRDVFSMGARPIALLNSLRFGELTSPRVKYLFEQVVAGIAGYGN
FT                   CVGIPTVGGEVQFDPAYEGNPLVNAMCVGIIRHEDIQRGVATGVGNTVMYVGAKTGRDG
FT                   IHGATFASEELSEQSEAKRPAVQVGDPFMEKLLLEACLEAVKSDALVGIQDMGAAGLTS
FT                   SSAEMASKGGFGIEMNLDLVPQREAGMTPYEMMLSESQERMLLVVKQGCEDEIAAIFAK
FT                   YGLEAKAIGKVTDDKMLRLLFRGEVAAEIPVDALAKDAPVYHKPSAEPAYYREFQAMPP
FT                   YTPHIEDYNQTLLGLLAQPTIASKEWVYDQYDYMVRTNTVVAPGSDAAVVRIRGMNKAL
FT                   ALTTDCNSRYLYLDPETGGKIAVAEAARNVICSGAKPLAITDCLNFGSPEKPEIFWQLE
FT                   KAVDGMSEACRALGTPVVSGNVSLYNETNGEAVYPTPVVGMVGLIDDLSHITTQSFKQA
FT                   GDLIYVIGEAKPEFGGSELQKWLEGRIFGKAPEIDLEVEASRQRQLLAAIRAGVVASAH
FT                   DIAEGGLAVALAECVMGASGLGAKVTIGGDLVSELFSETQSRFVISVKKEHQEAFEQLV
FT                   EAKRIGEVTGDGILTVNGEQGETVIRLSVDEMRNVWKGAIPCLLKSKD"
FT   CDS_pept        289630..291042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0264"
FT                   /locus_tag="GK0264"
FT                   /product="phosphoribosylpyrophosphate amidotransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:GK0264"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74549"
FT                   /db_xref="GOA:Q5L3D1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3D1"
FT                   /protein_id="BAD74549.1"
FT                   /translation="MLAEIKGLNEECGIFGIWGHEDAARLTYYGLHSLQHRGQEGAGIV
FT                   VAHNGSLSSHKGLGLVTDVFQSGTLDALKGAAAIGHVRYSTAGGGGYENVQPLLFRSQT
FT                   GAMALAHNGNLTNAIELKLALEGQGSIFQTTSDTEVFAHLIRRSQAPTFVEQMKEALSQ
FT                   IEGAFAFLLLTEKALYAALDPHGFRPLSLGRLGSAYVVASETCAFDVIGATYEREVAPG
FT                   ELLIISREGVRSERFAPRQPRSICSMEYIYFARPDSHVDGINVHKARKNLGKRLALEAP
FT                   AEADIVTGVPDSSISVAIGYAEASGIPYELGLIKNRYVGRTFIQPSQALREQGVKMKLS
FT                   PVRGVVAGKRVVMVDDSIVRGTTSRRIVAMLREAGAVEVHVRISAPPITHPCFYGIDTS
FT                   SKEELIAANRTVEEIRRLIGADSLAFISQEGMLEAIGRPDVSPQRGQCLACFTGQYPTR
FT                   LGQAARPCLTMK"
FT   CDS_pept        291166..292206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0265"
FT                   /locus_tag="GK0265"
FT                   /product="phosphoribosylaminoimidazole synthetase
FT                   (hosphoribosylformylglycinamidine cyclo-ligase)"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:GK0265"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74550"
FT                   /db_xref="GOA:Q5L3D0"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="PDB:2Z01"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3D0"
FT                   /protein_id="BAD74550.1"
FT                   /translation="MAKAYKQAGVDIEAGYQAVALMKEHVQKTMRPEVLGGIGGFGGLF
FT                   DLSALGYRQPVLISGTDGVGTKLKLAFLLDRHDTIGIDCVAMCVNDIIVQGAEPLFFLD
FT                   YIACGKAVPEKIAAIVKGVADGCVEAGCALIGGETAEMPGMYDEDEYDLAGFAVGVAEK
FT                   ERLITGETIQAGDALVGLPSSGLHSNGYSLVRRIVFEQAKLSLDEIYEPLDVPLGEELL
FT                   KPTRIYAKLLRSVRERFTIKGMAHITGGGLIENIPRMLPPGIGARIQLGSWPILPIFDF
FT                   LREKGSLEEEEMFSVFNMGIGLVLAVSPETAAPLVEWLSERGEPAYIIGEVAKGAGVSF
FT                   AGGGRA"
FT   CDS_pept        292203..292835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0266"
FT                   /locus_tag="GK0266"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:GK0266"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74551"
FT                   /db_xref="GOA:Q5L3C9"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="PDB:3AV3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3C9"
FT                   /protein_id="BAD74551.1"
FT                   /translation="MKRLAVFASGSGTNFQAIVDAAKRGDLPARVALLVCDRPGAKVIE
FT                   RAARENVPAFVFSPKDYPSKAAFESEILRELKGRQIDWIALAGYMRLIGPTLLSAYEGK
FT                   IVNIHPSLLPAFPGKDAIGQAYRAGVSETGVTVHYVDEGMDTGPVIAQRVVPIVPGEPI
FT                   EALEERIHQVEHELYPTVLRMLLGEKEQQEERIENDGSETSIDQRVQ"
FT   CDS_pept        292798..294336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0267"
FT                   /locus_tag="GK0267"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase ; IMP cyclohydrolase (bifunctional purine
FT                   biosynthesis protein)"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:GK0267"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74552"
FT                   /db_xref="GOA:Q5L3C8"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3C8"
FT                   /protein_id="BAD74552.1"
FT                   /translation="MAVKRALISVSNKEGVIPFAKQLAELGIDIISTGGTKRALEDAGV
FT                   PVISISDVTGFPEILDGRVKTLHPAIHGGILAVRSDERHQAALAEHGIRPIDLVVVNLY
FT                   PFQQTIAKPDVTLAEAIENIDIGGPTMVRAAAKNYADVAIVVDPADYPMVIEELKTTGS
FT                   IQAKTRQQLAAKAFRHTAAYDAMIAEYLTNLTGENYPETLTVTYTKKQSLRYGENPHQS
FT                   AAFYAKPLGAAFSIANAAQLHGKELSYNNINDANAAINLIREFQEPAVAAIKHMNPCGV
FT                   GVGATLLEAFTKAYEADPVSIFGGIIAVNREVDKETAERMHDIFLEIVIAPSFSDEAFA
FT                   ILTKKKNIRLLTLDFTAPDVKEKMLVSVNGGLLVQEADTFTLEDAEWNVVTKREPTEAE
FT                   REQLRFAWKVVKHVKSNAIVLAKNGMTVGVGAGQMNRVGAAKIAIEQAGEQAVGAVLAS
FT                   DAFFPMDDTVEAAAKAGITAIIQPGGSIRDADSIRKADEYGIAMVFTGVRHFKH"
FT   CDS_pept        294360..295652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0268"
FT                   /locus_tag="GK0268"
FT                   /product="phosphoribosylglycinamide synthetase (glycinamide
FT                   ribonucleotide synthetase) (phosphoribosylglycinamide
FT                   synthetase)"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:GK0268"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74553"
FT                   /db_xref="GOA:Q5L3C7"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="PDB:2YRW"
FT                   /db_xref="PDB:2YRX"
FT                   /db_xref="PDB:2YS6"
FT                   /db_xref="PDB:2YS7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3C7"
FT                   /protein_id="BAD74553.1"
FT                   /translation="MNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELVH
FT                   IDELDIEALVQFAKQQAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKA
FT                   FAKELMKKYGIPTADHAAFTSYEEAKAYIEQKGAPIVIKADGLAAGKGVTVAQTVEEAL
FT                   AAAKAALVDGQFGTAGSQVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEG
FT                   PNTGGMGAYSPVPQISDEMMDAALEAILRPAAKALAAEGRPFLGVLYAGLMATANGPKV
FT                   IEFNARFGDPEAQVVLPRLKTDLVEAVLAVMDGKELELEWTDEAVLGVVLAAKGYPGAY
FT                   ERGAEIRGLDRISPDALLFHAGTKREGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLA
FT                   AIDCDGLFYRRDIGRRAIERASAAYTRMKGR"
FT   CDS_pept        complement(295801..295965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0269"
FT                   /locus_tag="GK0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0269"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74554"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3C6"
FT                   /protein_id="BAD74554.1"
FT                   /translation="MREDIRPTLRTAFADVFHSTVIRQHFSHRERYVLLCIETANEECQ
FT                   LSTKEKKAK"
FT   CDS_pept        complement(295962..296207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0270"
FT                   /locus_tag="GK0270"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0270"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74555"
FT                   /db_xref="GOA:Q5L3C5"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3C5"
FT                   /protein_id="BAD74555.1"
FT                   /translation="MANIGIVNAFIRITVGLTVIAWATARLARRPWCTSYLWAALLGAM
FT                   KVGEGITRFCPMTALFDNMQRRQLFEEEKEAVVNPT"
FT   CDS_pept        296304..298049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0271"
FT                   /locus_tag="GK0271"
FT                   /product="adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:GK0271"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74556"
FT                   /db_xref="GOA:Q5L3C4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3C4"
FT                   /protein_id="BAD74556.1"
FT                   /translation="MGEQRYRWKGSELRAQAAVIDGKQSPTKVLVNATYLHSYFREWVK
FT                   GNIWIHGDRIVYAGERLPDRVDEACEIVDCRGYVLVPGYIEPHVHPFQLYNPHSFARYA
FT                   AAHGTTTLINDNLFLLLQLDDEDALLFLQEMNALPTSMYWWCRFDGQTELEREEEQVSN
FT                   ARIKRWLDQEAVLQGGELTSWPKVASGDDIILYWMQEAHRRRRKIEGHFPGASEKTLVK
FT                   MALFGADGDHEAMTGKEVRMRLWHGYTVALRHSSIRPDLPVLLEEMKALGIRHYDKCLL
FT                   TTDGSPPAFYENGVIDWLIRIAIEHGVPVIDAYAMATINAARHYGIEHLHGSIATGRIA
FT                   HINFLRSAHDPTPAQVLAKGEWVKRDGEAPPLWPAPEWSRFGIRPLSLSWELEWDDLQF
FT                   SMPMGLRMENAVILKPYSVSIDTSRDRLGHDHDECFLALFDRNGRWRVNTMLKGFSSVL
FT                   GGLASSYSNTGDLILIGKHKEDMMLAFGRMQEIGGGIVLAEDGEILFELSLPLGGMMSS
FT                   LEVDELINEEKTFVRLLRERGYPFEDPVYSLLFLQSTHLPYVRVTQRGIYDVMHKTVLF
FT                   PSIMR"
FT   CDS_pept        298068..299099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0272"
FT                   /locus_tag="GK0272"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0272"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74557"
FT                   /db_xref="InterPro:IPR021416"
FT                   /db_xref="InterPro:IPR023158"
FT                   /db_xref="InterPro:IPR035328"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3C3"
FT                   /protein_id="BAD74557.1"
FT                   /translation="MCPLKHWLFVISCAALLLLGGCTTKSEPKQAEPAKPAPRQEQPSK
FT                   PPAEEKQTFPLTGLPAKGNIHQRVVGVMINNHPKARPQSGLRAADIVYEVLAEGDITRL
FT                   LALYQSELPERVGPVRSARDYYIDLSEGYHALYVCHGWSPEAKARLEGGGIDYLNGLFY
FT                   DGTLFQRVPFRKAPHNSYISFANIEKGAKQNGYAWTDHVAPLSFRTDEPSGQKVETVHI
FT                   AYSHRAYAQVEYQYVPEQKGYYRYSGGEQTIDYDTHKPVVVQNVMIIAARHRVIDSHGR
FT                   RDIDLASGGKGYLLQGGVMQPIEWKNVDGRLLPYHNGAPIGFVPGKTWINIVPELAIVQ
FT                   WKS"
FT   CDS_pept        299192..299527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0273"
FT                   /locus_tag="GK0273"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0273"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74558"
FT                   /db_xref="GOA:Q5L3C2"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3C2"
FT                   /protein_id="BAD74558.1"
FT                   /translation="MQIDKLRGRELDQLFKAILSLRDLEECYRFFDDLCTVNEIQALAQ
FT                   RLEVARMLREGYTYHKIETETGASTATISRVKRCLNYGNDAYAMALDRIKEEQQQEEKE
FT                   ANEAVTD"
FT   CDS_pept        299625..300344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0274"
FT                   /locus_tag="GK0274"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0274"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74559"
FT                   /db_xref="GOA:Q5L3C1"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="PDB:4NAE"
FT                   /db_xref="PDB:4NAF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3C1"
FT                   /protein_id="BAD74559.1"
FT                   /translation="MEEIRAWRHVFKLDPNKPIDDERLERLCESGTDAVIVGGTDGVTI
FT                   DNVLDLLARIRRFSVPCALEVTDVEALTPGFDVYLVPIVLNSRQAEWIIGRHHEAVKQY
FT                   GDMMNWDEIAAEGYCILNPECKAAKLTRADTELDVDDIVAYARLAEHLYKLPIFYLEYS
FT                   GVYGDPSVVEKVKQALDQTQLFYGGGITTPEQAEHMARYADTVVVGNAIYDAFEQALAT
FT                   VAAVKQMAGQRNGDDGK"
FT   CDS_pept        300373..302547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0275"
FT                   /locus_tag="GK0275"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0275"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74560"
FT                   /db_xref="GOA:Q5L3C0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3C0"
FT                   /protein_id="BAD74560.1"
FT                   /translation="MNFLSEKLLAHLNKEQQEAVKTTEGPLLIMAGAGSGKTRVLTHRI
FT                   AYLMAEKQVAPWNILAITFTNKAAREMKERVQALLGGAAEDVWISTFHSMCVRMLRRDI
FT                   DRIGINRNFSILDPTDQLSVIKAILKDKNIDPKKFEPRTILATISGAKNDLLTPEQFAK
FT                   RASTYYEKIVGDVYQEYQQRLLRNHSLDFDDLIMTTIHLFDRVPDVLQYYQYKFQYIHI
FT                   DEYQDTNRAQYTLVKKLADRFQNICAVGDADQSIYRWRGADIRNILSFERDYPNAKVIL
FT                   LEQNYRSTKRILQAANEVIAHNVNRKPKRLWTENPEGKPIVYYEAMNEVDEAQFVARRI
FT                   QEAVESGERRYRDFAVLYRTNAQSRVIEEMFLKANIPYQIVGGLKFYDRKEIKDILAYL
FT                   RVIANPDDDLSLLRIINVPKRGIGASTIDKLVRYAAEHELSLFEALGELEMIGFSAKTA
FT                   GALAAFRGQLEQWTQLQEYVPVTELVEEVLDQSGYREMLKAERTIEAQSRLENLDEFLS
FT                   VTKHFENVSDDKSLVAFLTDLALISDLDELNGTDQAAEGDAVVFMTLHAAKGLEFPVVF
FT                   LIGMEEGIFPHLRSLENEDEMEEERRLAYVGITRAEEELVLTNAQMRTLFGNIQMNRPS
FT                   RFLDEIPAHLLETVSRGKPSVSRSASARLQAGGAIRVWKVGDRANHRKWGIGTVVSVRG
FT                   EGDDQELDIAFPSPIGIKRLLAKFAPIEKV"
FT   CDS_pept        302568..304580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0276"
FT                   /locus_tag="GK0276"
FT                   /product="DNA ligase (polydeoxyribonucleotide
FT                   synthase[NAD+])"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:GK0276"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74561"
FT                   /db_xref="GOA:Q5L3B9"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3B9"
FT                   /protein_id="BAD74561.1"
FT                   /translation="MDRQQAERRAAELRELLHRYGYEYYVLDRPSVPDAEYDRLMQELM
FT                   AIEEQYPELKTSDSPTQRIGGPPLEAFRKVTHVVPMMSLANAFDEGDLRDFDRRVRQEV
FT                   GEAAYVCELKIDGLAVSVRYEDGYFVQGATRGDGTTGEDITENLRTIRSLPLRLKEPVS
FT                   LEARGEAFMPKASFLRLNEERKARGEELFANPRNAAAGSLRQLDPKVAASRQLDLFVYG
FT                   LANAEELGIESHSEALDYLQALGFKVNPERRRCANIDEVIAFVNEWHEKRPQLPYEIDG
FT                   IVIKVDSFAQQRELGATAKSPRWAIAYKFPAEEVVTTLIGIEVNVGRTGVVTPTAILEP
FT                   VRVAGTTVQRATLHNEDFIREKDIRIGDAVIIKKAGDIIPEVVGVVVDRRDGDETPFAM
FT                   PTHCPECESELVRLEGEVALRCLNPNCPAQLRERLIHFASRAAMNIEGLGEKVVTQLFN
FT                   AGLVRDVADLYRLTKEQLIGLERMGEKSATNLLAAIEASKQNSLERLLFGLGIRYVGAK
FT                   AAQLLAEHFETMERLERATKEELMAVPEIGEKMADAITAFFAQPEATELLQELRAYGVN
FT                   MAYKGPKRSAEAPADSAFAGKTVVLTGKLASMSRNEAKEEIERLGGRVTGSVSRSTDLV
FT                   IAGEDAGSKLEKAQQLGIEIWDESRFLQEINRGKR"
FT   CDS_pept        304577..305800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0277"
FT                   /locus_tag="GK0277"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0277"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74562"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3B8"
FT                   /protein_id="BAD74562.1"
FT                   /translation="MKQISLLRSFVACRWTNRARKRLAVVGLASICLLSACAPKFDKGE
FT                   EVVQDKGSKQQEAVIPKYNIADSYYRVILPFKPSGARGEVVNDLNTRLDVDEFETGLMR
FT                   LATEQFPSDEYLFQEGQYLDSETVGKWLARKKTTRQLKEEKMKPEDNIGLNPPISDTGT
FT                   NEQKNKQSPIYLASILEHDYLVKIDNDKVKLGGIAIGLALNSVHYYSTEQGYPREVKIK
FT                   DDVIEREGKRIAAEVLKRLRSMKGLGNVPITIALYKQAPRSSVVPGHFFAVAHVDEGSS
FT                   TIDDWEAVNEEYYLFPSDEAEENHRDDWLKFNNFKSDVEDFFPNYTGIVGRGLYVNDQL
FT                   QKLTINITMPFYGKAEVIGFTQYVTGLVMEKFPDYITVNVYIASAGQPESLIVRQAKAD
FT                   EPFVHIYQ"
FT   CDS_pept        305976..306533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0278"
FT                   /locus_tag="GK0278"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0278"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74563"
FT                   /db_xref="GOA:Q5L3B7"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3B7"
FT                   /protein_id="BAD74563.1"
FT                   /translation="MKAICVFCGSSYGQSVKYKEAAKALGTFLARSGITLIYGGGTRGL
FT                   MGEVAEAALRHQGRVVGIIPQFLKDREVAHNRLSELLVVDTMHTRKAKMYEAADGFIAM
FT                   PGGYGTYEELFEVLSWSRVGLHQKPIGLLNVEGFFDPLLHLLRHTVDSGFAAPEDLELI
FT                   VSAEDVPTLYGQMNTFCRRRHS"
FT   CDS_pept        complement(306967..307743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0279"
FT                   /locus_tag="GK0279"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0279"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74564"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3B6"
FT                   /protein_id="BAD74564.1"
FT                   /translation="MNVAFDHLVHLTERPEQAKTAFEQWGFTAIHGGRHPSWGTYNALC
FT                   CFEHLRYIEWIGIADEQTAKTCGNPLIDQLVADRQEGNGFSQFAFRTNNIGAVAAHLKR
FT                   NGFTPIGPLPGSRERDDGKRLTWSMLFIEDDTDGAFRYPFFIQWGDGDDVRMNELAPLM
FT                   RHPIGSVSLSSISLYTLGLERAVNGYRRLFDLPEPDVGRDEAGAYAELAVGGIAIRFYE
FT                   ADRRHPSTRPFSCRLVGMQEQRRIEIDGATYIVSKP"
FT   CDS_pept        complement(307773..308279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0280"
FT                   /locus_tag="GK0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0280"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74565"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3B5"
FT                   /protein_id="BAD74565.1"
FT                   /translation="MTMSDALLAQVLDRLNAMDGTLQKLVEGQERLEREQIAIRQEQEE
FT                   IRKEQQEIRKEQQEIRLEQQRLRQEQDSLRAGQKELNGIVAALLHRQDETDAKLEALAA
FT                   DVHQLHQEFASLKQTVDRLEQKMDSRYEQLAAQIEDIKLDLNFIAHRTVDNERIIYKLK
FT                   EMLFR"
FT   CDS_pept        308438..308728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0281"
FT                   /locus_tag="GK0281"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C (Glu-ADT subunit C)"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:GK0281"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74566"
FT                   /db_xref="GOA:Q5L3B4"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3B4"
FT                   /protein_id="BAD74566.1"
FT                   /translation="MSRISIEQVKHVADLARLAITDEEAEMFTKQLDAIITFAEQLNEL
FT                   DTENVPPTSHVLDMRNVMREDIPEPGLPREEVLKNAPDQQDGQFRVPAILE"
FT   CDS_pept        308741..310198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0282"
FT                   /locus_tag="GK0282"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A (Glu-ADT subunit A)"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:GK0282"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74567"
FT                   /db_xref="GOA:Q5L3B3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3B3"
FT                   /protein_id="BAD74567.1"
FT                   /translation="MSLFDHSVSELHTLLKKKEVSISDLVDESYRRIDEVEEKVQAFLT
FT                   LNEEQARAKAKELDNQLAKGEETNPLFGLPIGIKDNIVTKGLRTTCASKILYNFDPIYD
FT                   ATVMERLNAAGTITIGKLNMDEFAMGSSTENSGFQLTRNPWDLERVPGGSSGGSAAAVA
FT                   AGEVPFALGSDTGGSIRQPAAFCGVVGLKPTYGRVSRFGLVAFASSLDQIGPITRTVED
FT                   NAYVLQAIAGVDPMDSTSANIPVPNYVEALTGDIKGLKIAVPKEYLGEGVDEGVRQSVL
FT                   AALAVLEKLGAAWEEVSLPHSKYALATYYLLASSEASANLARFDGVRYGYRTDNAKNLI
FT                   DMYKLTRSEGFGAEVKRRIMLGTFALSSGYYDAYYKKAQKVRTLIKRDFENVFERYDVI
FT                   IGPTTPTPAFKIGEKTSDPLTMYMNDILTIPVNLAGVPAISVPCGFVDGLPVGLQIIGK
FT                   HFDESTVYRVAHAFEQATDYHKQKPVL"
FT   CDS_pept        310212..311642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0283"
FT                   /locus_tag="GK0283"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B (Asp/Glu-ADT subunit B)"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:GK0283"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74568"
FT                   /db_xref="GOA:Q5L3B2"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L3B2"
FT                   /protein_id="BAD74568.1"
FT                   /translation="MNFETVIGLEVHVELKTKSKIFSSSPNAFGAPPNTQTNVIDLGYP
FT                   GVLPVLNRQAVEFAMKAAMALNCEIATETKFDRKNYFYPDNPKAYQISQYDQPLGRNGW
FT                   IEIEVNGKKKKIGITRIHLEEDAGKLTHTGDGYSLVDFNRQGTPLIEIVSEPDIRSPEE
FT                   AYAYLEKLKAIIQYTGVSDCKMEEGSLRCDANISLRPLGSDKFGTKTELKNLNSFNFVR
FT                   MGLEYEAKRQEKILLSGGVIRQETRRFDEATKTTVLMRVKEGSEDYRYFPEPDLVMLYI
FT                   DDEWKERVRASIPELPDARRKRYIEEWGLPEYDAKVLTLTKEMADFFEATVANGADPKL
FT                   ASNWLMVEVSGYLNAEQKELHDIALTPESLAGMIKLIQNGTISSKIAKKVFKELVEHGG
FT                   DPEKIVKEKGLVQISDEGALRKIVLEVLDANPQSVEDYKNGKDRALGFLVGQVMKATKG
FT                   QANPPLVNKLLVEEIGKR"
FT   CDS_pept        311818..313122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0284"
FT                   /locus_tag="GK0284"
FT                   /product="O-acetylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0284"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74569"
FT                   /db_xref="GOA:Q5L3B1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3B1"
FT                   /protein_id="BAD74569.1"
FT                   /translation="MSNEQTFRPETLAIHAGQKPDAETGARAVPIYQTSSYVFRDSEHA
FT                   ANLFGLKEEGFIYTRIMNPTNDVLEKRIAALEGGIGALALSSGQAAVFYSIINIASAGD
FT                   EIVSSSSIYGGTYNLFAHTLRKFGITVKFVDPSDPENFERAITDKTKALFAETIGNPKN
FT                   DVLDIEAVADIAHRHAIPLIVDNTVASPYLLRPIEFGADIVVHSATKFIGGHGNSIGGV
FT                   IVDSGKFDWKGSGKFPEFTEPDPSYHGLVYVDAVGEAAYITKARIQLLRDLGAALSPFN
FT                   AFLLLQGLETLHLRMQRHSENALAVAKFLEEEEAVESVNYPGLPSHPSHELAKKYLPNG
FT                   QGAIVTFEIKGGVEAGKKLIDSVKLFSHLANIGDSKSLIIHPASTTHEQLTPEEQLSAG
FT                   VTPGLVRLSVGTEAIDDILDDLRQAIRQSQTVGVK"
FT   CDS_pept        313641..314720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0285"
FT                   /locus_tag="GK0285"
FT                   /product="transposase of IS652-like element"
FT                   /db_xref="EnsemblGenomes-Gn:GK0285"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74570"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3B0"
FT                   /protein_id="BAD74570.1"
FT                   /translation="MYAQFIKELIDLPDVLIQKVRKEEERWIFELSPTEQCPLCPVCLK
FT                   RTIKMTGKKKQWMHGYAQRIGIFWVELPVERRRCGTCGMTFSTSYPGISPRSVATDAFQ
FT                   QWAAQCCIGTSIQAVARMLQLPYTTVERWFYTHAPSFLSNDIQPKAVCVDEFAFRKGHD
FT                   YGVAVMDAETGEVYAIEAGKNEEAIGRALAHVSDSVQYVVSDLAPAMKKAIQGMCPEAK
FT                   HVVDDFHVIQLFTEALDRCRKSLGKEGKKHGHVRYVCRFLTQCPEKLTEEERQTVQKWQ
FT                   NAWIHRYLFCPCSAVRAIAKALVKRTDEIISCILSPYSNGKMEGTNNKIKLMKRRGYGY
FT                   RNIQRFALRVRLETANILS"
FT   CDS_pept        314934..315104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0286"
FT                   /locus_tag="GK0286"
FT                   /product="lantibiotic precursor"
FT                   /db_xref="EnsemblGenomes-Gn:GK0286"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74571"
FT                   /db_xref="GOA:Q5L3A9"
FT                   /db_xref="InterPro:IPR006079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3A9"
FT                   /protein_id="BAD74571.1"
FT                   /translation="MAKLDDFDLDIVVKKQDNIVQPNITSKSLCTPGCITGILMCLTQN
FT                   SCVSCNSCIRC"
FT   CDS_pept        315293..315682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0287"
FT                   /locus_tag="GK0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0287"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74572"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3A8"
FT                   /protein_id="BAD74572.1"
FT                   /translation="MKEKLKMVTTLLAFISFIVVGGVSAASYVTYAGVLPRFQGDTELA
FT                   SANKATNSKSKVENSVVGADYKANMWIQQGSTKVSPTALNVTDNDTRYFTVDQSAVGKK
FT                   VSLMAENASFTYVTVDIAGKFYPDN"
FT   CDS_pept        315800..316681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0288"
FT                   /locus_tag="GK0288"
FT                   /product="NADH dehydrogenase (ubiquinone) chain 4"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:GK0288"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74573"
FT                   /db_xref="GOA:Q5L3A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3A7"
FT                   /protein_id="BAD74573.1"
FT                   /translation="MYIELIKLLKNRNFYISAACLLLLVIGAVVLGVKDYRENVQLLER
FT                   IYHDNPNVFALASPHLEWVGLGGFRFNVFSSLYYFLFPLLLSIPLVDSIDRERKSGNVH
FT                   YQLTRMGRSAYYWGKFLFSYISAFFLFLLPLLFGVVLVNLLTNHWDYSSFSQAYRQLVN
FT                   GTLPLPDNSFEGEKKSLFSPLLEISPYWYVLAYYIIGGLFASGYVCLGLGFSLLLKNRY
FT                   LITLMPQIIYMVCWAALTITNQLAWDPFNFLIPSQPVEGLSYWKIVIVFVLQLLIAVAV
FT                   FSYGVKKSEDVL"
FT   CDS_pept        316671..317405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0289"
FT                   /locus_tag="GK0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0289"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74574"
FT                   /db_xref="GOA:Q5L3A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3A6"
FT                   /protein_id="BAD74574.1"
FT                   /translation="MFSRQNVFFVWQDLLLHRTVIKMILGVMALLMVVGILPLGMVVVG
FT                   KWHSLKDFILLYRYEFFHLPAFLFLLGSALQTNAWVVLRRYRTRRQIGLHKALLVVVLA
FT                   GGVSLWVAAVGGLCTMFVKYVIYPNMPNAHAAFLYVPHSGDKSSFLYFLVMYFFVTAIY
FT                   GLLFVAFIDFGGNRFFAFAAVIILAVLDMFTVHMLPYLFYISEQTAPVWTILVLIAMML
FT                   VLVYTICLSSSQKNYYVQDDLL"
FT   CDS_pept        317402..318103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0290"
FT                   /locus_tag="GK0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0290"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74575"
FT                   /db_xref="GOA:Q5L3A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3A5"
FT                   /protein_id="BAD74575.1"
FT                   /translation="MKPMHLEFTLIKMDVKRIVITCLLFPLLGTLMSSWSEAFSSQCLS
FT                   ELFSRLFGAVTISNWMYWLMICFGYVVLLQIVWKKRDKYFEHKLFILLRDTTSYTMARL
FT                   LAGVLFTLVYVLSVFLIAGGFGLFVSHMAFSFDRSLVLMFVGIAVNLYWHASVWMLLNV
FT                   YATHHLANVVILALFFVGVKMPTPFIPLYYSMADLVRSSSMFWSALMVELLSIVAFGYW
FT                   TIKRVKNADYM"
FT   CDS_pept        318117..318770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0291"
FT                   /locus_tag="GK0291"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0291"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74576"
FT                   /db_xref="GOA:Q5L3A4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3A4"
FT                   /protein_id="BAD74576.1"
FT                   /translation="MKAIVLSNVSKTIKAREVLRNINLELERGKIYGFVGPNGSGKTML
FT                   FRVISGLVKPSSGTVAVFGQTLHQDVSFPSDISVLLEKPGFLEQYSGFDNLHFLAMIQN
FT                   KIGEREVKEAIERVGLNPHDKRPVKAYSLGMRQRLAIAQCIMEKPQLMLLDEPMNALDE
FT                   KSVDQVYQIIREENKRGCTILLTSHNKVDIQSLCHEVYSMNEGVITGMTHITAE"
FT   CDS_pept        complement(318774..318941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0292"
FT                   /locus_tag="GK0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0292"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74577"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3A3"
FT                   /protein_id="BAD74577.1"
FT                   /translation="MAQRRRAAALKLPASSSDAGSYWFTFDCPMNTEAAPSHSWLFKMA
FT                   TPSRISTLHT"
FT   CDS_pept        complement(319184..320545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0293"
FT                   /locus_tag="GK0293"
FT                   /product="transposase of IS231E-like element"
FT                   /db_xref="EnsemblGenomes-Gn:GK0293"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74578"
FT                   /db_xref="GOA:Q5L3A2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3A2"
FT                   /protein_id="BAD74578.1"
FT                   /translation="MKTSLSLQEEWHCFLDGLRSVLSCEELEHMARDHQFIQRKGKLRA
FT                   HDFVALCTFLQEGGGQKSLVQLCSALALKQNTSLSAEGLNQRFHEKAVSFLKAVFEKLL
FT                   IHQTQEARRLCPRHSLFLRIRILDSTSFQLPPEIQGIYEGCTGPGVKIQLEYEWLEGKV
FT                   LHVDVEDARHHDAAYGASLLSTIQEGDLCLKDLGYFSLEGLQAIHDAGAFYISRLKHNV
FT                   GIYQKEGDRFRKWEPEDFLAVLQPGETMELEHAYVSGKKVHQPRLIVYRLTEEQERQKE
FT                   GQWKQKAKQKGAAYVTRRPHPIYVYITNIPAIYTSLHEIHTLYSLRWQIEVVFKTWKSL
FT                   FHIHRFKPMKGARFQCHLYGTLIALLISSTVMFKMREWLYRKQKKELSEYKAMSMIKEF
FT                   GMDLFQALWCSEALAVQLLLKLCDIIAQHGKKSRRYTKKSALDIIESLVIMPVS"
FT   CDS_pept        320984..321136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0294"
FT                   /locus_tag="GK0294"
FT                   /product="lantibiotic precursor"
FT                   /db_xref="EnsemblGenomes-Gn:GK0294"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74579"
FT                   /db_xref="GOA:Q5L3A1"
FT                   /db_xref="InterPro:IPR006079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L3A1"
FT                   /protein_id="BAD74579.1"
FT                   /translation="MAKLDDFDLDIVVKKQDNIVQPNITSKSLLYPGLHHRHLNVLNAK
FT                   FLCIL"
FT   CDS_pept        complement(321329..322777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0295"
FT                   /locus_tag="GK0295"
FT                   /product="transposase of ISBst12-like element"
FT                   /db_xref="EnsemblGenomes-Gn:GK0295"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74580"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KWI8"
FT                   /protein_id="BAD74580.1"
FT                   /translation="MLTVQQAVFTVESLIGKVQQQKQLITHQQQVIEQLLKENKQLRKE
FT                   NEQLKYRVQELEARTKKNSSNSHLPPSSDRFEKKRSSREPSGKKPGGQEGHEGKTLRQV
FT                   EHPHHRVVHRVHTCQGCGASLREVKPFKVDIRQVFDVPPVAIEVTQHEREVKSCPHCRC
FT                   VQQAEFPSHVTNHVQYGPRLTALVVYLHHIQLIPYKRLSDTIEALYQHSISTGTLANMV
FT                   KRGREALESNMDIIEDALLESNILHVDETSLRINGKLAWVHVACTSRYTYLAPHASRGK
FT                   KATDDIGILPRYEGTMMHDAFGTYPKYTHATHALCHAHHLRELKGFIEQGHTWAMRMTT
FT                   FLLAAKQAVEAHHGALSEEEARRWERVYDRILERAQHRLETMTPLPKKALAFVRRLQKR
FT                   KEEALRFLREVHVPFDNNQAERDLRMVKVKENISGTFREETFAQSFCIARSIVSTLTKH
FT                   EKNVWDSLCLLLAGETIDRVLSAT"
FT   CDS_pept        complement(322998..323237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0296"
FT                   /locus_tag="GK0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0296"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74581"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L399"
FT                   /protein_id="BAD74581.1"
FT                   /translation="MGTTYAKVNFSMSMYIAFSACGVFQLPAHAQRTQGLGSGVILKLA
FT                   DLPHMMVRRTNPRPFDARVSPTRSGLAFLSSQAR"
FT   CDS_pept        323289..323657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0297"
FT                   /locus_tag="GK0297"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0297"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74582"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L398"
FT                   /protein_id="BAD74582.1"
FT                   /translation="MKRLKITHDHGWTPRKLRKQERKIKNAHLRQRVMAVRLVMEGYLG
FT                   REVASMVNVCRPTVSHYVSLFNEGGLELLLHRDFAPGSRFSPKNSRKRSNTPRVDHDTC
FT                   GAGLGHRFGVEYEHPSIL"
FT   CDS_pept        324051..324278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0298"
FT                   /locus_tag="GK0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0298"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74583"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L397"
FT                   /protein_id="BAD74583.1"
FT                   /translation="MPTFGHHAHISLFGAVNVHDGETVLHQAGAANATTFLDFLRVLKE
FT                   RYSDRLVVLVLDNARIHHTKMVREFLREEG"
FT   CDS_pept        324278..324505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0299"
FT                   /locus_tag="GK0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0299"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74584"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L396"
FT                   /protein_id="BAD74584.1"
FT                   /translation="MFSLHLLSSVFTATEPDRTLVEMAERYCHCQCVSQRSKRYRPSRF
FT                   CMFLNLKNIAGKRYFQLKHRLSRISSEACA"
FT   CDS_pept        324824..326977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0300"
FT                   /locus_tag="GK0300"
FT                   /product="lantibiotic biosynthesis protein"
FT                   /note="similar to N-terminal region of lantibiotic
FT                   biosynthesis protein (spaB 1030 aa) of Bacillus subtilis
FT                   (GK0300 divided by IS-like element (GK0301) is possibly
FT                   continued to 329,833 bp)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0300"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74585"
FT                   /db_xref="InterPro:IPR006827"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L395"
FT                   /protein_id="BAD74585.1"
FT                   /translation="MKDLIFKNIDTFMIRTPVLSVDNYLRFFDQKLTEGEMKERLLEIC
FT                   HNPVFRESILVASKSLYNKMIDFCNGKEIKKYDYFIKAIYKYLIRISTRPTPFGLFAGV
FT                   DFGEYTDENTSIRYGTNKYKKFARPDLEWLMKIVKKLEQEQYEQLWFTVNDSIFLKGER
FT                   AYLLHSTRKDDDKRVNEISVRVTLPFKITCELARHLIHYQTLKKELIKQFPNTSEEKIE
FT                   RFLKQLIENEFLISNLRPPLTVMDQLDYLIKRLKESHIEEWSNELIDIQQKIRTYTMTP
FT                   LGEGEQIYKELHKKMKKLADTKNVLQVDMKLNLQEKKLNKQVIKDVNELMHILLPFSMT
FT                   YQQTDSPLSRYKQEFIEKYGVDREVPLLEMLDNDLGIGAPMDYTNPKNARLAVGVPHQL
FT                   IDEQLREYFLHKYIEAVKDKKSITITEDEIKELGLDDYDYQSIPDSLDINVIIKCDSEQ
FT                   DLEHNHFKYYIGPNLGSTHAGKSFGRFSYMMEGEEKLFETLNKEMLNLNNDSGEYVTCE
FT                   LVYLPNETRHANVTRNIHNSEYELALFTNNSKDEYHRLSLNDILIGIENDMFYAKSKTL
FT                   NKKLIITMNNMLNTQNAPNAIRFLYDISLDGKKIWCNFPWDTIFQDYAYIPAIEYKNFV
FT                   IAPRKWVPSSTVTRQTKCLSPLDTKGIGGIWAHFGRVSRCEGGCLESLEEVPALEPQGI
FT                   ALVWPSVRFVDKGRRFLKKNVQA"
FT   CDS_pept        complement(326841..328229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0301"
FT                   /locus_tag="GK0301"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0301"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74586"
FT                   /db_xref="GOA:Q5L394"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L394"
FT                   /protein_id="BAD74586.1"
FT                   /translation="MAFGSALETTGIGRDSPLLVCSRHHQIPLERLIFAMVANRALHPS
FT                   SKLAMEEWVEKDVHIPHLPQVASHQLYRAMDELLAVQPELERQVFHAVADLLNLEVDLI
FT                   YFDTTSSYFEVDPSETPEGESLRKQGFSKDKRPDLVQIVIGLAVTREGVPIRAWVWPGN
FT                   TMDMTVIKQVKQDLIGWKLGRVISVMDRGFSSEENLRILQQAGGHYIVGEKMRSGKAAV
FT                   EEALNRRGRYQQVRENLHIKEIIVGDGEARQRYVLVYNPSEAERQRKEREKLLESLKEE
FT                   LEGLRQLPNEAHHKATCRLRSHPSYGKYLRQLKDGTLRIDKQAVREAEKYDGKYLIRTS
FT                   DDTLSAEDVALGYKQLVDIEQAFRTLKSTLELRPMYHRLEDRIRAHVLLSWLALLLVRI
FT                   VEIRTHESWPKVRDECERLMLGHFSSKNGDLYQRTELTAKQALFLAALGLEPPPKILGI
FT                   HPRT"
FT   CDS_pept        330184..331371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0302"
FT                   /locus_tag="GK0302"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0302"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74587"
FT                   /db_xref="GOA:Q5KY66"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KY66"
FT                   /protein_id="BAD74587.1"
FT                   /translation="MNRLAHHQGIHKFFFTLGLTLQLSKPVIKHLIHIVDALTTKGFSG
FT                   TLTDIHYWSFHPNHRTTLSHFFTKSPWNEERLLGKLQEWILSQVERLAKRKNQPLFVSI
FT                   DDTICQKTKPSSRAAHAIQGCDWHYSHKDHQSVWGHSLVWLMVHTFTQAFPFAFRLYDK
FT                   KAGKSKIDLAIEMLSSLKVKRAQPVYVLMDSWYPSKKLIEACLKQGFHVIAMLKTNRIL
FT                   YPKGIAIQAKQFARYVESKDTRLVTVGQERYRVYRYEGAIHGLDDAVVLLAWKADQPMA
FT                   PEHLHCILSTDRELGDEDILRYYAQRWTIECFFRQAKDQLKLDGYRVRHIRAVKRYWAV
FT                   VLLACVYSIAESRQNLSTGLELLRSRKDHSVVEFIYDAAKQDIPIDVIKKQLRIA"
FT   CDS_pept        331436..333265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0303"
FT                   /locus_tag="GK0303"
FT                   /product="lantibiotic ABC transporter (ATP-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0303"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74588"
FT                   /db_xref="GOA:Q5L392"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L392"
FT                   /protein_id="BAD74588.1"
FT                   /translation="MNIKEYDDHVTIKDIVKSIRIVPKTLVLIKNVDKQSFFIIIFLSL
FT                   LMGGAPIVTLLGSQNLLNAIGSQNIHIIISALIFYISAVLLSEIISSFMEYYQNKFQTL
FT                   INYKLNLQIMDKCTRLSLQHFEDAEVYDMLQRVQNETPYKPFEVFLSILGAISAIVTFF
FT                   SSMMILIHWKPWVLIILIFIPLVFSFYFFKIGQREFNVSWLRAPEKRKSWYLSYLMTRD
FT                   NTFKEVKIYNLAGYILNKFKEINKTFVEQDIHLFKRRTVFTFIFELVEQICINTVLVII
FT                   IISALAGEILIGHVVGLIQALNLISSNSKKILNIIHSLYKNNLYINQLFEFLGLDEEVL
FT                   DKGDRFVSGIDKIENIKIRNLTFRYPTKPKVVLKNINLDINKGERIAIVGANGSGKSTL
FT                   IKLLLKLYEHDEDSIFYNGVSINDLDTEQLRKNIAVLFQDFVKYELKLTENVGFGDITR
FT                   IDRDGELKQAMERARVNFIEDLDTQLGLWFVDGVQLSGGQWQKVAIARALFRDASVYIL
FT                   DEPSSALDPISEKEVIDMFINMTKDKIGIFISHRLSTAKLADKIVVMNDGEIVGIGTHW
FT                   ELLATNELYRRMYELEALKNEEEYEHLNESAGL"
FT   CDS_pept        333246..334535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0304"
FT                   /locus_tag="GK0304"
FT                   /product="lantibiotic biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0304"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74589"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR020452"
FT                   /db_xref="InterPro:IPR033889"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L391"
FT                   /protein_id="BAD74589.1"
FT                   /translation="MKALVCNLAKKLSDYENMKRIVNHPSNYIKIGNKTINPFNELSLS
FT                   HGLPALCALYGELGEQYPDEGWDLLGHQYIKKIGEQMNQHGFPSLSMFTGLAGIGLAAV
FT                   CLSKGGKRYQNFISTINQAIEERIGEMIEYLKQKPYPNMDDYDAISGVAGIASYCLLFP
FT                   QEMKKSITLILKYIIDLSQDKQMEDINVPGWYIPPKNAFSDTERRKWPSGFFNIGLSHG
FT                   IPALLIVLCNAKKLNIYVDGQDECIQRIADFLMKFQIKDENGSYWGTHVSLEEYKNGSV
FT                   LNKDTRDAWCYGTPGVAYSLLIAGKTLNNQSYIDCAVSGMKLASKRLYNIFSPSFCHGL
FT                   SGVAYICNRFYEETNISDFKEAACKLVDDIIKFYNEEFPFGFKNIEESEGSTKYYDYVG
FT                   LIDGTAGILLTILAIQNSKKTPWDCAFFII"
FT   CDS_pept        334618..334818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0305"
FT                   /locus_tag="GK0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0305"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74590"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L390"
FT                   /protein_id="BAD74590.1"
FT                   /translation="MAYRSVEQLPKKGVVRSTGHRSNMLEKVHRQEVSFTRASLKTCAF
FT                   FSKKQQRVKLHIAPMNNATVL"
FT   CDS_pept        334884..335582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0306"
FT                   /locus_tag="GK0306"
FT                   /product="lantibiotic biosynthesis protein (response
FT                   regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0306"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74591"
FT                   /db_xref="GOA:Q5L389"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L389"
FT                   /protein_id="BAD74591.1"
FT                   /translation="MNNKKILVVDDDEDICCTIKQYLELHHYQVETVHSGVEALKMIND
FT                   DFDLIVLDIMMEGIDGMELCTIIRDRVDYPIVFVSAKTLEEDKVQALAIGGDDYITKPF
FT                   SLKELKARIDSHLRREERIRSNERYLLSSKNITIDLLANEVFCKGKKLPLTKKEYEIVK
FT                   LLMLNKKVVFSKERIFERVWGIDSDSQLDTVTESIKNIRKKIKDVDPETSYIQTLYGLG
FT                   YKWDVSNEKR"
FT   CDS_pept        335569..336987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0307"
FT                   /locus_tag="GK0307"
FT                   /product="lantibiotic biosynthesis protein (sensory
FT                   transduction protein kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0307"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74592"
FT                   /db_xref="GOA:Q5L388"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L388"
FT                   /protein_id="BAD74592.1"
FT                   /translation="MKNDKTIKRDFYLLVVKVVLATVISSAVTYLCVIYLIMTLTTNDV
FT                   VKPTNYFVKDLDLIEKKVKENEEAIFKGRLIPIHRYSEKIQGEVVDISGKHLYGDREII
FT                   DDQVDISQSINREIVKGSYVYRFIPLKHDNAIQAVYVLKAPFGFIINNQNRFEAVLIYA
FT                   VMFISPLIFFIVYLIFFTSRLYKSLFHNVKLLLQASDHIASGNFDFQVSGLKRKEFIKI
FT                   QDSFNTMISALKEMVERLAKTDDERKMMVSSIAHDIRTPLTVIQGQIDLIQDLRKLDHF
FT                   DVTPHLEIIRKNCGKMTMLTDNLSLLYKVENDHFSLNGKEVDVRQILEEKKLEISTMVY
FT                   HQKSINICFDVNLQKSRYILDEAMLMRVLDNILYNSLRFTKSGEIKLEVYDEKEGNECK
FT                   IYFRCSDTGTGFKENDTSLLFQPFYQDKQYKNHVGLGLYIAKRIVNHHGGEIWAYNNEK
FT                   GGATVEFYIKELSD"
FT   CDS_pept        complement(337278..338468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0308"
FT                   /locus_tag="GK0308"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0308"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74593"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L1V9"
FT                   /protein_id="BAD74593.1"
FT                   /translation="MLSIPLGLPEFKVIKQELLSYGYAIHVEKTETQERCPHCGFATSS
FT                   VHDRRTRKVRDLAIFHQPVYLFVKVKRYRCWNCSQVFSASLESIQPNQHYTNRFCEYLY
FT                   ELCEGSTIQEVSRKHRIPYTTLERIYYFIASKKAKERQTAIEASSQEEMVLSLDEIAVK
FT                   KGHQYETVLMDAKAGSVMGMHADRQCDSALHLLSQNVLSKERVQTVILDMWEPYHKAVR
FT                   ALFPSASIVIDKYHVIQKVTQALDQARKEFPPLKKARYLLLKGCEKLRKDQRLRLDDIL
FT                   EEYPVLSIAYYLKELFRDFYRTDGYNEAKERLEEWIQLAKQSPFASFQEAANTLERWKE
FT                   PILSYFLCPYTNARIEGTNHKIKNIKRRAYGYRNRERFRLRVFLECTGNTTGSQAA"
FT   CDS_pept        complement(338625..339008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0309"
FT                   /locus_tag="GK0309"
FT                   /product="lantibiotic biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0309"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74594"
FT                   /db_xref="InterPro:IPR040876"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L386"
FT                   /protein_id="BAD74594.1"
FT                   /translation="MKNSILLLMLIGILFIAGCSLVSNLKKTATQNMEIDRKLPKYELN
FT                   KENLQEIHYQGRTYMIQAAKVDRNQLNKPIGKVAETITINEHHQILSKKELRKIEVIPD
FT                   QTDEKRTHLNFGWVIQHQRRKPR"
FT   CDS_pept        complement(339063..339851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0310"
FT                   /locus_tag="GK0310"
FT                   /product="lantibiotic ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0310"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74595"
FT                   /db_xref="GOA:Q5L385"
FT                   /db_xref="InterPro:IPR022294"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L385"
FT                   /protein_id="BAD74595.1"
FT                   /translation="MSFLRLLSSEWIKTKRTAIRMMVIITPIIYSLFMVWYFSHYRTST
FT                   FWQMKIYQGFFEVMAVSLPIIISLLTGLMSYQEEKAGSFMNILTGPVSKVQWYVGKLTL
FT                   LIFIACADILLATILMLFGMKYVLKVAHIHYQLFLQGAMLSIVGSLILFSLHLFISFAF
FT                   GMGASIAVGSGGFLISALIGATSLGDHVWSYIPWAWAVRLSQFPILMMPEVKQTLGAQL
FT                   LSSFSLSLWEGIAYALLSFIIVTIIGSIWFHRWEGNQPHE"
FT   CDS_pept        complement(339853..340599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0311"
FT                   /locus_tag="GK0311"
FT                   /product="lantibiotic ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74596"
FT                   /db_xref="GOA:Q5L384"
FT                   /db_xref="InterPro:IPR021205"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L384"
FT                   /protein_id="BAD74596.1"
FT                   /translation="MLNMFESERLKYKRTFAKKLVFIAPLFFVLYAIITMPTINSTHNY
FT                   FEYAVFNWWPLIFVPIGTALIASLSTVREKKSGNDKVLRCHDISIVRLWWSKITVIAYY
FT                   MLLSTIELIILLVLLKWLFPNSLSSATVAVFASLVIWLTSLAYIPIGLFVAERFGMVVS
FT                   IIVSVIGLALGVVMAAQPYWLFIPWSWGMRMMCPIVGVHPNGVPLEKGSPLLDPSVIPI
FT                   GLAIALVMFLLLSFLTAVWFARKEVY"
FT   CDS_pept        complement(340618..341307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0312"
FT                   /locus_tag="GK0312"
FT                   /product="lantibiotic ABC transporter (ATP-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0312"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74597"
FT                   /db_xref="GOA:Q5L383"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L383"
FT                   /protein_id="BAD74597.1"
FT                   /translation="MGEYMLETHHVSKAFGKQLVVDDVSIKVKKQTVYGLLGPNGAGKS
FT                   TLLKMLTGLLRPTKGEIMINGHPWSRKDLKDIGVLIESPALYGNLTAHENLLVHAKLLH
FT                   LPESRIQEVLNIVGLENTGKKKASQFSLGMKQRLGIAKALLNHPKLLILDEPTNGLDPL
FT                   GIQDLRKLIQSFTENGITVILSSHILSEVKQLADYIGIIQNGKLRYEGKIDESQDLEKL
FT                   FVDVVNE"
FT   CDS_pept        complement(341910..342539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0313"
FT                   /locus_tag="GK0313"
FT                   /product="hypothetical protein"
FT                   /note="similar to N-terminal region of glycine
FT                   betaine/carnitine/choline ABC transporter (lin1461 504 aa)
FT                   of Listeria innocua"
FT                   /db_xref="EnsemblGenomes-Gn:GK0313"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74598"
FT                   /db_xref="GOA:Q5L382"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L382"
FT                   /protein_id="BAD74598.1"
FT                   /translation="MELLQTFIERKNDIWIAFQEHVLLSAIAMSIAIVIAVPLGVVLTR
FT                   YRKLAEPIIGIAAIIQTIPSLALLGFMLPIFGIGKLPAIIALTLYALLPILRNTYTGIL
FT                   GVDPTLVDAGRGMGMTSRQILWMVELPLSLPVIMAGVRTATVLTIGVAALATFIGAGGL
FT                   GDLIDRGLRIADKNLILAGAIPAAMLAIVFDWLLRKVEKKVTPKGL"
FT   CDS_pept        complement(342794..343921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0314"
FT                   /locus_tag="GK0314"
FT                   /product="glycine betaine/carnitine/choline ABC transporter
FT                   (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0314"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74599"
FT                   /db_xref="GOA:Q5L381"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L381"
FT                   /protein_id="BAD74599.1"
FT                   /translation="MIRFENVTKQYEDGFVALKNINLEIRKGELVALIGPSGCGKTTTM
FT                   RMINRLIEPTSGKVYIDGQDISQLDPVELRRNIGYVIQQIGLFPHMTIAENIALVPKLK
FT                   KWEKHAYEKRVDELLELVGLDPATFKHRYPSELSGGQQQRVGVVRALAAEPDIILMDEP
FT                   FSALDPISREQLQDDIVRLQEEIHKTIVFVTHDMDEAIKIADRIALMKDGEIVQFATPD
FT                   QMLRRPANSFVREFIGEDRLRIRHTAVPTAEDLMSADVATISPRRGLAEAFRLMKAKKV
FT                   DSLVVVDKKQVFLGIVTLKQIEQRYQEEHLLVADIADYDVTTLSKEADVTNVAALFQDP
FT                   DVRIIPVLDGDRLVGGITRSSMMRALAEWTFQQHA"
FT   CDS_pept        complement(343938..344837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0315"
FT                   /locus_tag="GK0315"
FT                   /product="hypothetical protein"
FT                   /note="similar to C-terminal region of glycine
FT                   betaine/carnitine/choline ABC transporter (permease)
FT                   (CAC2849 523 aa) of Clostridium acetobutylicum"
FT                   /db_xref="EnsemblGenomes-Gn:GK0315"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74600"
FT                   /db_xref="GOA:Q5L380"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L380"
FT                   /protein_id="BAD74600.1"
FT                   /translation="MRKWMMTLLAVGLVFGLAACSGTSDAKGKIVISGKKFTEQVILTH
FT                   LLAEYVKANTDLDVEVKDSLGGAFMLQQAIENGDVDMYVEYTGTGYLNILKQPYDPKKT
FT                   PEQIYNETKKLYKEKYNIAWLKPLGFNNTYALAMRRDLAEKLGVKTYSDLAKHSSSLTF
FT                   GSDAEFFERSDGYDGLVDTYGFQFKKKVTIDPDLQYEAAKNGEIDVITAYTTDARIKKY
FT                   DLVVLKDDKQYFPPYHAVPIIRQEVLDANPDLEEKLNKLANILTDEKMMELNGEVNLEG
FT                   KRPREVAIDFLKAEGLID"
FT   CDS_pept        complement(345315..346097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0316"
FT                   /locus_tag="GK0316"
FT                   /product="coiled-coil protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0316"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74601"
FT                   /db_xref="GOA:Q5L379"
FT                   /db_xref="InterPro:IPR002928"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L379"
FT                   /protein_id="BAD74601.1"
FT                   /translation="MKRMEALLREILHEVKATRTAVESLEQRVGALEGQVANLNERTGA
FT                   LEVLAANLNERTGALEAQMAQLNERTSALEQQFTQLNERTSNLEHQVAQLSERMGTVEH
FT                   QVAQLSERMGTVEHQVAQLNERMGTVEHQVAQLNERMGTVEHQVAQLNERMGTVEHQVA
FT                   QLNEQTNTLARRIDLLDERTNETKAIVEALRHGQEVLTAKYEAMAHDLHHMKGDLTRIT
FT                   SILEDKVLPALAEHEAGLSVLNARVFKTESALHRLVYA"
FT   CDS_pept        346233..347723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0317"
FT                   /locus_tag="GK0317"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0317"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74602"
FT                   /db_xref="InterPro:IPR013493"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L378"
FT                   /protein_id="BAD74602.1"
FT                   /translation="MDATWLKPIVETKYLSTENAHRYRAILRYFYIQHERMRQYLFPEE
FT                   VYAFLKQHEEFADYTEEELQQDLDQLVKWNNLIARQETSHVRTIEEFKKKRFRYQCSPY
FT                   TVEIERMIRTLEQLGDSFGGSLEKTRFDRLYASLSRIEAIIASGFQEQRDEMYQVWEET
FT                   FDYFKKIIQNSADYMAYLHSENVEERMTSESFLVYKEQFTAYLRDFIVALQKTSMQIEQ
FT                   LLENLPEDGVRQFIGHVVDYERSIPRFADAPPPRPMQIEEKWETWRSLCEWFLGRNGRE
FT                   SELLFLQYQTNEAIRRLTRVVQRLGERHHHFRSRKGDYLHLARWFSRLESIEEAHCLSA
FT                   VVFGCFHTKHLVADTEATDNIYRDVWDEPPAEWVTKPRVRHYGEKKKPQAIEDKEREKE
FT                   EARLRYLEEKAREEAELKQFVTDGKIVLADLPEVTPYVRKTLLGWIAKAMGREGQAMKT
FT                   ENGWVVNVVNKEGTICLRAEDGELVMPNYEIHVLSRGE"
FT   CDS_pept        347726..348922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0318"
FT                   /locus_tag="GK0318"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0318"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74603"
FT                   /db_xref="InterPro:IPR013494"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L377"
FT                   /protein_id="BAD74603.1"
FT                   /translation="METAFDDKAKEALAALFEQFWIIRDKEPDLYQLVREREHVLKKYV
FT                   EEKFGYRLIVHRYFAKLEKIPAEPEPWMGIESFQEPLDYALFCCLMAYLEGKAVEEKFL
FT                   LSDVCEEIRAMYPGDLPVDWTNYSHRRALIRVLKTAEQIGLVRRMDGEIEAFAQHVEEE
FT                   ALYEVPVLARYFMRTYPKDLLQYESIDELLAEEWKASPQDYRRHRLYRKLFLSPAVHRT
FT                   EGDEQDFYYLRNFRHRLRDDIEAHTPFRYELYKNAAMLTLPERQAPYTVFPDQKGTSEV
FT                   ILHFAALVRERLGEYPPDEYGRIRLTPEQFSAWLADCRRRYGAGWGKTYRDMSAAELVR
FT                   EVLAALNEWRMADVEHDTGMIVLYPLLGRMSGRYPDDFDAKEGGEHGESMGASSCGAD"
FT   CDS_pept        348882..353003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0319"
FT                   /locus_tag="GK0319"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0319"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74604"
FT                   /db_xref="InterPro:IPR013496"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L376"
FT                   /protein_id="BAD74604.1"
FT                   /translation="MANPWVLHRAGLINFWYYDEQYFHFADGKLLLRGSNGAGKSVTMQ
FT                   SLIPVLLDGKKTPDRLDPFGSRARRMEDYLLGEKDVVNRDERTGYLFLEYKRKESDQYV
FT                   TTGIGLRAKRQKSLDFWGFVLFDNRRIGYDLQLYKQEKTGEKIPLTKRELATALGAGGT
FT                   VVETQKDYMELVNKHVFRFESLEAFQELIELLIQLRSPKLSKDFKPTVIYEILESSLPP
FT                   LTDDELRHLSDTIENMDQAKQQLEQLERDERALKRLCDQYRLYNEYMIAEKATEYVKAV
FT                   KQAEQLAAAQHRLHDEEEQARKTLDELDESITRLRREEDVLRSREIDLAGHEVFQQAEK
FT                   YEQLKSERERLQERWERHEQTIAEKERLERQHRRRLDESEARLDDLERKLEDELAQLRA
FT                   DAEEGAFSLHETNEDDFHRHRQKQQEFSFAAWKQEADRHIEQLEELARLWRRHDDVKRR
FT                   YEEASTEAGERRREMDEWRHQQQKWEELLEQEKERFEQAVLAWVEQGGIDVSEADIQAF
FT                   LRQMGALYELYSLDDLKRPFVQAYYDAVGKKKDEKWRLEHDIRLLEEKRAEREAELRQW
FT                   REQRDPEPERDEQTTAARLALEREGIPFVPFYAAVEFVDDVPDDVRERIESALSHAGLL
FT                   DALIAARDVDVDCDRVLIPKPVHMVHTLADYLRPDADAPVSAERIDEVLRSIVITDAEQ
FT                   EGGMTIDETGRYSLGLVRGHAPRRARAMFIGRAARERWRLENIAALEAEIAAVGQEIDR
FT                   LRREHQAVGAAIQALADWLASFPADRDVRTAFEEGQEARRQAESKEREWKRQEEKAALL
FT                   AREWKQIKQQLRDESAELDLAFTLDGCEQAQLAMKSYVRHLHELEVLYRETRHTEAMIA
FT                   QQRERLAALETEIDEAKGERNRIRDEKERISLEIVEMERTLAQMGADDIRAEIARIQER
FT                   LASLRREIPRLVNERARTEQQLMRLAEEREKEARREAFARELAAMWEKSFAREAALGLV
FT                   DLDRSRSLLEQAKEAKQRYEAVLKETRSSLLARLNTVFFQESSNLTEYRASFEPLEEQT
FT                   KPEWTAAAPDDEMAMKAADWREKQERHVIYLDYKGERATPFAVLAEVERDIVLQHEYMK
FT                   EQDRELYEDVILKSVGRILRSRIQRAERWVNDMNKLMGGLDTSSGLVLSIQWKPKTAET
FT                   EAELDTKELVRLLRLDPRLLREEDLQRVTNHFRSKIARARELLEERGQGSTLHQIIKEV
FT                   LDYRKWFSFTLYYEKTNEPKRELTNHRFYQFSGGEKAMAMYIPLFAAAYSRYQEAGDDA
FT                   PYIISLDEAFAGVDENNIRNLFGLVEQLGFNYIMNSQALWGDYDTVPALSICELVRPRN
FT                   ASFVTVIHYRWNGRVKQLMVDDKEWEMIKT"
FT   CDS_pept        353000..354220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0320"
FT                   /locus_tag="GK0320"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0320"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74605"
FT                   /db_xref="InterPro:IPR013495"
FT                   /db_xref="InterPro:IPR024465"
FT                   /db_xref="InterPro:IPR024466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L375"
FT                   /protein_id="BAD74605.1"
FT                   /translation="MSTVKEAAAFFRSEQGFKRLFVEMKRKYESLGRVGGAVSLQSFSK
FT                   EERESIAAFFGKDVSRVFLSDFEKQLGQTRFAGVGLVELLEHYFGVPLMSNKERRQAEA
FT                   EERERFFARLAEEHHWFAAVRGQRFVQTAYEADRGGLEAAVRLVGAALCRLPLSSYMRL
FT                   PLFAQQVASDPHAFDLSTLPGRLLLSALQATTPGQWDVASVESVNELLQSVGLLREDIL
FT                   NFVTCANILAETEGGPHPVFSAASETNTALNMPLRDVLSLVGAHPARGKTVYIVENAGV
FT                   FSTLLDTRAPLVSTNGQMNLATMKLLDLLAASGAKLYYSGDFDPEGLAMAERLLERYGQ
FT                   AVTLWRFSLDDYAAANPVVELTPERLAKLASVTSEPLRPVKEAIGRKKKAGYQEAIIGR
FT                   LTGDING"
FT   CDS_pept        354288..354665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0321"
FT                   /locus_tag="GK0321"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0321"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74606"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L374"
FT                   /protein_id="BAD74606.1"
FT                   /translation="MLVRLELDEAKQRLLFGFFETYLRLSEEEEAKPRHEVSQMETKEA
FT                   KRVMELIVSYEQRGLEKGIQQGIEQGIKQGMKQGMKQGRQEGIEEGKLDVVKRMLAKGY
FT                   DVDTIHELTGLPVEKIERVKG"
FT   CDS_pept        complement(355570..355794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0322"
FT                   /locus_tag="GK0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0322"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74607"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L373"
FT                   /protein_id="BAD74607.1"
FT                   /translation="MQQRQRKAVNNHAWWINGAIQKKQMPKRSPCAKQKSGFLQSKRRK
FT                   NEQPKQNEAVDRGSAAIRFLQTEDVHTMA"
FT   CDS_pept        355931..356986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0323"
FT                   /locus_tag="GK0323"
FT                   /product="D-aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0323"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74608"
FT                   /db_xref="GOA:Q5L372"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L372"
FT                   /protein_id="BAD74608.1"
FT                   /translation="MRRKLRDLGFSIGTLPVGRRNQITDVPGVQVGHVTIRKDVDERTV
FT                   IRTGVTAVLPHGGHLFLEKVPAACFVLNGFGKTTGLVQVEELGTIESPIMLTNTFSVGA
FT                   VWQGTLEYMLEATPEIGDVTGSVNIVVGECNDSYLNTARVMAVTKEHAKEAIAAARVEM
FT                   EEGEVGAGTGMMCFGWKGGVGSSSRIAGGMYTVGALVVSNFGRREELRFVPYVPPSFDE
FT                   RDVPAGSIMMIVATDAPLDARQLKRLAKRAAVGLARTGSHVHHGSGDIVIAFSNAYTIA
FT                   HFSDSVLQSVPPLVRDDAPLMNELFQAAVEATEEAIWNSLTMAETTTGRNGRVGEAIPY
FT                   SLLRWIKWTEK"
FT   CDS_pept        complement(357073..358305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0324"
FT                   /locus_tag="GK0324"
FT                   /product="drug-efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GK0324"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74609"
FT                   /db_xref="GOA:Q5L371"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L371"
FT                   /protein_id="BAD74609.1"
FT                   /translation="MNWKRSVRVLWLCNFMVSAGMTMVIPFLSLFLWQMGVTEHHALSI
FT                   WTGLVFSVTFLSAAVMAPIWGVFADKYGQRANLIRAGIGMGLITGCMAFAASPMTLLAL
FT                   RFLVGFFSGFITVSFSYLARVVPRDHSGEALGTLQTGSIAGNIIGPLIGGALSDLFGFR
FT                   PVFLVTGLCILLTLLPVIFWLEKDPVVPQTKENKASFKEVFRHRPLIVLFIATFLVQIA
FT                   VLGVNSMMTIFVQSLIGHSSNLAFLSGLASSITGIATIIGAPYLGKLGDRIGQEKTLPI
FT                   LLVLSGLFALPQVWTDNIYELYVWRFLQGLVVGGVWPSIQALINAQSPRRIQGRVFGVT
FT                   ASSRFLGNLTGPTAAGAIAGFFSISSIFVLSGLLLIATGALVGYATHDRAWREEMKEKI
FT                   AAWTHRLHSRY"
FT   CDS_pept        complement(358505..359158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0325"
FT                   /locus_tag="GK0325"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74610"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L370"
FT                   /protein_id="BAD74610.1"
FT                   /translation="MGIFRRIKTIILAEANEQIDRWEDPVAMTKQYLRQLEQQLEQGRQ
FT                   ALAQQWVAERRYETLIAQAEATIEKRSRQAKLALERNEESVAKLALRDKLLYEKKLEAY
FT                   KQQYEAIKAKTVEVANRLNQLRERYDELAAKQLELAARVNAAQALKQIDTALASFSADE
FT                   ALRGFARMEERVIALEAEAAAARFGTNAALSPVPFDEEVERELAKWKEAQANNA"
FT   CDS_pept        complement(359118..359642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0326"
FT                   /locus_tag="GK0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0326"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74611"
FT                   /db_xref="GOA:Q5L369"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L369"
FT                   /protein_id="BAD74611.1"
FT                   /translation="MKKAQTFLFIALAALVGWSAFHVLTPHEVMAHGRPGVPFAGVHDG
FT                   FGHHHREFGMGSREGWMMAGLFMWWLIPFLLVGAGAIWLAAARSKRWIGWALVALGVAA
FT                   ILPKWVLILLALAAVYTLGRRQARKTAIAEVWAPALPSVPVDWLDEWEKTIQKEAKQHG
FT                   HFSPDQNDYSR"
FT   CDS_pept        359842..360165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0327"
FT                   /locus_tag="GK0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0327"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74612"
FT                   /db_xref="GOA:Q5L368"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L368"
FT                   /protein_id="BAD74612.1"
FT                   /translation="MVRSYGLDVGGALFVFLFSFLFPTFDVGYYAYGSFLGFAIGSLIV
FT                   GLARIRWNPHARLGGALIGLFLIIAISVIIIRLFPIEIRDVGDLVMPYVNAIVNACFCC
FT                   NLF"
FT   CDS_pept        complement(360550..362859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0328"
FT                   /locus_tag="GK0328"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0328"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74613"
FT                   /db_xref="GOA:Q5L367"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L367"
FT                   /protein_id="BAD74613.1"
FT                   /translation="MRAFQLWMQEWKAVASNRKTLIPIIAVLFIPLLYSGMFLWAFWDP
FT                   YDHLDELPVAVVNKDKGTTFEGKAFHLGDDLVEKLKEKKQFNWHFVNEHEGEKGLKEQK
FT                   YYMLIQIPEDFSQNATTLQDDHPKKLQLIYKPNEGFNFLSAQIGGTAVEKIKTEVAKTL
FT                   TETYAENMFENIQTLADGLTKASDGAKQLHDGLGEAKNGTNKLYDGMKKAEDGSKDLHH
FT                   HLATLAEKSMAFTDGLNQAVNGSTQVQAGVQMLDNGMKHMVDGQGQLLDGAKQAQEGTA
FT                   NLASGAKRVYEGMQTLDARMPQLLQGSEQLSGGAEKLASSLAQWQQGAARVQTGATQVT
FT                   GGLEQLAAQLDALIAQTPDPTQKAVYERLKENVEKLSFGSKQVENGIAQLNDGAKALQS
FT                   GAASLNSGAKQLHEGHIALDRGVDELLSGQQQLVNGANALLNGQEKLVAGMNTLHEKMK
FT                   EAEQGADKLANGGQTLTSGLQVLAQGADRLQDGAHQLANGSQQLASGMNELTSGTRHLQ
FT                   NGMNRLTDGSEELADQLKEGAKKASDVKANKDVYDMFAEPVKVKNEKVNEVPNYGTGFT
FT                   PYFLSLGLFVGALLLSIVFPLREPAAVPRSPFHWFFAKFGVLIGVGIFQALLADSVLLY
FT                   GLDLQVKSVPFFILFSVVTSIAFLSVIQFLVTTFGDPGRFIGIVVLILQLTTSAGTFPL
FT                   ELIPRSLQHFNAWLPMTYSVFGFKAVISSGDFSFMWENIGKLLLFIVAMMVGTMAYFTM
FT                   QHRRRFATAVEQASEA"
FT   CDS_pept        362937..363209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0329"
FT                   /locus_tag="GK0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0329"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74614"
FT                   /db_xref="GOA:Q5L366"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L366"
FT                   /protein_id="BAD74614.1"
FT                   /translation="METILFTDISRTVGQSFVETMVRVPSPNQRLKSCAIHSDELLHQS
FT                   FVSFYLTGAFIFLTKWTFRSFRFISYHKQYLHAISRNDSFMFEVR"
FT   CDS_pept        complement(363509..364771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0330"
FT                   /locus_tag="GK0330"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0330"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74615"
FT                   /db_xref="GOA:Q5L365"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L365"
FT                   /protein_id="BAD74615.1"
FT                   /translation="MFLALFILIAAALFYWITTSDQERRITRLAEQEANTIEQFLLKQS
FT                   DFDLFHDESVVLLSEDQLFFYVIGPNGDLLAGDEIHPRLRPYFLNVLSRMDTGERTPVY
FT                   VTVSLPEHMPGLARAAARDWRVLAVAYPLIIHGDFAGMLYIGMDVTSFFGVFHWLLVVL
FT                   IGLAVLFLAVGVALSYFMSKRALIPIEEAYERQRQFVADASHELRTPLSVVFSSVEALA
FT                   LEEDVMKNDFARRLLDRLREELKRITKLMNDLLTLARADAKNAALELSKQTFDFRPHAE
FT                   RTFQLVSELAAKKQITMHFHAPEQALVTADPDKLTQLLYILLDNAIKYTPEGGEVTLSI
FT                   RTEPKQFILSVKDTGIGIPPEDIGRIFDRFYRVDKTRSRQQGGHGLGLSIAKWIVEAHG
FT                   GTIHVQSQLGQGSEFLVRLPA"
FT   CDS_pept        complement(364862..365533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0331"
FT                   /locus_tag="GK0331"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GK0331"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74616"
FT                   /db_xref="GOA:Q5L364"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L364"
FT                   /protein_id="BAD74616.1"
FT                   /translation="MKILLAEDDLHLGELIVHLLKKKGIDHIDWVQEGEDAYDYAMAEF
FT                   YDVVVLDWMLPNGDGVNICSRLRQNGYTGAILMLTAKDAVQDRVTGLEAGADDYLVKPF
FT                   EIDELVARLKALARRTFVPLQEEKVTFHGFTLNRTSHTLHRGDEEIFLTPREFQLLDLL
FT                   VQNQGQVVPRETILDRVWGWDADVSMKTIDATIKLLRKKLKDDVIQTVRGVGYKIDKSM
FT                   E"
FT   CDS_pept        365707..366912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0332"
FT                   /locus_tag="GK0332"
FT                   /product="serine protease Do"
FT                   /db_xref="EnsemblGenomes-Gn:GK0332"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74617"
FT                   /db_xref="GOA:Q5L363"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L363"
FT                   /protein_id="BAD74617.1"
FT                   /translation="MDMMPFEPTPTPQPKRRGRFVSWLAASVAGAVIGSAATWYVAPKW
FT                   IYGETHSQTEAAETTAKSEVLPLQPTANVKTNMIDAINKVADAVVGVVNIQKQVDFFSD
FT                   QAQDTEAGTGSGVIFKKEGNVAYIVTNNHVIEGANKVEVALPNGKKVNAEIVGADALTD
FT                   LAVLKIPAEGVTNVASFGDSSKVKIGEPVAAIGNPLGLDLSRTVTEGIVSGKRTMPVST
FT                   SAGDWEIDVIQTDAAINPGNSGGALINSAGQVIGINSMKIAETGVEGLGFAIPSENVKP
FT                   IVEQLMKDGKIKRPYLGVQLVDVADLSDEVRADELKLPSNVTYGAAITSVEPFSPAADA
FT                   GLKSKDVIVAINGDKIDSVSALRKYLYTKTSVGDRIKLTIYRDGFETTVSVTLKARDSS
FT                   QS"
FT   CDS_pept        366969..367325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0333"
FT                   /locus_tag="GK0333"
FT                   /product="hypothetical protein"
FT                   /note="similar to C-terminal region of transposase of
FT                   IS605-TnpB family (TM1044 405 aa) of Thermotoga maritima"
FT                   /db_xref="EnsemblGenomes-Gn:GK0333"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74618"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L362"
FT                   /protein_id="BAD74618.1"
FT                   /translation="MERLLMMLEYKAKGDGCTLIRVVSTLYRVCSYCESWHDDAQPLHV
FT                   REWGRPQCRAHHDPDHNAARNDVEGRASFVAVTRQPNRGTHGGGLAGSLSWGGYFQEFP
FT                   NSKRERRWESVRTL"
FT   CDS_pept        367765..368418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0334"
FT                   /locus_tag="GK0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0334"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74619"
FT                   /db_xref="GOA:Q5L361"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L361"
FT                   /protein_id="BAD74619.1"
FT                   /translation="MCTATLLAGVVMLVKGTVRRLYSLAAVLAVPLFFLNNFHTIARVG
FT                   VDPFDYWQQSLIEGQWWAWLSLALFLYIVWYWGLLVQRIGGKKEGQAWWKRQRWIWVVL
FT                   AAAAPVIVYWVQNIDNSVVSSVRTYEPSNAHLPHGPSARIFFLYSHPLERESYIVEADE
FT                   HHVRKVVTLKAVGISHLSPASSTKELLLWSDYTGKIHGQWFALHPGMKIPLFFP"
FT   CDS_pept        368629..369765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0335"
FT                   /locus_tag="GK0335"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0335"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74620"
FT                   /db_xref="GOA:Q5KVU7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KVU7"
FT                   /protein_id="BAD74620.1"
FT                   /translation="MDVIYPRCAGLDVHAETIVACALWEEDGHIQKDIQTFSTFSKGLG
FT                   DLLEWLEEHGVTHVAMESTGVYWKPVFAFLEGYVDLTLANPQRIKNVPGRKTDVSDAEW
FT                   IAKLLRHGLVEKSFVPPADIRELRDFTRLRKKWVGQLTSEKNRIQKVLESSNVKLGSVL
FT                   SDLFGVSGKDILARLLEKGYVDKDELDQCLRGRLKKKKQAVYDSLLGTLTEHELRLLRL
FT                   LWKHVEELERLIEEVDQHIDRLLEPYREEVNLLMTMPGVKKQTAAVIIAEMGTDMSVFE
FT                   TPERAASWTGLSPGNHESAGKRKSTRTTKGNPHLRSALCEAAWSAARSKTHPLSRKFWS
FT                   LAARCGKKKALIAIARRMLVIIFCMISRKEPFRQPQLI"
FT   CDS_pept        369796..370662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0336"
FT                   /locus_tag="GK0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0336"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74621"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L359"
FT                   /protein_id="BAD74621.1"
FT                   /translation="MPKIGHLCFPIAFFGHFQYTLTDQERIPHSPSGGDFHGKVCVSTK
FT                   SRHMDGCRSKAVSSPLSFASLEGEWDIRSLNQDVKTNKLEVRKEGKLLFSKRFPPYVLQ
FT                   VLHVAPYFYVFADVIEKEQGVLYVIDQRGEVVKEIPLLTSSARSMAAFRNYLVIATKPR
FT                   LTIIDPHSWRVTYWDMGQEETRFDQLQVKGDALWVSYVQREKSGWIALNDQFKLIEKHE
FT                   LPSVYWEARFHGDYVYILFEPQEGNKADNAGEMNIFQLRTAQLAAKFTVPKQKHNLQTF
FT                   YVMDEIQ"
FT   CDS_pept        370659..371048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0337"
FT                   /locus_tag="GK0337"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0337"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74622"
FT                   /db_xref="GOA:Q5L358"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L358"
FT                   /protein_id="BAD74622.1"
FT                   /translation="MIVQEMTARGERDIQFRDYEEFWPFYLTQHRKRATRRWHFVGTSF
FT                   VFLFIIIAAVTGNAWWLLGAPIAAYTLAWFSHFFIEGNKPATFGHPLWSLRADFHMYGL
FT                   MLAGRLGRELERIGLSEDRDVSQNG"
FT   CDS_pept        complement(371185..372051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0338"
FT                   /locus_tag="GK0338"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0338"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74623"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L357"
FT                   /protein_id="BAD74623.1"
FT                   /translation="MSETRIDHDRLFKELLSTFFEEFVLLFFPRVYEHVDFNHLSFLSE
FT                   EVLTDVTAGEKHRVDLLIETKLKGEDGLIIVHIEHQSYIQPAFSERMFIYFSRLFQKHR
FT                   RRILPIAIFSYDAIRNEPSSFTVEFPFWAVLDFRFLAIELRKLPWREYIRHDNPVAAAL
FT                   LSKMGYNEDEKVEVKKEFLRMLTRLELDEAKQRLLFGFFETYLRLSDEEEIRLRNEVNT
FT                   MEEKEAAKVMELIVSYEQKGMEKGMEKGMEKAKMDVAKRMLAKGYDADTIHELTGLPLE
FT                   KIEQMKK"
FT   CDS_pept        372264..372803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0339"
FT                   /locus_tag="GK0339"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0339"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74624"
FT                   /db_xref="GOA:Q5L356"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L356"
FT                   /protein_id="BAD74624.1"
FT                   /translation="MWFGHPPEVVYGAVLVVSALLTVLYFFFSDVLDGLFDVADHPLFS
FT                   PQLVLSFFIVGSAVGLLAEWYTDWASSLVLWLAIGVALVAVLLLHFFVFLPLRSAEASL
FT                   GYTDADLEGALAKVIVSVPPDGLGEILISRKSGAVAKAAKSANNEAIPSGEEVIIVQME
FT                   NGVAVVARHDPYHLSI"
FT   CDS_pept        372826..374343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0340"
FT                   /locus_tag="GK0340"
FT                   /product="epidermal surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:GK0340"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74625"
FT                   /db_xref="GOA:Q5L355"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L355"
FT                   /protein_id="BAD74625.1"
FT                   /translation="MVAPWLIVIGVVVLLLVGLIAIFIARYRTVGPDEALIVTGSYLGS
FT                   KNVHVDESGNKIKIVRGGGTFVVPIFQQAEPLSLLSIKLDVQTPEVYTEQGVPVMADGV
FT                   AIIKVGSSIGEIATAAEQFLGKTRQDMENEAREVLEGHLRSILGSMTVEEIYKNRDKFS
FT                   QEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLDALGKPRIAQVKRDADIATAEAEKET
FT                   RIKRAEADKEARKAELERLTEIAEAEKINQLKLAEFRREQDIAKARADQAYHLEEAKAK
FT                   QEVMAQQMQIKIIERQKQIELEEKEILRRERQYDSEVKKKADAERYAIEQKAAAEKAKQ
FT                   IAEADAQKYRVETLAKAEAERIRLDGLAKAEAEKAKGEAEAEIIRLKGLAEAEAKQKIA
FT                   EAFERYGQAAVLDMIIKMLPEYAKQVASPLANIEKLTIVDTGSGAGGGANRVTGYATNL
FT                   MASLQETLKASTGIDVKQLLENLTTSGASSAVTAKPTVAEEANASQS"
FT   CDS_pept        374486..375406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0341"
FT                   /locus_tag="GK0341"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0341"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74626"
FT                   /db_xref="GOA:Q5L354"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L354"
FT                   /protein_id="BAD74626.1"
FT                   /translation="MKRARIIYNPTSGRELFRRHLPDVLVRLEKAGYETSCHATEGPGD
FT                   ATKAARQAVEREFDLVVAAGGDGTINEVVNGIADQPYRPKLGVIPVGTTNDFARAIGVP
FT                   RSIEGACEVIATGEPVPIDIGCVTNEDKTRYFINIAGGGRLTELTYEVPSKLKTMLGQL
FT                   AYYLKGIEMLPSIKATEAQIEYDGKLFEGEIMMFLVSLTNSVGGFEKLAPDSSLNDGLF
FT                   DFIIVKKTNLAEFIRLVTLAARGEHINDPHIIYTKANRVKVRSPMQLNLDGEFGGMLPG
FT                   EFVNLYRHLEVIMPKDKAEQVRTGR"
FT   CDS_pept        375484..376857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0342"
FT                   /locus_tag="GK0342"
FT                   /product="RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0342"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74627"
FT                   /db_xref="GOA:Q5L353"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L353"
FT                   /protein_id="BAD74627.1"
FT                   /translation="MTKQQAPVAKNEYYDVTFTDLTHDGLGVAKVDGFPLFVKHALPGE
FT                   RAKVKAIKVKKGYGYGRLVELYEPSPDRVEPPCPVYRQCGGCQLQHLSYEGQLKAKEKQ
FT                   VKEVLARIGKLDGVTVHPVIGMKNPWRYRNKAQVPVGEREGGLVAGFYKERSHEIIDMD
FT                   ACLIQQEKNDDVVQAVKRIVERYGIPSYDELAHRGVLRHIVARYGAATGEVMVVLVTRT
FT                   NHLPHEQEIVRSIVREIPDVKSIVQNVNPERTNVIFGAKTRVLWGSEFITDRIGGIQFA
FT                   ISARSFYQVNPEQTKVLYDKALEYAELTGRETVIDAYCGIGTISLFLARKAKHVYGVEI
FT                   VPEAIEDAKRNAELNGIQNVTFEVGAAEDVIPRWYEEGVRADCLVVDPPRKGCDAALLE
FT                   TIIAMKPPRVVYVSCNPATLARDLRILEDGGYETIEVQPVDMFPHTAHVECVAKIRLR"
FT   CDS_pept        377195..378649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0343"
FT                   /locus_tag="GK0343"
FT                   /product="type I restriction modification system M subunit
FT                   (site-specific DNA-methyltransferase subunit)"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:GK0343"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74628"
FT                   /db_xref="GOA:Q5L352"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L352"
FT                   /protein_id="BAD74628.1"
FT                   /translation="MLTGELRNKVDKIWETFWTGGITNPLTVIEQFTYLLFIKGLDEVE
FT                   TQREQEDALLGIESERIFPPDKQHLRWSKFKHFEAAHMYDVVSNEVFPFIKNLHGNRES
FT                   AYAKYMGDAIFMIPTPQMLVKIVDGIDRIPMKDRDTKGDLYEYLLSKIATAGTNGQFRT
FT                   PRHIIHMMVELMKPTPEDIIVDPAAGSAGFLVAAGEYLRKHRSDLFLVQSLKEHFNNHM
FT                   FYGFDMDRTMLRIGAMNMMLHGIENPNIEYRDSLSEQNKDKDKYTLVLANPPFKGSLDY
FT                   DAVSNDLLKVVKTKKTELLFLALFLRILKTGGRCACIVPDGVLFGSSKAHKDIRKEIVE
FT                   NHKLEAIISMPSGVFKPYAGVSTAIMIFTKTGLGGTDQVWFYDMKADGYSLDDKRTPIE
FT                   ENDIPDIIARFHNREAEKERKRTEQSFFVPVEEIRENDYDLSINKYKEIEYEEVQYEAP
FT                   SVIIKRIKELENDILKGLGELEDLIK"
FT   CDS_pept        378646..379686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0344"
FT                   /locus_tag="GK0344"
FT                   /product="type I restriction-modification system S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GK0344"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74629"
FT                   /db_xref="GOA:Q5L351"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L351"
FT                   /protein_id="BAD74629.1"
FT                   /translation="MRKVSLGSLVNIRTGKLDANASDPEGKYPFFTCSRETLKIDTYSY
FT                   DCECVLVAGNGDLNVKYYNGKFDAYQRTYIIESIDKNILNVKYLYYFMQLYVSKLRQMS
FT                   IGGVIKYIKLNYLTDAKIPLPNIEKQNKIVKVLEKAQELIDKRKAQIKALDQLTKSLFL
FT                   EMFGDLKNNRYNWPIAELGDVCISIKDGPHVSPKYTQKGIPFISVNNIINNKWDFTNVK
FT                   YISETDYEIFAKRCKPEKGDILYTKGGTTGFAKYIDIDIKFMNWVHLAVLKYDKNIMDG
FT                   IFLTHMLNSHFCYAQSQKYTRGIANRDLVLSQMKKIKVLVPPLERQKKFVSIVEKVPSR
FT                   ILCNVR"
FT   CDS_pept        complement(379813..380982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0345"
FT                   /locus_tag="GK0345"
FT                   /product="transposase of IS654-like element"
FT                   /db_xref="EnsemblGenomes-Gn:GK0345"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74630"
FT                   /db_xref="GOA:Q5L350"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L350"
FT                   /protein_id="BAD74630.1"
FT                   /translation="MSKRSIPNVDWANQLENAIRQFVKEKLELIMREEIKNFLEIEQAG
FT                   TPNMRNGYYQRNLDTQYGRIEGLLVPRDRNGEFQTQLFAPYQRHTGWLEEAIIRMYQSG
FT                   MSTREIGKFIERILGSTYSPATISRITDVVKEDIEKWHARPLHQRYSVLYLDGLYVKLR
FT                   RDTVEKEVIYVVLGVNEEGYREILDFFVGGQESAYVWQEILQQLYKRGVKEVLLGVFDG
FT                   LPGLEEAFKAVYPKADVQRCVVHKVRNTLSRVRKKDQFEMAEDLKLIYRSPNKEIALEM
FT                   FQQFQSKWSHKYPREVQSWANELDVLLTFMDYPSSIRSVIYTTNAIERTIKEIRKRLKP
FT                   MNSLSSLEAAEKVVYLTIQDFNEKWAGRKLRGFAEAQEALQRMFEERYC"
FT   CDS_pept        381257..384595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0346"
FT                   /locus_tag="GK0346"
FT                   /product="type I restriction-modification system R subunit
FT                   (endonuclease)"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:GK0346"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74631"
FT                   /db_xref="GOA:Q5L349"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L349"
FT                   /protein_id="BAD74631.1"
FT                   /translation="MSNFHFLVGKPHYESFTNACLEAEKSLVVSPATCAILTRRALELA
FT                   VKWVYSFDSALKVPYQDNLSSLIHDNVFLSIIDEDLLPLLRYIVKLGNVAVHTNSMITR
FT                   EEAILSLHNLHQFVSWIDYCYSDEYTATDFDESLLPIGEEKRERPEELKDLYERLSSKD
FT                   KRLEEMMKENEQLRALLTAKREENTKEYHFQVDELSEWETRKKYIDLDLKLAGWEFKKD
FT                   VIVEYPVVGMPNQEGVGYVDYVLFGDNGKPLAVIEAKRTTADPNKGKQQAKLYADCIEK
FT                   MHGQPPIIFYTNGFETYMWDDLNYPARRVSGFYNKEELSLLIDRRTMKKPLKNVQINDN
FT                   IANRYYQKEAVLAVCDALENKRRKALLVMATGSGKTRTAISIVDVLTRHNWVKNILFLA
FT                   DRKTLVTQAKNSFSHLLPNLTLCNLLDNKDNPEESRMVFSTYPTMMNAIDDAKRKDGRR
FT                   LFTVGHFDLIIIDESHRSIYKKYRAIFDYFDAILLGLTATPKDEIDRNTYEVFDLENGV
FT                   PTYAYELDQAVQDGYLVDYRTIETKLKFLEDGIHYDELSDEEKERYEETFDDEVGEDID
FT                   STALNEWLFNDDTIDTVLRDLMEKGIRVEGGDKLGKTIIFAKNHRHAERIVERFDQLFP
FT                   EYKGGFARVIDYSVNYYQTLIDDFSDRNKWPQIAVSVDMLDTGVDIPEVVNLVFFKKVR
FT                   SKSKFWQMIGRGTRLCKDLFGVGQDKTHFLIFDYCGNFEFFRENPKGIEGKAVESLTER
FT                   LFNAKIEIIKELQHLQYQEEEYIAYRNELIDEVLAEINKLNEENFRVRQHIQYVHKFKN
FT                   RTKWDSLTAIDVNEIKEHLSPLIVPLNDDELAKRFDLLMYTIELAKLQTKNATKPIRSV
FT                   IRTAEALSKLGSIPQVMEQKYIIEKVQTEEFWSEADIFELEAVREALRDLVKFLEKETQ
FT                   KIYYTNFKDQILEVKENGPMFNVNDLKNYRKKVEHYLHEHRDQMAIYKLRNNKKLTVQD
FT                   LKTLEHILWSELGTKDDYQREFGDTPITKLVRQIVGLDPQAANEAFSEFLSSERLNIQQ
FT                   SRFVKLIVDYFVKNGVMDKRVLQEEPFKTVGSIVELFQDNMDDARKIIRIIDEINRNSE
FT                   DIVGA"
FT   CDS_pept        384854..385468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0347"
FT                   /locus_tag="GK0347"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0347"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74632"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L348"
FT                   /protein_id="BAD74632.1"
FT                   /translation="MSHPISNFHYLPPTIMIAILNYPLFPHETDRFHTVFHIREDEEQF
FT                   LWSHHLEFHVLDLSQFMVKWKKYRREVKQSPEWPWLTMLSAVDGRTKKMDEEMFRELEG
FT                   IAMTEQDILEALEEWQNLSVDPENRYAYEMRLKWLLDQLSNIRGSREEGRQEGLKEGLE
FT                   QGREEGKNETIRKMVEKGMSITDVAHILDMTEEEVRERLGD"
FT   CDS_pept        386664..387227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0348"
FT                   /locus_tag="GK0348"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0348"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74633"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L347"
FT                   /protein_id="BAD74633.1"
FT                   /translation="MIRFHDFQVDVQTYAQRGKQNDFPLLKRCPHCQAKRPLYRHGYYE
FT                   RNAVTSHQSYRIWIARYRCPECRRTVAVLPSFLLPYFQYTLPTIWRVVKERLGLTPKRG
FT                   MEEAPLLPTDEGVLFYVRRLFRNLNHLHWFFAERWRKIGPAIAQARERALWWIQTMEEI
FT                   GLFFVIQEIWEHRSTHLFARTFIS"
FT   CDS_pept        387370..388617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0349"
FT                   /locus_tag="GK0349"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0349"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74634"
FT                   /db_xref="GOA:Q5L346"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L346"
FT                   /protein_id="BAD74634.1"
FT                   /translation="MNESMRQEIALFRYGLIAPLVNGQVDPKTYLKEVAERIHQVPHHG
FT                   EKRIAAKTILDWCTQYKKGGFEALKPKRRSDRGHSRRLSPEEEDHILALRKKHPHMPVT
FT                   VFYQHLIEQGEIQSISYFTIYRLLKKYNLVGKEILPIPERKRFAYDQVNELWQGDLSHG
FT                   PLIRVNGKTQKTFLIAYIDDCSRVVPYAQFFSSEKFDGLRIVTKEALLRYGKPKRIYSD
FT                   NGKIYRAEPLQYACAELGITLIHTQPYDPQSKGKIERFFRTVQTRFYPLLEMNSPKSLE
FT                   ELNERFWKWLEEDYHRKPHASLNGKTPHEVFQSQVHLVSFVEDSDWLDSIFLKREYRKV
FT                   KADGTVTLNKQLYEVPPRFIGQSIELRYDEQGVYVYEDGQRVAEAVLVRFEDNAYVKRH
FT                   RSPFAAVPVEGGENDV"
FT   CDS_pept        388610..389410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0350"
FT                   /locus_tag="GK0350"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0350"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74635"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KZ98"
FT                   /protein_id="BAD74635.1"
FT                   /translation="MYKTFYSLSREPFSKETNPPEAYQGASYQEALAALDYVKRTRGIG
FT                   LLIGEPGAGKTFALRAFKESLNPSLYHVVYFPLSTGSVMDFYRGLAFGLGEEPKYRKVD
FT                   LFYQIQQGIERLYHEQRVTSVFILDEMHLAKDAFLQDIAILFNFHMDSTNPFVLILAGL
FT                   PHLQAKLRLNQHRPLHQRIIMRYQMGPLDKEEVVGYIEHRLKQAGAKHPIFTPAALEAI
FT                   ALQSQGWPRIINNLATTCLLYGAQLKKHMIDEDIVRMAAEEMGY"
FT   CDS_pept        389710..390078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0351"
FT                   /locus_tag="GK0351"
FT                   /product="cadmium efflux system accessory protein
FT                   (cadmium-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0351"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74636"
FT                   /db_xref="GOA:Q5L344"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L344"
FT                   /protein_id="BAD74636.1"
FT                   /translation="MSKKDTCEIYCYDEEKVNRIQGELQKEDISSVVLLFKALADENRA
FT                   KIVYSLCQDKELCVCDIANIIGASVATTSHHLRTLYKQGIVKYRKEGKLAFYSLDDDHI
FT                   KQLIMIALVHEKEVKVRV"
FT   CDS_pept        390071..392209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0352"
FT                   /locus_tag="GK0352"
FT                   /product="cadmium-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0352"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74637"
FT                   /db_xref="GOA:Q5L343"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L343"
FT                   /protein_id="BAD74637.1"
FT                   /translation="MSEQQAKLSKSEAKTYRVQGFTCANCAAKFENNVKSLPGVQDAKV
FT                   NFGASKITVWGTTTIEELEKAGAFENLKVREDKEKSVKREPFWKQKENIKVYISAVLLV
FT                   ISWFLGKQYGEEHIFATIGYAAAILIGGYSLFIKGFKNLVRLNFDMNTLMTVAILGAAA
FT                   IGEWGEGATVVILFAISEALERYSMDKARQSIESLMDIAPKEALIRRGNEEMMVPVDDI
FT                   QVGDIMIVKPGQKLAMDGIIIKGTSTLNQAAITGESVPVAKTVGDEVFAGTLNEEGLLE
FT                   VKVTKRVEDTTLSKIIHLVEEAQAERAPSQAFVDRFAKYYTPAIIIFALLLAVIPPLFM
FT                   GADWSEWIYRGLAVLVVGCPCALVISTPVAIVTAIGNAAKNGVLIKGGIYLEEAGSLKV
FT                   IAFDKTGTLTKGVPSVTDVVTYNGDENELMTITAAIEKGSQHPLASAIIRKAEEDGLNF
FT                   NDLSVEEFQSITGKGVKAKVNNAMYYVGSPGLFEELLPNGIQSEIKEQITTLQTQGKTV
FT                   MALGTEKEILALIAVADEIRESSKEVIRKLHQVGIEKTVMLTGDNQRTAEAIGKQVGVS
FT                   DIKADLLPEDKLNFIKELRDKHQSVAMVGDGVNDAPALAASTVGVAMGGAGTDTALETA
FT                   DIVLMSDDLSKLPYTIKLSRKALAIIKQNITFSLGIKALSLLLIVPGWLTLWLAIFADM
FT                   GATLLVTLNSMRLLKVKE"
FT   CDS_pept        392253..392417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0353"
FT                   /locus_tag="GK0353"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0353"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74638"
FT                   /db_xref="GOA:Q5L342"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L342"
FT                   /protein_id="BAD74638.1"
FT                   /translation="MSITSLILLLLIMSIVLFVYGVVQKSKAAKRIAFGLFIASVGLAG
FT                   FVVFLIGYM"
FT   CDS_pept        392799..394268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0354"
FT                   /locus_tag="GK0354"
FT                   /product="sodium:alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:GK0354"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74639"
FT                   /db_xref="GOA:Q5L341"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L341"
FT                   /protein_id="BAD74639.1"
FT                   /translation="MIEKLVETVNGWLWSPFLIAFIVCCGLYFSIRTRFLQIRHVKEMI
FT                   RLVTTGKGSEAGVSSFQALTMSLSGRIGVGNVAGTATGIAYGGPGAVFWMWVITFIGAA
FT                   TAYVESTLAQIYKEEQDGQYRGGPAFYIEKGFGWKWFAVVIAGAIILSMAVLMPGIQAN
FT                   SIADGFSNAFGIPKLVTGIFVIAVLGFTIFGGVKRIAKTAEIVVPFMAVGYLLVAIAII
FT                   AANIEKVPDVFGLIFKSAFGADQVFGGILGSAVMWGVKRGLYANEAGQGTGAHPAAAAE
FT                   VSHPAKQGLVQAFSIYLDVFLVVTATALMILFTNQYNVINEKTKEPIVVNLEGVEPGAG
FT                   YTQAAVDTLFPGFGSAFIAIALFFFAFTTMYAYYYIAETNLAYLVRGEKRGTAFFALKV
FT                   IFLAATFYGTVKTATTAWAMGDIGLGIMVWLNLIAILLLFKPAYIALKDYEEQLKQGKD
FT                   PEFNASKYGIKNATFWENGYTRVDEKKEQAL"
FT   CDS_pept        complement(394522..395397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0355"
FT                   /locus_tag="GK0355"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0355"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74640"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L340"
FT                   /protein_id="BAD74640.1"
FT                   /translation="MNILVTGATGKLGTKVVETLLKSVPAHQLAVSVRQPEKAEHLRAR
FT                   GVDVRHGDFDRPETLETAFQGIDRLLIISTDGDNETRIRQHTNAVNAAQRAQVGFIAYT
FT                   SLANANESRLALAEVHRVTEEAIANTGIPYSFLRNNWYLENEIGTVQAVLAGAPWVTSA
FT                   GTGKVGWALRQDYAEAAAAVLAGDGHENTIYELSGPLMTQEELAAALGAVLGKDVPVQQ
FT                   VNDAAYADIMKKAGLPDPLVSFLVDIQRGIREGSLEIESNDFEKLLGRPVTPIHDALAQ
FT                   LVRDLKGTTH"
FT   CDS_pept        complement(395481..395897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0356"
FT                   /locus_tag="GK0356"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0356"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74641"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L339"
FT                   /protein_id="BAD74641.1"
FT                   /translation="MKQISTRFSMAVHILCLLATSPADCTGDFIAQSVNTNPVIIRRIM
FT                   GMLKKAGLVDVRPGVGGASLRKPPDQITLLDVYRAVGVVETDQLFRIHEHPNIQCPVGR
FT                   NIEAVLQAELKAAQAAMEERLSQTTISRLIAQFQ"
FT   CDS_pept        396133..397521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0357"
FT                   /locus_tag="GK0357"
FT                   /product="RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0357"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74642"
FT                   /db_xref="GOA:Q5L338"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L338"
FT                   /protein_id="BAD74642.1"
FT                   /translation="MTDSGKQSFITDIHQLDKKGAGQAVVWQEEEGRRKKLKLTVPSTL
FT                   PGEKVRVLIDWPKRRRAHARVEEVIEPHPERLAPSCPHFDRCGGCVWQHWRYEGQLRHK
FT                   TEHVKTLLKEHGFDPGVVRDTIGMEHPWHYRNKMEFTFSPEGLLGLHERGNFRQVISLE
FT                   TCLIAGEKIVKAAMEVARWARDHRLPGYHKDTHEGLLRHLMVRESFATGEVMVALFATE
FT                   APEGDLKEAAADLTERITKMLPQVKSLLWLENRAWADRTQAEQTHVLAGRDFIYDELCG
FT                   FRYRLWFDTFFQTNPVQAAKLVELALEMGKPQPHENMIDLFCGVGTFSLPFAKRVKALA
FT                   GIEIVETSIESAKRNAKDNGIDNTYFLARDARRGIDEVLEQFGRPELLLLDPPRSGAGG
FT                   KVMRKIGRARPERVVYVSCNPETFASDITELVSFGYTLKTVQPVDMFPHTAHVECCALL
FT                   VRGS"
FT   CDS_pept        complement(397694..398455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0358"
FT                   /locus_tag="GK0358"
FT                   /product="sporulation control protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0358"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74643"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L337"
FT                   /protein_id="BAD74643.1"
FT                   /translation="MFKKLLSSIGIGAATVDTKLAKAQYVQGETVEGIVDIRGGSIEQH
FT                   IDEIYLALVTTYLREIDDKKHEEKAVLARYKVSGSLTIGPNETKTIPFQFALPYDVPVT
FT                   LGSSRVWLQTGLDIKMALDPQDRDHLAIEPHPLVAAFLEAARQLGFRLHHVQCEQAPRY
FT                   WQRRLPFVQEFEFKPASGPFKGCLDELEAIFFLSENSVEVLLEIDRKARGLSGLFAEAL
FT                   DMDETFVRFTYGTGDIPALPQLLADAIQKYS"
FT   CDS_pept        complement(398688..399869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0359"
FT                   /locus_tag="GK0359"
FT                   /product="dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0359"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74644"
FT                   /db_xref="GOA:Q5L336"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L336"
FT                   /protein_id="BAD74644.1"
FT                   /translation="MISSSSFRYHVGIAGAGAFAEFLAGALAPLPSFHLAAVAGRTDEK
FT                   RQRVIDAYRRRQAQAGDVREYREAEELIVDPHVDIVILTTPPHLHAPLAKRALEEGKHV
FT                   LLEKPGGLTAEALRANIQLAARQNRALAVNLVLRYHPLAEAVKQLIHRAFLGPVDYASL
FT                   HNAAHRVAEGHWFWDERRSGGILIEHGVHFFEVGRDWFGEAASARGFALREPDGTRPRV
FT                   GATVIHESNGWRIPVHYYHGFTMDPAASESTHWDIHTARGRIVLEGWIPTQLSVSGLVS
FT                   TDEAAHMDALLDAIPKQPSSRAIEQVRQAANRLLPSVPRSDAPRIPYERTVVLSDRHGW
FT                   YEAIAQTRFLDFCRLIENPSWRVLVTAEDAAADLALAEACTVADEETDPLGIR"
FT   CDS_pept        400161..401204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0360"
FT                   /locus_tag="GK0360"
FT                   /product="nucleoside-diphosphate-sugar pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0360"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74645"
FT                   /db_xref="GOA:Q5L335"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L335"
FT                   /protein_id="BAD74645.1"
FT                   /translation="MKALLLAGGLGTRLRPLTENIPKPMAPIANRPWLEHLIVHLRDQG
FT                   VNEFVIAAHHCSEVIRRYFEDGKRWNVKITYALEPFPLGTAGAIKNAERWLKERFLVFN
FT                   ADIVHLPQLIPLLDFHRQHGGLATIVLTEVDDPSSYGVVEQDDRGQILRFVEKPRREEA
FT                   PSNRINAGMYIFEPDVMRYIPAEREVSIERETFPLLIEKNVGVYGIVSTGYWRDMGTPA
FT                   RYRQVHWDALSREFPIPLKGREIQPGVFVGENVEIGSGVLFVPPVLIGDHVKIGPQAVI
FT                   GPNAVIGDRCQIGARVHCAQTIVWDRSVIRDRSRLQNSIFGYRTVTPAGEVFEDSIINQ
FT                   FKEAVQA"
FT   CDS_pept        401201..402388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0361"
FT                   /locus_tag="GK0361"
FT                   /product="hypothetical conserved protein"
FT                   /note="similar to N-terminal region of hypothetical protein
FT                   (bll5144 761 aa) of Bradyrhizobium japonicum (GK0361 and
FT                   GK0362 are divided by frame shift)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0361"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74646"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L334"
FT                   /protein_id="BAD74646.1"
FT                   /translation="MIRIAYVSTYPPRRCGLATFTEHLRQSIDGVRGPSDGDRVIVLYN
FT                   ESDGDDAYRHNPAYWPLPAQNRAAYAEMAKRVNESDIDVVLLQHEFGIFGGEAGEYILD
FT                   FIAALNKPLVTTFHTVFADPPLPYRPIQEKIAAASDAIIVMNRQAIPYLVKAFGLPEEK
FT                   IVYIPHGAPGPSSENRDSLRRRLGFSGRKVMLTFGLLSRGKGIESVLAALPGVVRKVPE
FT                   ALYVIAGQTHPEVKKREGEAYREELKSLIHRLGLELHVYMEDRYFSEEELIDYLTACDL
FT                   YVTPYPGMQQITSGTLAYAVGVGRPVVSTPYEHARDLLQGCEELLLPYGDTTAWEERLG
FT                   QLLADEAALKRWEEKVRQIGANTHWPRVGEQHVALFARMCDAKRGEVKTIGTVSH"
FT   CDS_pept        402369..403484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0362"
FT                   /locus_tag="GK0362"
FT                   /product="hypothetical conserved protein"
FT                   /note="similar to C-terminal region of hypothetical protein
FT                   (bll5144 761 aa) of Bradyrhizobium japonicum (GK0361 and
FT                   GK0362 are divided by frame shift)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0362"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74647"
FT                   /db_xref="GOA:Q5L333"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L333"
FT                   /protein_id="BAD74647.1"
FT                   /translation="MAPSVIKFDHLERMTDDTGLLEHSLGRIPRRREGYSTDDNARAIW
FT                   ACLEWMALCEDKGEKERLHRLLDRYLAFLLWAQNDDGTFHNNFFFDRTKEEETPSDDCF
FT                   GRSFWATALAYVRLSDPARREAAADMLRRAMPAAWELRSLRGVAWGVATCGVLLTEGRP
FT                   LGVDQEEVAALAARLEQRLLAAYWEHAGDDWYWYEPELTYANGVLPWALWTAYRRAPRD
FT                   EVKEVAEKSLAFLIEKMSGPGGVIRPVGNRGWCSRRYRADWDQQPLDVMKLALAAREAY
FT                   WATDDERYRGVVRRCLAWFYGQNDGNAPLADPSDGSCCDGLGPNGPNPNRGAESTLSYL
FT                   LTAAIAQSISVEVVVDEYVNNETVRMAGTRV"
FT   CDS_pept        403435..404844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0363"
FT                   /locus_tag="GK0363"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:GK0363"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74648"
FT                   /db_xref="GOA:Q5L332"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L332"
FT                   /protein_id="BAD74648.1"
FT                   /translation="MNTSTTKPFAWPAHVFKEYDIRGRAGEELDESFAYWLGRAFADMM
FT                   QKEGEKRAVVGHDNRLSSPGLHRALKDGLLDGGCDVVDIGLSTTPMFYYSLYYTNIPCG
FT                   MIITASHNPGDENGFKIAMGKTTIYGERIQALRRAMERLSQEQPRPETARGREETLDLA
FT                   PAYIKMLKEKIQLGPRKLKVVVDCGNGTPSIIAPQVLKEWGCDVVPLYCESDPTFPNHH
FT                   PDPVVPENLTALIEMVRKEQADLGIAFDGDGDRIGVVDETGAIRWGDQLMVLFWREILK
FT                   RYPGADAPVEVKCSQALVEEIERLGGKPFFHRTGHSHVKATLRRRPEIPFAGEMSGHLF
FT                   FNDEFYGYDDALYAAGRLLRLLSHDERPLSEWFADVPRYAATPETRVACPEEKKPAAIA
FT                   AVKNQFAGRYPVVDVDGARIQFPEGWGLVRPSNTQPILVLRAEAKTEEALAEIKRQLAD
FT                   CLHALELCIDW"
FT   CDS_pept        405063..406712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0364"
FT                   /locus_tag="GK0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0364"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74649"
FT                   /db_xref="GOA:Q5L331"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR018771"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L331"
FT                   /protein_id="BAD74649.1"
FT                   /translation="MIRESLQYIQDAYAALTELSMLIVDDHGAPVTKVSNMTELAELVL
FT                   FAAEREAPSFFCPRELVIDGWQRPSVVPVGRFGMKSIVAPVFVDEKAEYWIWAGVFIEE
FT                   ETKWLICEQPLAAGGKWVSAIERSVALPARAVEAKLKDIEKMAVICGELISGERRKQQC
FT                   CEYGKRLEAVVTDSSALADVDKLLFELRAFDERVDMALYIAKCPQGWMVAAASGEKAGK
FT                   LRGKMIDALFPPLSSSKPPLRSVYVQDAALDPRFSFFVRHGIRPKAMIAYPAMYGKTME
FT                   GWVMIGSEAASSLPAALRSVGSALVQHWLLLAKCTEADMKMDRHLMRLSMLMEIGRAMR
FT                   MVQNEEEIIRMMAEFAAELAYGDFVCVVWSSDGQTAVVHEGAMDVEMAVRYRDDVCRRY
FT                   GCHGEKAKSEVPALLDVEGKSVMEVPFFVGDGRYGVLAVHIKKGREAKEAEVYMTALAA
FT                   IGAMMISGKAHGGNDGTVNIDMLSEQLTAREMDVLELLIQGCSNREISERLFISVHTVK
FT                   NHITNIFQKIGVNDRSQLIALVYQLNHRRQRR"
FT   CDS_pept        406956..407528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0365"
FT                   /locus_tag="GK0365"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0365"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74650"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L330"
FT                   /protein_id="BAD74650.1"
FT                   /translation="MKPKAMIRTMAIVKTADILKAMDITEELAKRMGFLPRDCLFLRLA
FT                   TEEACTNAYEYCQKTRKLPFRIFWKIDARQFMIIVKQRGGCFSVAQTDVVNTGPRGRGL
FT                   QLITHIVDDVYVKQAGNNVLFCMCKCKKKSDYWRKQDGDKTRGNLHAYMGRRYYLKQCR
FT                   IVPSSAGKVAGQTGGSIDRQHGGGQIH"
FT   CDS_pept        407377..407709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0366"
FT                   /locus_tag="GK0366"
FT                   /product="anti-sigma factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:GK0366"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74651"
FT                   /db_xref="GOA:Q5L329"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L329"
FT                   /protein_id="BAD74651.1"
FT                   /translation="METKQGAICTLTWAEDITLNNVESFRQALEKLLDKQADQLIVNME
FT                   GVKYINSAGLGVIADSVMAARARQKELVIAGVEGSLAEIFHIVKFSSFIKLFATEKEAM
FT                   DYFSGE"
FT   CDS_pept        407719..409242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0367"
FT                   /locus_tag="GK0367"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0367"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74652"
FT                   /db_xref="GOA:Q5L328"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L328"
FT                   /protein_id="BAD74652.1"
FT                   /translation="MDGFWEHVQRYDHLAWRELLLGLEKMNVFVGPGDYVYWLAAPEQR
FT                   RLLFISSSCEQLYGLPPDDFYRDQDIWAKVSYPDDRAKAERKWSLLLGADAGAQTYRII
FT                   NQRDGSVRWVLERTFPVLGQFGEVRLVSGVVADLTEAKRNENERQLAEQVYKAMEQAML
FT                   VTDGQFVVQFVNPAFTKITGHGVEIVGQPLHTLYAGYYEAWLYEVIQAGTGESGEWRGW
FT                   VRWRRKNGSVYVRQTTVRAVPGHDGGIAFYLFLFAGPTYENPYIAAMKDDLRLAREVQK
FT                   RVLSKPLSAKGIQIAGTYIPSRELGGDMYAWYPIDKQRYGIFLMDVMGHGAAASLICMS
FT                   VRSLLNGVIRKGIVPTEVFRELNRHMRQLYHENGRMTYYFTAVYVLVDVKERMIEYASA
FT                   GHPPGFLFQPDGTVAELDRGCAPIGLLPRLFVDSGRLRYEPGATLVLYSDGAIEGGAGS
FT                   VRQKIEAFRDALTPHILLDEQVLLDHLRRHFAQKGPLPDDFSAVVAKLG"
FT   CDS_pept        409529..409942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0368"
FT                   /locus_tag="GK0368"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0368"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74653"
FT                   /db_xref="GOA:Q5L327"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L327"
FT                   /protein_id="BAD74653.1"
FT                   /translation="MAVTNPAGFWKRLLANLLDAIVVGIPISIIGYFITGSWETNWFTS
FT                   LANILYALIVPAVWYGYTVGKRMLGIRIAKVNGGKVGVGTMFLRSFVGGLVYFITFGIG
FT                   LIISAIMVAAREDKRSIHDFIAGTYVTTEKPTV"
FT   CDS_pept        410600..411853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0369"
FT                   /locus_tag="GK0369"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0369"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74654"
FT                   /db_xref="GOA:Q5L326"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L326"
FT                   /protein_id="BAD74654.1"
FT                   /translation="MSLSSYIIRTMFVVIPGTAAIGMATCLVNGIRGAAFWWTLVATVL
FT                   FGAMLGFVSATLNYRRFVAPIAVINEHLGKMTGGDLTVRIPLDRVQQLRPIAASLNDMA
FT                   NAWQSVMGQVQHHAEEVAQYSQQLAAVAEQTTKATEQIATTMETLAASAEEQADAVRTT
FT                   AASVHDISQTLSDVAFHTKEVAHQAEKTSAKAEDGKQSIGQMSKQMQFIYDHVQTLGQV
FT                   VKGLGERSNEIGQITEAITGIASQTNLLALNAAIEAARAGEQGKGFAVVADEVRKLAEQ
FT                   SARSAQQISELIGYIQEETKRAVASAEQVIAEVAKGLNVAAACGQSFAHIREEVGQVSK
FT                   QIGQVSSAIEQMTEHARQVNDALQQMTNIVEQSASGAANVSAATQEQMASVEEIASSST
FT                   SLGQMADEMRAMLKKFSV"
FT   CDS_pept        412274..413962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0370"
FT                   /locus_tag="GK0370"
FT                   /product="thiamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0370"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74655"
FT                   /db_xref="GOA:Q5L325"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L325"
FT                   /protein_id="BAD74655.1"
FT                   /translation="MENIRSFMSFPESRKVYIEGSRPDVRVPMREIALSPTKTPQGMVE
FT                   NKPVRVYDTTGPYTDPDFEPDVEKGLPPLRRRWIVERGDVEEMERSSVAIQRSLPFVRR
FT                   PLRAKPGKTVTQMHYAKRGIITPEMEFVAIREQIDPEIVRQEVAAGRAIIPANINHPES
FT                   EPMIIGRRFHVKINANIGNSAVSSSIEDEVEKLLWAVRWGADTVMDLSTGKHIHETREY
FT                   IIRNSPVPVGTVPIYQALEKVGGVPEKLTWDVYRETLIEQAEQGVDYMTIHAGVRLHYI
FT                   PLTANRTTGIVSRGGSIIAQWCLAHHEENFLYTHFEEICEILKQYDVAISLGDGLRPGS
FT                   IADANDEAQFAELKTLGELTKIAWKHDVQVMIEGPGHIPMHKIRENVEREQEICHGAPF
FT                   YTLGPLVTDIAPGYDHITSAIGAAIIGAYGTAMLCYVTPKEHLGLPNKEDVRAGVVAYK
FT                   IAAHAADLAKGHPAAQQRDDALSKARFEFRWNDQFNLSLDPERAREYHDETLPAEAAKT
FT                   AHFCSMCGPKFCSMNISHELQRKIKEEGMKEKAQQFIRQGSSLYQ"
FT   CDS_pept        414192..415310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0371"
FT                   /locus_tag="GK0371"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0371"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74656"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L324"
FT                   /protein_id="BAD74656.1"
FT                   /translation="MDMTLTAKIKIYPTAEQAEVLKATLSAYRQACNAVSVVIFDTKVL
FT                   AQAKLHDMTYRLLRSNYALRSQMAQSVIKTVIARYRSLKSNGHEWTLVRFKKPEYDLVW
FT                   NRDYSIVQGLFSVNTLEGRIKVSFEPKGMEPYFDGSWTFGTAKLVYKHNKFFLHIPMTK
FT                   TIPTVDEHNIRQVVGVDVGVNFLAVAYDSQGKTIFFNGRKIKHMRAKYKRMRKTLQQKG
FT                   TASARRKLKTIGQRENRWMTDVNHAVTKALVRQYGERTLFVLEDLTGIREKTERVRIHD
FT                   RYETVSWAFYQFRQMLEYKARLHGSKVIVVAPHYTSLTCPKCGHTEKANRKKRTHTFCC
FT                   RTCGYTSNDDRIGAMNLQRKGIEYIVEGTTQA"
FT   CDS_pept        415915..417099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0372"
FT                   /locus_tag="GK0372"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:GK0372"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74657"
FT                   /db_xref="GOA:Q5L323"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L323"
FT                   /protein_id="BAD74657.1"
FT                   /translation="MGLNTFSDIVQTMPPYLFSRFQKKKEELLKLGVDVIDLGIGAPDL
FT                   PPPSFVIEELKEALDAPEHYTYSPYGGCREYREAVARFYEREYGVKLDPETEVLALIGS
FT                   KEGIVHLLQAVLNPGELALVPDPGYPVYRTAVHFARGQSLSLPLDAQHGYIPRFDALPS
FT                   SVYDQAKIMFLNYPSNPTAAAVDLDVFAEAVSLARQHQMFIAHDAAYSFVTFAGFQAPS
FT                   ILQVDGAKEVAVEFGSLSKSYNMAGCRIGYVVGNRDMIRALSVIKSNTDTCQFIPIQKA
FT                   AVAALTNGRTFIRENSRIYEQRMNMMVERLRELGIDVQRPKATFFLWIPVYDGYSSERF
FT                   AAKLLEEAGVIVTPGTAFGSAGEGYVRVSLSAPMERLQQAVERWKQVDWEESAR"
FT   CDS_pept        417096..418751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0373"
FT                   /locus_tag="GK0373"
FT                   /product="acetolactate synthaselarge subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:GK0373"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74658"
FT                   /db_xref="GOA:Q5L322"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L322"
FT                   /protein_id="BAD74658.1"
FT                   /translation="MKRTMRHITVAQAIVECFKQEQIRYVFGVPGESYLPLLDAIYDEP
FT                   SIEFISARHEGGASFMAEGYAKASRKCGVVLATRAVGGANLTIGVHTARQDSTPMVVFL
FT                   GQVNSRFLGREGFQEVDMEAFFRPIAKWVVEIREAERVPELVQRAFRTAKTGRPGPVVV
FT                   SLPEDVFSKTITEAVMAETYVPKPAPRQEDIRNIKERLERAKRPLVIAGGGVKWSGAEQ
FT                   LLRLWAEKYALPVMAAFRRHDVFPHNHPCYVGHLGLGTPKEVMETAEQADVVIALGTRL
FT                   SEVTTQDYRLLSPTQTLIHIDIDSDGLGKVYAPDIAVWADCREALSRLLDIAVQPSWQE
FT                   WAAERRERYEQTAALPLEKRTLHEAVMASLGHHLPKNAVITNDAGNFAGWLHAFFPFGD
FT                   GHTYIGPTSGAMGYGMPAAIGAKLAFPDRTVVSLSGDGGFMMTVQELETAARYDIPIIS
FT                   IVFNNHMYGTIRMHQELQFPGRVIGTDLGRVSFARLAECLNSCGFQVQTEQQFTEALLL
FT                   ALEAKKPTVIEVLTDPNHISVAATIQDLRAKRKS"
FT   CDS_pept        418822..420303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0374"
FT                   /locus_tag="GK0374"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0374"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74659"
FT                   /db_xref="GOA:Q5L321"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L321"
FT                   /protein_id="BAD74659.1"
FT                   /translation="MKIQNYINGEWKEPSTGQFAPVINPATGETIAEVAMSGPNDIDEA
FT                   VQAAKEAQKQWALVPAPKRAEILYKVGMLLKERKEQLARMLTMEMGKVIEEARGEVQEG
FT                   IDMAFYMAGEGRRLFGDTTPSELKDKFAMSVRVPVGVVGIITPWNFPIAIATWKSFPAI
FT                   VAGNAVVWKPAPETPIMAQELARIFEEAGLPPGVFHVVHGDGPTVGNALVEHPDVKVIS
FT                   FTGSNEVGRMIAEKCGRLLKKVSLEMGGKNAVIVMDDADLTLAVDGIIWSAFGTSGQRC
FT                   TACSRVIVHERVKQELERRLLEAVKTLKIGNGLDETVKVGPVIHEEALQKIDRYVRIGV
FT                   EEGAKLLVGGYILREGDYARGFYYAPTIFTDVTPNMRIAREEIFGPVVSIISVRSLDEA
FT                   IAVNNSVDYGLSSAIFTRDVNNVFRAMRDLDTGIVYVNAGTTGAEIHLPFGGTKGTGNG
FT                   HRDSGVAALDVFTEWRSIYVDFSGKLQRAQIDTDD"
FT   CDS_pept        420461..421618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0375"
FT                   /locus_tag="GK0375"
FT                   /product="L-lysine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0375"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74660"
FT                   /db_xref="GOA:Q5L320"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L320"
FT                   /protein_id="BAD74660.1"
FT                   /translation="MKVLVLGAGLMGKEAARDLVQSQDVEAVTLADVDLAKAEQTVRQL
FT                   HSKKLAAVRVDASDKQQLSAFMKGHDVVVNALFYQFNETVAKTAIAAGVHSVDLGGHIG
FT                   HITDRVLELHEQAQAAGVTIIPDLGVAPGMINILSGYGASQLDEVESILLYVGGIPVRP
FT                   EPPLEYNHVFSLEGLLDHYTDPALIIRNGQKQEVPSLSEVEPIYFDRFGPLEAFHTSGG
FT                   TSTLSRSFPNLKRLEYKTIRYRGHAEKCKLLVDLNLTRNDVEVEINGCRVKPRDVLLSV
FT                   LKPLLDLKGKDDVVLLRVIVGGRKDGKETVLEYETVTFNDRENKVTAMARTTAYTISAV
FT                   AQLIGRGVITKRGVYPPEQIVPGDVYMDEMKKRGVVINEKKTVRL"
FT   CDS_pept        complement(421731..422906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0376"
FT                   /locus_tag="GK0376"
FT                   /product="multidrug-efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GK0376"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74661"
FT                   /db_xref="GOA:Q5L319"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L319"
FT                   /protein_id="BAD74661.1"
FT                   /translation="MKQKKRTYSLHITGYPESSGDIFFCFVRRFFVVDPILPVIAESIG
FT                   ATHWQVEMLFTAYIFTMAVMMIPVGLVVSRVGDKQMMVIGLGLVTIFSLLCGFAADIPQ
FT                   LSIFRAGWGLGNATFFATAMTLLIALTPQASTAVGLYEAAIGLGMAGGPLIGGLLGQHS
FT                   WRYPFIGTSVLIFIAFLLVAFFVYDPNKGKPKKAVGWQEMRHLLAFPPFLKGAIGGMLY
FT                   YYGFFVVLAYSPLVMKLSAIQIGLVFFGWGLCLAYGSAALAHRLEAKYESKQILPYSLL
FT                   LFAVLLLLLAVAEQTWFMIVLIILSGLVSGLNNALFTGYVMETSPYERGVTSGMYNFVR
FT                   WMGSAIAPVLSGVIGHAVSAKAPFMIAMALSLVAFLFLAWRKREPSATKTV"
FT   CDS_pept        complement(422881..423357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0377"
FT                   /locus_tag="GK0377"
FT                   /product="carbon monoxide dehydrogenase small subunit"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:GK0377"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74662"
FT                   /db_xref="GOA:Q5L318"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L318"
FT                   /protein_id="BAD74662.1"
FT                   /translation="MEETTKRELVLHVNGERRSIVTRQAETLLFVLRDGLGLTGAKPGC
FT                   LNGDCGACTVLVDGTPIKSCMMLAIETVGKEITTIEGLDDAPIQHAFVRHFAFQCGYCT
FT                   PGFIMNAHALIERHPGADQATIQEWLESNICRCTSYQEIEAAVKEALEAKKADI"
FT   CDS_pept        complement(423379..424221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0378"
FT                   /locus_tag="GK0378"
FT                   /product="carbon monoxide dehydrogenase middle subunit"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:GK0378"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74663"
FT                   /db_xref="GOA:Q5L317"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L317"
FT                   /protein_id="BAD74663.1"
FT                   /translation="MVPFDFAYYRPQSIAEATALFAALERDGKRPLYYGGGTEIITLSR
FT                   LNLVRTAAVIDIKSIPECRSLDVDNGSLVLGAALSLGELEEANPFPLLTKAAREVADRT
FT                   ARNQITLGGNICGQIFYRETALPLFVAEADVIIAGPYGIRQCRFLDLFHQQLQLGRGEF
FT                   VVQFKVDRATATLPHFHRKRRKQGEVGYPLVTIAALKKDGTVRVALSGICPFPFRSADV
FT                   EAHLNDRNRPVGERIQAAVDAFPRPILHDIEGSADYRLFVAAQLLEDMLRELGDGETV"
FT   CDS_pept        complement(424208..426535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0379"
FT                   /locus_tag="GK0379"
FT                   /product="carbon monoxide dehydrogenase large subunit"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:GK0379"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74664"
FT                   /db_xref="GOA:Q5L316"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L316"
FT                   /protein_id="BAD74664.1"
FT                   /translation="MAIGKSIIRKEAWDKVTGRAKYTNDFKEQGMLHAALVTSPYAHAR
FT                   ILSLDARRALAVHGVHAVVTGEGLPLTGEDMRDRPPIAVDKVRYYGEVVAVVVADTLAQ
FT                   AEQAARLVRVVYEPLPAVGSPREALKEGAPLLHEHLDRYEKNKTTHPEPGTNVAHRTKI
FT                   RKGNIEQGFAESDVIVETSVSFAPSDHIAMETRCATAEIWPDGTIHISASSQSPFMIKK
FT                   LLHTYFGEETGKVIVHTPLVGGAYGGKAPVQLELLAYLASKAVGGRKVSVWNSREHDMV
FT                   TSPVHIGLEATVKIGATKEGLLKAMEILFLFDGGAYSDKAIDVSRAAAVDCTGPYHVEN
FT                   VFCDSLCVYTNRPYATPFRSFGHCEQAFAVERAIDELARTLQLDPWDVRRKNAIRPGHT
FT                   TPTQVRLTKSNVGNISACLDRLRELMRWDEWQRVEVDAYTVRAKGISSGWKTSTIDTDA
FT                   SSGVILTFNSDGSVNVISGVVEIGTGTKTVLAQIVAERLKMDVDCVHVKMDIDTQTTPE
FT                   HWKTVASRGTFMAGRAALAAADDAIRQLKDIAACVLRASPDDLEVGFGRVFLRDDPAIF
FT                   LPIKDIAYGYKFPNGNAIGGQVIGRGHYILRHLTPLDPETGAGKPGPEWGVCAEGVEIE
FT                   FNRRDYTYRIVKAYAVIDAGKVLNPKAALGQAMGAMSMGLSFASREGFLFDNEQRVLNP
FT                   QLRTYRPIRFGEHPEYIVEFVETPQIDAPYGARGIGEHGLIGMPAALANALSLAAGVPL
FT                   NELPLVPELIWRTQKGDSYGSV"
FT   CDS_pept        complement(426522..427160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0380"
FT                   /locus_tag="GK0380"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0380"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74665"
FT                   /db_xref="InterPro:IPR017615"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L315"
FT                   /protein_id="BAD74665.1"
FT                   /translation="MKDITIAAIYLAAGQSRRMGADKRALPWGDGTLGTAGLKAALRSR
FT                   LSPVIVVVPPDDALAWLPDELRNHENCRFTRCADHCRGQAHSLACGLRESLASGADAAV
FT                   VLLADQPFVTADVINALTDLYRRHRPDYVAFTRFGTPMPPVIFGKQTFPALLALRGDAG
FT                   GRTLFHHPRWRGLLYEGDETIGIDIDTIDDYKRAVMDREEKEGRHRGHR"
FT   CDS_pept        complement(427157..428185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0381"
FT                   /locus_tag="GK0381"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0381"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74666"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L314"
FT                   /protein_id="BAD74666.1"
FT                   /translation="MESYHAVLEAIAAAPGDGVLAIIISVEGSAYQKEGTCMWIGANGE
FT                   TVGLLSGGCLEEAAAAYAREVLANRQAAAVSFDLRTEDDWSWGQGAGCNGLVHIWLEPV
FT                   TSDAKLDWLALKRCLDRGEHVLMVRSIMYPDERPFFQSETGEQFGGCRRTPHREWREWL
FT                   HKTPFYQGRSGLYEVDGETFYVQHFWPKPRLVVFGAGPDAPPLVSAAKAAGFSVTVSDW
FT                   RPAFCHPSHVSDADEWVVGFPHETVPMLHLNERDFVIVMTHQFERDRELVSLLADKPLA
FT                   YLGVLGPRRRTDRLFPSGSAPPFVRSPVGLSIGARSPHEIAISITAELISVLRRHGAEA
FT                   AQ"
FT   CDS_pept        complement(428395..428574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0382"
FT                   /locus_tag="GK0382"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0382"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74667"
FT                   /db_xref="GOA:Q5L313"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L313"
FT                   /protein_id="BAD74667.1"
FT                   /translation="MAKKKSFPLRIDYDLYAILEQWAQDEFRSVNAQIEYLLREAAKRA
FT                   GRLGKGKTDQQQGS"
FT   CDS_pept        complement(428590..429435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0383"
FT                   /locus_tag="GK0383"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0383"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74668"
FT                   /db_xref="GOA:Q5L312"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L312"
FT                   /protein_id="BAD74668.1"
FT                   /translation="MREQKAWRIDGFIGIGCVALFVLAGFVSLIQAQLLLAVFCFALAA
FT                   FLATGITIVQPNQAKVIIFFGRYFGTIRDSGLFFTVPLTVRKKVSLRVRNFTSKKLKVN
FT                   DVQGNPIEIAAVVVFRVIDSAKAVFDVDDYEQFVEIQSEAAIRHVATKYPYDTFEDDNE
FT                   ITLRGNADVISDELAQELQERLRIAGVDVMEARLTHLAYSPEIAGAMLQRQQAAAILAA
FT                   RKKIVEGAVSMARMAIEQLDKENVLELDDERKAAMVNNLMVAIVSERAAQPVINTGSLY
FT                   "
FT   CDS_pept        429708..430154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0384"
FT                   /locus_tag="GK0384"
FT                   /product="transcriptional activator of the histidine
FT                   utilization operon"
FT                   /db_xref="EnsemblGenomes-Gn:GK0384"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74669"
FT                   /db_xref="GOA:Q5L311"
FT                   /db_xref="InterPro:IPR015111"
FT                   /db_xref="InterPro:IPR023552"
FT                   /db_xref="InterPro:IPR036482"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L311"
FT                   /protein_id="BAD74669.1"
FT                   /translation="MEPRQARIGRLALLLAMLDEGEEEAALGQLEALAWRYCQGRVGAM
FT                   EPQKIVAAIETAAKRHGVVDGGLYREMHALYHAILEAVHGVTRGQVELGDLLRTAGLRF
FT                   AVVRGMPYEQPNEGEWIAVALYGTIGAPVRGLEHEAAGLGINHI"
FT   CDS_pept        430274..431788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0385"
FT                   /locus_tag="GK0385"
FT                   /product="histidine ammonia-lyase (histidase)"
FT                   /EC_number="4.3.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:GK0385"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74670"
FT                   /db_xref="GOA:Q5L310"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L310"
FT                   /protein_id="BAD74670.1"
FT                   /translation="MIVLTGHTLTIDEVRRVVYERERVAADEESMRAVEKSRAAVEQAI
FT                   SNGRTIYGVNTGFGKLADVRIEGSDLEQLQINLLRSHACAVGEPFAEDVVRAMLLLRAN
FT                   ALLKGYSGVRPAVIEQLLAFLNTGIHPIVPQQGSLGASGDLAPLAHLALAFAGEGEAMY
FT                   QGRRMPAAQALSQAGISPLSLQEKEGLALINGTQVMTAVGALAYLEAEQLAYDSEWIAA
FT                   LTIEALYGIVDAFDARIHAARGFQEQVEVAERLRRYLAGSQLTTRQGERRVQDAYSIRC
FT                   LPQVHGASLRALRYVKETLEIEMNAATDNPLIFADGTALSGGNFHGQPVAIAMDLLKIA
FT                   VAELANISERRIERLVNPQLSEGLPPFLSPQPGLQSGAMIMQYVAASLVSENKTLAHPA
FT                   SVDSIPSSANQEDHVSMGTTAARHAYMIVQNARKVLAIELICALQAVEARGIERMAPST
FT                   RQFYHKARRIVSSITADRVFSDDIEAVAAWLSERANHHFLRDEAKA"
FT   CDS_pept        432162..432860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0386"
FT                   /locus_tag="GK0386"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0386"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74671"
FT                   /db_xref="GOA:Q5L309"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L309"
FT                   /protein_id="BAD74671.1"
FT                   /translation="MGISLTISAAALLALWKIIAIDIILSGDNAVVIAMATRRLPKDQR
FT                   NKAIFWGTAGAVLLRILFAAIIVFLLNIPFVHFVGGLLLVWIAYKVLVEREEEANVQSS
FT                   DRLLKAIATIIIADAVMSLDNVVAVAGAAEGHLGMLALGVAISIPIMIFGSKAIVRVME
FT                   QHRWIAYVGSGILAWTAGKMMAGDEGVLHWFHLSYGPFVYAVAAGVAILVVSAGYITNK
FT                   KAEREEGTLI"
FT   CDS_pept        432857..433816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0387"
FT                   /locus_tag="GK0387"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0387"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74672"
FT                   /db_xref="GOA:Q5L308"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L308"
FT                   /protein_id="BAD74672.1"
FT                   /translation="MSGWGWCDAMNIQRILVTGRLYAELAALLPNKRPDKEFRFVAEEE
FT                   LTANDFAWADAYVGFRPAGPFSLANLRWVHSLGAGVDAFLWKREWKKNVLLTRTIGSFG
FT                   EQIAEYCLSYLLRDAQCHDVYAWYQEQRQWKPLAPKRLGEQRIVIYGTGEIGRRIAETL
FT                   RLFGVSPIGVSRSGRDTPPFSAVCRHEEAGEALACADWVIAALPLTEETHHLFDETFFA
FT                   CLHNAGFINVGRGATVDETALIGALENRNVRLAVLDVFEEEPLPPHSPLWVHPNVIITP
FT                   HIAALTSVDAAAHSVLDTLRCIETGEPLANAVDVSRQY"
FT   CDS_pept        434051..434212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0388"
FT                   /locus_tag="GK0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0388"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74673"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L307"
FT                   /protein_id="BAD74673.1"
FT                   /translation="MPTITLRLGRHNPAKSVVWFDRAGQLLRLDGDVVRIENAVRFEHG
FT                   DDVKSFFI"
FT   CDS_pept        434830..435150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0389"
FT                   /locus_tag="GK0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0389"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74674"
FT                   /db_xref="GOA:Q5L306"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L306"
FT                   /protein_id="BAD74674.1"
FT                   /translation="MKLRFSEKSGIFMKVLLLVISWFIILFSLMIQNSDAFIYWFNPSV
FT                   VSINDERYFYTLVPTFLNILLLFFQIKFLGVRERKTTIHKILFVTLIINSILFLYYVIY
FT                   CR"
FT   CDS_pept        435262..436449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0390"
FT                   /locus_tag="GK0390"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0390"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74675"
FT                   /db_xref="GOA:Q5KZ76"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KZ76"
FT                   /protein_id="BAD74675.1"
FT                   /translation="MNKLAHHQGIHKFFFTLGLTLQLSKPVIKHLIHIVDALTTKGFSG
FT                   TLTDIHYWSFHPNHRTTLSHFFTKSPWNEERLLGKLQEWILSQVERLAKRKNQPLFVSI
FT                   DDTICQKTKPSSRAAHAIQGCDWHYSHKDHQSVWGHSLVWLMVHTFTQAFPFAFRLYDK
FT                   KAGKSKIDLAIEMLSSLKVKRAQPVYVLMDSWYPSKKLIEACLKQGFHVIAMLKTNRIL
FT                   YPKGIAIQAKQFARYIESKDTRLVTVGQERYRVYRYEGAIHGLDDAVVLLAWKADQPMA
FT                   PEHLHCILSTDRELGDEDILRYYAQRWTIECFFRQAKDQLKLDGYRVRHIRAVKRYWAV
FT                   VLLACVYSIAESRQNLSTGLELLRSRKDHSVVEFIYDAAKQDIPIDVIKKQLRIA"
FT   CDS_pept        436734..437426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0391"
FT                   /locus_tag="GK0391"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0391"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74676"
FT                   /db_xref="InterPro:IPR024301"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L304"
FT                   /protein_id="BAD74676.1"
FT                   /translation="MDRQYSSLQDSKVSNFDDIVADKYLLDILKETIQYKIDFYSEINK
FT                   KVLGYKLSISNIETKLENGRIVAHILSNTELTFQKDEFEPYTYLEEIEHIIVIENIKDA
FT                   WKITKDIYDELGAPNESAINDLNYNKNFYDMFKKNKIPVKEKAKLSKKLQDSISQYSVD
FT                   ETQNRTSLASTQMFYSTAIESTSLDKAVEYARKWALSYNPEYKKYDNDCTNFVSQILYA
FT                   AGFKTDST"
FT   CDS_pept        437943..438251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0392"
FT                   /locus_tag="GK0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0392"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74677"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L303"
FT                   /protein_id="BAD74677.1"
FT                   /translation="MPLPHFPLGGVRLVKGSLRRIRQEFCSTGSSEQKSQGASCWRNAC
FT                   AMAIRFVHRVGTGGRSASSGMTTGTRPSSALCGRRKLKYATNSVTKKDTEPSSAPNP"
FT   CDS_pept        complement(438585..439307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0393"
FT                   /locus_tag="GK0393"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0393"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74678"
FT                   /db_xref="GOA:Q5L302"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR022823"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L302"
FT                   /protein_id="BAD74678.1"
FT                   /translation="MTRGAIHNRDAFLEHIAHRLGRAPRLSGVSRPQWSNQPQWKVLAG
FT                   YSQDDLLNVLQKQCGLIHTDYIETTSAELAGALRRQVAAYGGGPVIVPDDPRFAEYGLS
FT                   ALLRDEWPAEQTTVHIWNPALGRQNIDAAEQANVGIAFSDITLAESGTVVLFSRNEQGR
FT                   AIHFLPKTYIAIVPKSTVVPRMTQAAAVIHEQIEKGGLVPSCINFITGPSNSADIEMNL
FT                   VVGVHGPMKAAYIVVTDR"
FT   CDS_pept        complement(439304..440734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0394"
FT                   /locus_tag="GK0394"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0394"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74679"
FT                   /db_xref="GOA:Q5L301"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022825"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L301"
FT                   /protein_id="BAD74679.1"
FT                   /translation="MPMKIENGPFWKRVRENLDNDFMRGAVAGMQDRGYVRRLGVIEEL
FT                   GHWEEWRSLAEQIRKHTLENLDFYLMQLSENVAKRGGHVFFAQTAEEANEYIRRVALEK
FT                   QAKKIVKSKSMVTEEINLNPVLEAIGCQVVETDLGEYILQIDDHDPPSHIVGPALHKNK
FT                   EQIRDVFQRKLGYTKSSDPVELARHAREMLRRDYLTADIGITGCNFAIAESGSITLVTN
FT                   EGNADLVTALPKTQITVMGMERIVPTFEEMEVLVSMLTRSAVGQKLTSYITVLTGPRDE
FT                   GDVDGPEEFHLVIVDNGRSSILGTEFQPVLQCIRCAACVNVCPVYRHIGGHSYGSIYSG
FT                   PIGAVLSPLLGGYDDYKELPYASSLCAACTEACPVKIPLHELLIKHRQIIVEREGKAPV
FT                   AEKLAMKAFRLGTASPSLYRFGTKLAPSAFAPFAEDGRITKGPGPLKAWTESREFPAPS
FT                   KERFRDWFQTRQKGGNPS"
FT   CDS_pept        complement(440750..441469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0395"
FT                   /locus_tag="GK0395"
FT                   /product="glycolate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0395"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74680"
FT                   /db_xref="GOA:Q5L300"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR022822"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L300"
FT                   /protein_id="BAD74680.1"
FT                   /translation="MKVSLFVTCLIDLFYTEVGKATVELLERLGCKVDFPEAQTCCGQP
FT                   AYNSGYVKEAKEAMKQMMRAFADADYVVTPSGSCAAMLKEYPHIFHGDPEWEAEAKRLA
FT                   AKTYELTQFLVDVLKVEDVGASLHGRATYHTSCHMTRLLGVKDAPLRLLEHVKGLELVP
FT                   LPNAHQCCGFGGTFSVKMGPISEQMVDEKIGHIEEAEADYLIGADCGCLLNIGGRIARL
FT                   GKPIRVMHIAEVLNARN"
FT   CDS_pept        complement(441586..442311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0396"
FT                   /locus_tag="GK0396"
FT                   /product="transcriptional regulator (GntR family)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0396"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74681"
FT                   /db_xref="GOA:Q5L2Z9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Z9"
FT                   /protein_id="BAD74681.1"
FT                   /translation="MAFKRIKTKKIYEEVAEAIFDMIKNGELKPGDKLDSVQQLAEQFQ
FT                   VGRAAIREALTALKAMGLIELKQGEGTYVREFDPTMMTFPLSIAVLMNKEDIWHLLEVR
FT                   KLLEAGAASLAAAKRTDRDLDAMTEALRQMKEGIGSDELGEKADLAFHMAIAAASQNPM
FT                   LVSIMNSVSGMIVETMRETRRIWLFSKQTTTEKLLAEHQAIFEAIRDQNPDAARTRMLE
FT                   HLTNVENVLRRYIRTQQPD"
FT   CDS_pept        442382..442642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0397"
FT                   /locus_tag="GK0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74682"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Z8"
FT                   /protein_id="BAD74682.1"
FT                   /translation="MIQHHGSRQALFVACGRGRQRFGEANVIPSRMAKCERDGMGRSQH
FT                   RQETSTVPTSRMVIPFSVNIGVGKHNGWKVQKNTKTTIVFC"
FT   CDS_pept        442773..444446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0398"
FT                   /locus_tag="GK0398"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:GK0398"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74683"
FT                   /db_xref="GOA:Q5L2Z7"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Z7"
FT                   /protein_id="BAD74683.1"
FT                   /translation="MWKQDFTPIADQLWLSAIVALIPILYFFWALAVKRMKGHVAGLTT
FT                   LLLAVVLAVIAYRMPAGKAVMSVTQGAVYGLLPIGWIIITSVFLYKLTVKTGHFDIIRN
FT                   SVVSLTEDRRLQALLIAFSFGAFLEGAAGFGAPVAISAALLAGLGFNPLYAAGICLIAN
FT                   TAPVAFGAVGIPIISMEGPTGVPAMEISKMVGRQLPFLSVFIPFYLVLIMAGWKKTMEV
FT                   LPAIIVSGVSFALTQYFTSNFLGPELPDILSSLVSIVALAVFLKYWKPKSTFRFATESE
FT                   VAAAGQVARATQRGGEVFRAWSPFLVLTALISLWGIPQVKAALTGHYEGTNGLLKLVNA
FT                   IGVHLTFMPPVPGLNNQILNPSGQPIAAVYKLELLGAAGTAILLAAVVTKFIIGISWKE
FT                   WARTFVETLNELKFPIITIASVVGFAYIANSSGMSTTLGMALAKTGPLFPFFSPILGWL
FT                   GVFITGSDTSSNLLFGNLQKVTATSIGMDPVLALAANSSGGVVGKMISPQSIAVACAAV
FT                   GLTGKESDLFRFTIKHSVFLIILIGVLVYLQSTVLSWMIP"
FT   CDS_pept        complement(444741..445748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0399"
FT                   /locus_tag="GK0399"
FT                   /product="cell-shape determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0399"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74684"
FT                   /db_xref="GOA:Q5L2Z6"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Z6"
FT                   /protein_id="BAD74684.1"
FT                   /translation="MFASSELGIDLGTMNVRLFSQTKGIVFDEPAAVAYNRHTGKLMAI
FT                   GQQAKQMIGKAPAHIEVTYPLQNGVIADFERAKMLLQQVFKQVGNPLGLAFKKPSVVMS
FT                   VPFHATSVERRSFYEIAQHCGAKHIHFIEEPVAAAIGADLPVSEPVANVVVHLGAGKTE
FT                   AAIISLGGVVACRSLRIGGNRLDEDIIQYVRQRYNLLIGEQTAEQVKIEIGSTPGTSLT
FT                   QGMTIHGRDVVTGFLKAISLDPAEVQHALKESLLQIAEAIRAVLEECPAELSGDIIDHG
FT                   VVLTGGGALLHGIEQWLGAELHVPVHVAPNPSEAVAIGTGKALRAMPKQLSAAL"
FT   CDS_pept        complement(446057..446509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0400"
FT                   /locus_tag="GK0400"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0400"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74685"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Z5"
FT                   /protein_id="BAD74685.1"
FT                   /translation="MKKWYSLLFVSMIVLFSSFFVSTSNSDAAANKARLIIEAKKLIGT
FT                   PYRYGGTTPKGFDCSGFVYYTHKKVGVTLPRTSREMYKKGTYVHKSQLQPGDLVFFDTS
FT                   KQTKGVSHVAIYIGNNQVIHAVSRGVKIDSLNSSYWKTKYIGAKRL"
FT   CDS_pept        447034..449310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0401"
FT                   /locus_tag="GK0401"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0401"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74686"
FT                   /db_xref="GOA:Q5L2Z4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Z4"
FT                   /protein_id="BAD74686.1"
FT                   /translation="MIYIHYAEKQEHREYEEAAKQIAGMIAGDLAAMGHERLDERAEHL
FT                   PAYHMVMAVLERWQHYGRVLSVYTLKKNERGELYFVAAPATDYNWNGRIDGEKEQAVPP
FT                   GAVYRRHFPEIEEAFHGRFAMEQHPTTDEWGRSISAFMPIRQPDGTVDAVVGIDFDAKT
FT                   YEKHLQQGRKQAMWTMMAMFLATAVAYLLALHQQMERKALAVYQKTLASNEHRLRRLAE
FT                   MTMEGLIVYAHGKVVEVNEAACRLLGYSESELIHLPIGELVVDGSMKLNHPHEESERFE
FT                   IELRRKDGTAFPAEIVRRRYDYEGEKVTVAAVRDLTEQKQNEERMRYIANHDELTGLPN
FT                   KEAMYKAVERCLVEAKQHRYEAAVIFLEVSGMKTINDFYGYAVGDEVLLHLAQEWKEKQ
FT                   GMTVGRWSGNEFIALVPNSTHQKAEEMAKQLIEAADEPIVVNGMELYVTVNIGISVYPK
FT                   DGEDAKTLIRKADIARYEARKKAASDFLFFTEPMAIRLNEKMAMERDLRRALENEEFEL
FT                   YYQPQIRLHDRQVIGMEALIRWRHPEKGMVSPSLFIPVAEQTGMIIPINEWVIRTACEQ
FT                   TKQLLDRFPDLSVSINLSPYEFESRRFVDKLARLLADAGLPPHHLDLEITERMTMDTER
FT                   ALDILSKLKGLGVTISMDDFGTGYSSLSYLTDLPIDRLKIDRSFVQHIQGKKDVILPAI
FT                   IRLGHNIGVKVLAEGVETETEAAYLQGKRCDEAQGYYFSPPLPYDELVRFLNGQRVRRQ
FT                   AQELT"
FT   CDS_pept        449312..449683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0402"
FT                   /locus_tag="GK0402"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0402"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74687"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Z3"
FT                   /protein_id="BAD74687.1"
FT                   /translation="MDGFWRIAEEKIREAMKNGEFDNLPGFGKPLEIEDLSRIPEELRL
FT                   GYLLLKNAGYVREEAELRKELLTLEDLLRCCEDDEEKRELEKKWTEKQLRLAELMKKRG
FT                   QTNSKALRDYGRRIEEKFR"
FT   CDS_pept        449777..450430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0403"
FT                   /locus_tag="GK0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0403"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74688"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Z2"
FT                   /protein_id="BAD74688.1"
FT                   /translation="MKERRERGHSLDGRNSKTISRQKRSDEIVKNVWLAFFTALVLTMP
FT                   STVAAAGQSGEAVDVHMPAGHMWKHRALDEQKWMEMVQTYTPEQIGEWKKVLEERKTLR
FT                   QQLDDEKVKRVIKAHCKQMKKEREAALDRLIDQLADKKITKEQFKQELKQLHKKKRWMT
FT                   KEEKQRLHMLHEQTRQAMENNDKEAMAKLLPQWLDHMKKENERLAKWLQEVKEG"
FT   CDS_pept        450659..451300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0404"
FT                   /locus_tag="GK0404"
FT                   /product="siroheme synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0404"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74689"
FT                   /db_xref="GOA:Q5L2Z1"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Z1"
FT                   /protein_id="BAD74689.1"
FT                   /translation="MGYPVILHLRGRRAVVVGGGKVAARKIHGLLEAGAEIVMIAPEAE
FT                   PELQALAAGGMIVWKKKRFDPDDLAEAFLVIAATNDRKVNEAVTQAASSGQLVNVVDDP
FT                   ERCDFHVPAVIRRGPLTIAVSTGGASPAVARRIRRELEEKYGEEYRPYLEFLQRARGIV
FT                   LREVEDAEGRKRLFQALAADSFRQSGRWEEEFTRLLAKEKERNKEGERGR"
FT   CDS_pept        451547..452602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0405"
FT                   /locus_tag="GK0405"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0405"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74690"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Z0"
FT                   /protein_id="BAD74690.1"
FT                   /translation="MPTITLRLELHNPTKVKQGMYERMTEVNTAFANWLLNHPELNQAT
FT                   SKIFKEFSSQRFPSAVVNQTIREVKAQKKKQKAKKFRTFWCCFNNQNVKVEKKGVFYTV
FT                   SFPTLEKRIGVPVVTRSYQEAWLNRLLNGTVKQGAAKLYKKRKKWYLAIAITFDVKPQH
FT                   ETKVMGVDLGLRYIAVASVGTKSWFFKGNQCAFVRRRYAALRRRLGQAKKLQMIRKIGR
FT                   KESRWMKDQNHKISRQIVRFAVANGVGVIRMEALTGIRKRATSAKEAGRSLHAWAFHQL
FT                   QTMIAYKAEMAGIRVEWVNPTYTSQTCKCGHREKANRNGIRFRCQRCGYTLHADLNGAI
FT                   NIAKAISGFAS"
FT   CDS_pept        452783..453397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0406"
FT                   /locus_tag="GK0406"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0406"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74691"
FT                   /db_xref="GOA:Q5L2Y9"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Y9"
FT                   /protein_id="BAD74691.1"
FT                   /translation="MCGHATLASAHVLWERGEHRRDEAIAFFTNSGVLTAINNDGWIRL
FT                   DFPNETPVRVESPPAALVGALPAEPLFIGRNRFDYLVEIGSEQEVRRLTPDFRLLQEVD
FT                   ARGIIVTSRSAAEEVDFVSRSFFPALGVPEDPVTGSAHCCLGPYWADKLGKTTLVGYQA
FT                   SARGGIVRVMVAGERVQLEGKAVTVLKGDLAAEAAFGLQPI"
FT   CDS_pept        complement(453580..454233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0407"
FT                   /locus_tag="GK0407"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0407"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74692"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR023841"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Y8"
FT                   /protein_id="BAD74692.1"
FT                   /translation="MNERHVLVVFPHPDDEAFGVSGTIAEHAQNGTPVTYACLTLGEMG
FT                   RNMGVPPFANRETLPHIRKQELEEACRILGIHDLRLLGYRDKTVEFEDEEELADQIAAI
FT                   VAETNPSLVITFYPGYSVHPDHDACGAAVIRALKRWPKEERPTVHCVAFAKNCEQDLGQ
FT                   PDVVRDVSSVIDTKLAAIRAHRSQTEGLMQAASKRGDALAWLKTERFWTYRWDD"
FT   CDS_pept        complement(454247..454594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0408"
FT                   /locus_tag="GK0408"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0408"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74693"
FT                   /db_xref="InterPro:IPR014934"
FT                   /db_xref="InterPro:IPR036492"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Y7"
FT                   /protein_id="BAD74693.1"
FT                   /translation="MQPIDTAAVQEALNRFANRDVYIHLETTNGAYASHHNEGFYSVGA
FT                   YIRNACIRFTRGKITGPGPYRVGLKLDLGWVYAEGLTHWEWTEKGQLLLAGHDDQGKLA
FT                   VALELSNEPFV"
FT   CDS_pept        454760..455527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0409"
FT                   /locus_tag="GK0409"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0409"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74694"
FT                   /db_xref="GOA:Q5L2Y6"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Y6"
FT                   /protein_id="BAD74694.1"
FT                   /translation="MGVQGNGVTILNFDGVYRPQKRLFQFPHEWVDLADVPETNLYCSE
FT                   AALAEIERRLERRRKRGAVLIGSGNYHYVTYLLLKEINEPFTLVLFDRHTDAEGGDDVI
FT                   SCGSWVSYALKHPRLQKVVIVGPTASSHQLRLSPNMTVLPFDDHDEWPKALIEAIPTGS
FT                   IYISIDKDALRREDAVTNWDQGVIPLSQLLACLRLLLFHKKVLGVDICGEYPPSAVDMF
FT                   DPLCREARGKNEQANMAILETYFHYAAPHLRPA"
FT   CDS_pept        455566..455712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0410"
FT                   /locus_tag="GK0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0410"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74695"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Y5"
FT                   /protein_id="BAD74695.1"
FT                   /translation="MAIRKARKTLSLRILAIGPALLPARWPKKPGRPLLEGMSLVVKSR
FT                   SRT"
FT   CDS_pept        complement(455690..455974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0411"
FT                   /locus_tag="GK0411"
FT                   /product="acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0411"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74696"
FT                   /db_xref="GOA:Q5L2Y4"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2Y4"
FT                   /protein_id="BAD74696.1"
FT                   /translation="MKRVHVIVEGRVQGVGFRYFVQHEALKRQLTGWVKNNDDGTVEME
FT                   VQGNESALQLFLDTIEAGTMFAKVARMHIEPRDVRSDEKQFRIMYGSGF"
FT   CDS_pept        complement(456063..456809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0412"
FT                   /locus_tag="GK0412"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0412"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74697"
FT                   /db_xref="GOA:Q5L2Y3"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Y3"
FT                   /protein_id="BAD74697.1"
FT                   /translation="MEAVLYVSHGSRIAAARHEAARFVEQCRRAIDIPIQELCFVELAE
FT                   PDIVTGVDRCVAQGATRVIVVPLLLLSAGHAKHDIPAALDIARRRHPSVDILCGAPFGV
FT                   HEAMIDIMIDRISEQSAPLDGESMILLVGRGSSDPDTKRDMSAIAALLKEKTNVPHVDV
FT                   CFLAAIRPTLDEGLERAHASAYRRVFVVPYLLFTGVLMKTIERRLQGFSVSDKQWHLCS
FT                   YLGDHPRLVLLIQQQVLSLSSVKKGA"
FT   CDS_pept        complement(456820..457596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0413"
FT                   /locus_tag="GK0413"
FT                   /product="uroporphyrin-III C-methyltransferase (urogen III
FT                   methylase)"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:GK0413"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74698"
FT                   /db_xref="GOA:Q5L2Y2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Y2"
FT                   /protein_id="BAD74698.1"
FT                   /translation="MGKVYLVGAGPGDPELITVKGLKCIQQADVILYDRLINEELLSYA
FT                   KPDAELIFCGKLPGFHAMQQETINHALVWHAKKGKTVVRLKGGDPFVFGRGGEEAEALA
FT                   KHGIEFEIVPGITSAIAAAAYAGIPVTHRAFSSSVAFVTGHRRDGSRDEIKWESLAKGI
FT                   DTIAIYMGVHHLPYICGQLMKYGKAPETPAAVIEWGTTTAQRTVTGTLATIAGIAAKEN
FT                   IQNPSMIMIGDVVRLRANIQWFEPLLASSAAAGATS"
FT   CDS_pept        complement(457745..458356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0414"
FT                   /locus_tag="GK0414"
FT                   /product="adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:GK0414"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74699"
FT                   /db_xref="GOA:Q5L2Y1"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Y1"
FT                   /protein_id="BAD74699.1"
FT                   /translation="MSTNIVWHHTSVTKEDRRKRNGHHSAILWFTGLSGSGKSTVANAV
FT                   SRRLFELGIQNYVLDGDNIRHGLNKDLGFSAADRTENIRRIGEVAKLFVDSGQFVLTAF
FT                   ISPFAEDRALVRRLVEEDEFIEIYVNCPLEECEKRDPKGLYQKARRGEIREFTGIDSPY
FT                   EAPEAPELTIETHRYSVDECAEQVLAYLRERGMIPAAKTD"
FT   CDS_pept        complement(458369..459529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0415"
FT                   /locus_tag="GK0415"
FT                   /product="sulfate adenylyltransferase"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:GK0415"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74700"
FT                   /db_xref="GOA:Q5L2Y0"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020792"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2Y0"
FT                   /protein_id="BAD74700.1"
FT                   /translation="MSVSIPHGGTLINRWNPDYPLDEATKTIELSKAELSDLELIGTGA
FT                   YSPLTGFLTKTDYDAVVETMRLSDGTVWSIPITLAVTEEKAKELAVGDKAKLVYRGDVY
FT                   GVIEIADIYRPDKTKEAKLVYKTDELAHPGVRKLFEKPDVYVGGEITLVKRTDKGQFAS
FT                   FYFDPAETRKKFAEFGWNTVVGFQTRNPVHRAHEYIQKCALEIVDGLFLNPLVGETKAD
FT                   DIPADIRMESYQVLLENYYPKDRVFLGVFQAAMRYAGPREAIFHAMVRKNFGCTHFIVG
FT                   RDHAGVGNYYGTYDAQKIFLNFTAEELGITPLFFEHSFYCTKCEGMASTKTCPHDAKYH
FT                   VVLSGTKVREMLRNGQVPPSTFSRPEVAAVLIKGLQERETVAPSAR"
FT   CDS_pept        complement(459803..460510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0416"
FT                   /locus_tag="GK0416"
FT                   /product="phosphoadenylyl-sulfate reductase
FT                   (thioredoxin-dependent)"
FT                   /EC_number="1.8.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:GK0416"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74701"
FT                   /db_xref="GOA:Q5L2X9"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011798"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2X9"
FT                   /protein_id="BAD74701.1"
FT                   /translation="MLTYDQWEKAEKPSFPSDNETKGALDVLAWAYREYGDEIVYACSF
FT                   GIEGIVLIDLISQVKPDAEIVFLDTGLHFPETYDTIAKVKEKYPSLRIVMKQPRLTLEE
FT                   QKAQFGDELWKRDPNKCCELRKVIPLREVLTGVTAWISGLRREQSPTRRHVEYINKDDK
FT                   FRSIKVCPLIHWTWKDVWNYVYKRHLPYNVLHDRGYPSIGCAPCTAPATDPNDLRSGRW
FT                   AGQGKTECGLHLA"
FT   CDS_pept        complement(460532..460708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0417"
FT                   /locus_tag="GK0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0417"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74702"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2X8"
FT                   /protein_id="BAD74702.1"
FT                   /translation="MNSVNLPPIAKCQFQLKKIFSKIRGTLSPALSDSCKEGFSPPNCR
FT                   LAAIYPTNYVDFL"
FT   CDS_pept        complement(460870..461094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0418"
FT                   /locus_tag="GK0418"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0418"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74703"
FT                   /db_xref="InterPro:IPR009507"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2X7"
FT                   /protein_id="BAD74703.1"
FT                   /translation="MDLSKRSAENVAYMIEQLKQKLKVLNLDAIKPSHFSEEWYDELRD
FT                   IYEMVMKRETFSPSEMQAIVEELGSLRKK"
FT   CDS_pept        461432..461932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0419"
FT                   /locus_tag="GK0419"
FT                   /product="protein-tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0419"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74704"
FT                   /db_xref="GOA:Q5L2X6"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2X6"
FT                   /protein_id="BAD74704.1"
FT                   /translation="MAVWMIKVLFVCLGNICRSPMAEAVFRHLVKERGLDGLIAVDSAG
FT                   TGSWHVGEPPHVGTRRVLTENKIDYSGIRARQVNHRDLEEFDYIIAMDAANLNDLRRLA
FT                   GSRSKAVLARLLDFVPDREKDDVPDPYYTGNFAEVYRLVRSGCEHLLERIIRDHRLGVE
FT                   ETK"
FT   CDS_pept        461984..462817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0420"
FT                   /locus_tag="GK0420"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GK0420"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74705"
FT                   /db_xref="GOA:Q5L2X5"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2X5"
FT                   /protein_id="BAD74705.1"
FT                   /translation="MVVNLAFIRELARRFTEDEIPRLSAELAYYFLLSLFPFLLFLMTL
FT                   LAYLPIPHEDVLALVRQYAPKEALHLIETNVYRLMNEQNGGLLSFSIIAAIWSASNGMS
FT                   AIMRAFNRAYDVQEDRPFWIVRGLSIVLTLGMIVVIIVALVLPVFGRIIGLFLFSALGL
FT                   SQQFLEVWNAFRWVTSSLLLFAVFTALYYFAPNKQLRCVNVVRGALFATAGWIAASLAF
FT                   AYYVNNFADYTAMYGSLGGMIVLMVWFYLSGMILVLGGELNAMFDCEREGKRRQR"
FT   CDS_pept        complement(463163..463309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0421"
FT                   /locus_tag="GK0421"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74706"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2X4"
FT                   /protein_id="BAD74706.1"
FT                   /translation="MSRTERKNMIEFIEKVRGLSREELAYMTDAEIEYIYERYYHHHEE
FT                   IVE"
FT   CDS_pept        complement(463434..464567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0422"
FT                   /locus_tag="GK0422"
FT                   /product="multidrug-efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GK0422"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74707"
FT                   /db_xref="GOA:Q5L2X3"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2X3"
FT                   /protein_id="BAD74707.1"
FT                   /translation="MRFAILTGIVAVSGLSQGMLLPLLAMLLDENGVSSSVNGAHAAAL
FT                   YIGVLTISPFLERPLRRYGYRLLILLGGFIVICSLILFPLFPSLFFWLVLRFAIGIGDH
FT                   MLHFATQTWITDFSLPTERGRRLSLYGWAFGLGFTIGPLLASLASVEKALPFYLAALLS
FT                   FAGWIGVFWLPNEKPKPLERSSSAAGRFIGAWKQAWPALLLPFAYGFLEAAVHSIFPLY
FT                   ALRERMSAEQIAFILPCFSLGGIIFQLPLGALSDRFGRREIITGALLAGAGCFLIALTV
FT                   GASTVGLAACLFTAGMFTGSLFSLGIAYMTDLLPKELLPAGNLLCGMLYSLGSMTGPPL
FT                   AGSVVDLSARAFFLAVSAVLLVPAICLVSRREQETAA"
FT   CDS_pept        464714..465766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0423"
FT                   /locus_tag="GK0423"
FT                   /product="H+/Ca2+ exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:GK0423"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74708"
FT                   /db_xref="GOA:Q5L2X2"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2X2"
FT                   /protein_id="BAD74708.1"
FT                   /translation="MNKVFAWMTWIGVPVSVIGGFLHWPTVLMFVLYCLTIIALASYMG
FT                   RATESLAIVAGPRIGGLLNATFGNAVELIISIFALQAGLVDVVLASLTGSVLGNLLLVA
FT                   GLSFFVGGLKYKRQEFNIYDARHNAGLLTFAIFIAFVIPEVFTMHMNHSEQVALSVGIS
FT                   IIMILLYAAALYFRLVTHRGVYQHKSEEVEEHEEPEWGKGKATAILALATVAVAYLSER
FT                   LVHTFETVAESFGWSELFIGIIIVAIVGNAAEHASAVIMAYKNKMNVAVEIAVGSTLQI
FT                   AMFVAPVLVLVSLLFPEKMPLVFSLPELVAMAASVLLMIVLSNDGDTNWFEGATLLAAY
FT                   TIMGIGFYLL"
FT   CDS_pept        465919..466707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0424"
FT                   /locus_tag="GK0424"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0424"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74709"
FT                   /db_xref="InterPro:IPR025548"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2X1"
FT                   /protein_id="BAD74709.1"
FT                   /translation="MKKWAVSLFVSVLLLYAAAFSALAAAGKPAPGAVIDISKENTYPN
FT                   PTQDLPHLEPSSFTKQLLRSANVKIENPELIHLFNESSATDTPWAVGYRATIYLGQWPL
FT                   NYQSIETSTNWEYQKVNTNFLDNRGGDTAQKLYYKQEMQKYVRGGLTVKVPNEDAVKRM
FT                   MLNKAMEKTNLPLSFSTVVGLGTKKDQPYNVPAKKIGYLYAYAPAVNEKGKVTYGEVYV
FT                   VLKGNKKKIVVKNVTTRGVGAWIPVQDRLYMSYVVSEQPR"
FT   CDS_pept        complement(466737..467861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0425"
FT                   /locus_tag="GK0425"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0425"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74710"
FT                   /db_xref="GOA:Q5L2X0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014866"
FT                   /db_xref="InterPro:IPR031004"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2X0"
FT                   /protein_id="BAD74710.1"
FT                   /translation="MRSSTMPAITPAYDPWEAYVDIEEYGKLQLTNIEFTTTTLCNMRC
FT                   EHCAVGYTLTMKDPEALPLDMLLRRLEEIPHLRSLSITGGEPMLSLKSVEQYVVPLLRY
FT                   AHERGVRTQLNSNLTLDLSRYEPVIPYLDVLHISHNWGTIDDFVEGGFAMMERKPTRAQ
FT                   REKYFQRMLDNAKALANAGVMVSAETMLNKRTVRHLETIHRQVVEAMGCRRHEIHPMYP
FT                   SDFASALETLSLDELREAIHHLLDIRDENVWMLFGTLPFYPCSDNEEDVRLLKRLYESK
FT                   NVTVRNDPDGRSRLNVNIFTGDVIVTDFGDEPPLGNIIHDSLPDVYDKWRRSKLARELL
FT                   CHCPSARCLGPNVLVKQTYYRGVDFTKRSARIGR"
FT   CDS_pept        468091..469638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0426"
FT                   /locus_tag="GK0426"
FT                   /product="fumarate hydratase class I (fumarase)"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:GK0426"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74711"
FT                   /db_xref="GOA:Q5L2W9"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2W9"
FT                   /protein_id="BAD74711.1"
FT                   /translation="MEKFQQSMYDLIVETSTKLPKDVRRAIARAKVRENAGTRAAMALD
FT                   TIVENIQMADENVSPICQDTGLPTFKIKVPVGVNQIEMKKAIRAAIVEATKNGKLRPNS
FT                   VDSLTGKNSGDNLGEGVPVIKFEQWENDYIDVRLILKGGGCENKNIQYSLPCELEGLGR
FT                   AGRDLDGIRKCILHAVYQAQGQGCSAGFIGVGIGGDRSSGYELAKEQLFRPVDDVNPIE
FT                   ELRQLEEYIMENANKLGIGTMGFGGESTLLGCKIGVMHRIPASFFVSVAYNCWAFRRMG
FT                   VKIDPATGEIIEWLYQDGEDVDFAKELEKAEAAAALEQGDTRVIDLVPPLSEEQVRQLR
FT                   VGDVVRISGVIYTGRDAIHKYLMDHDAPVDLNGQIIYHCGPVMLKDEEGRWHAKAAGPT
FT                   TSIREEPYQGDIMKKFGVRAVIGKGGMGAKTLQALKEHGGVYLNAIGGAAQYYADCIKS
FT                   VEGVDLLEFGIPEAMWHLRVENFTAVVTMDSHGNSLHEDVEKSSLEKLAQFKEPVFK"
FT   CDS_pept        469797..470612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0427"
FT                   /locus_tag="GK0427"
FT                   /product="nodulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0427"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74712"
FT                   /db_xref="GOA:Q5L2W8"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014235"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2W8"
FT                   /protein_id="BAD74712.1"
FT                   /translation="MAAKEELGMRWLISLVLALSLFPAPAFAISNAPIHWGFKRSENHE
FT                   PPSAGKELDELLAKYDAFYLGDTSEKTIYLTFDNGYENGYTAQILDVLKEKHVPAAFFV
FT                   TGHYLQTAPDLVKRMAAEGHIIGNHSWHHPDLTAASEERFREELEKVKEKTEELTGQKG
FT                   MAYLRPPRGIFSERTLSLARDLGYYHVFWSLAFVDWQTDRQRGWQYAYDQIMKQIHPGA
FT                   ILLLHSVSKDNAEALPKVIDDLRKQGYTFASLDELMVKKMGLHPWLFRP"
FT   CDS_pept        470773..471657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0428"
FT                   /locus_tag="GK0428"
FT                   /product="DNA-3-methyladenine glycosidase II"
FT                   /db_xref="EnsemblGenomes-Gn:GK0428"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74713"
FT                   /db_xref="GOA:Q5L2W7"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2W7"
FT                   /protein_id="BAD74713.1"
FT                   /translation="MRKVRTMWKQTITVPAPYDFAHALERLALDPLLAVDLERQRVTVP
FT                   LHLDDVKVPVVVESIGAKDAPRFIVSGPHPERQQEIIERISHLFQWRTPLASVHGYFQA
FT                   TELAPLFARYEGLPLVLDFDLYFCLVKCLIHQQLHLKVGYRLTERFVKTFGEERDGVWF
FT                   YPRPEEIAARSYEDLRALQLSGRKAEYIVNVSRLIAEGKLRLDEIEQMEDGEVMERLTA
FT                   VRGIGPWTVQNFLLFGLGRPNVFPPADIGLQRAVEKWFGLPKRPTTKEMAALGERWKPY
FT                   ASYAALYLWRSIE"
FT   CDS_pept        471669..473057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0429"
FT                   /locus_tag="GK0429"
FT                   /product="RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0429"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74714"
FT                   /db_xref="GOA:Q5L2W6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2W6"
FT                   /protein_id="BAD74714.1"
FT                   /translation="MAKQQMNIKIKKGEQFPVTIQRIGINGEGVGYFQKQVVFVPGALP
FT                   GEEVIVEATDIHPTYAEAKIKRIRKRSPNRIKPPCPLYDQCGGCQLQHLAYEAQLEAKR
FT                   DIVIQALRRHARRLDVDKLDIRPTIGMDNPWHYRNKSQFQVGMKEGKVLAGLYGLNSHR
FT                   LIDLSECRVQHPQTTRVTNIVKTILQDLHIPIYNERTRMGVVRTIVARVGFHTGDIQLV
FT                   LVTATKDIPRKELLIEEIRRRLPEVKSIVQNINGEKTSLIFGDETEVLAGDEYIQETLG
FT                   DLSFELSARAFFQLNPLQTVKLYDEVKKAAALTGTERIVDAYCGVGTIGLWLARDAKEV
FT                   RGMDTIPEAIEDAQNNAKKHGFTNTHYVVGKAEYWLPKWVKEGWKPDVIIVDPPRVGCD
FT                   RALLETILHVRPKTVVYVSCNPSSLARDLDALAAQYRIDYIQPVDMFPHTAHVEAVAKL
FT                   TLQF"
FT   CDS_pept        473699..474058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0430"
FT                   /locus_tag="GK0430"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0430"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74715"
FT                   /db_xref="GOA:Q5L2W5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2W5"
FT                   /protein_id="BAD74715.1"
FT                   /translation="MAKKIGLFVAGAVALLVLLFHLGPLVGLAITLAVLYYAFKKCLKA
FT                   PSTFGKIVWALIGCAALVVSASNVPALIALVAAYVLYVVYKKWNGVKDERVVPEADDPF
FT                   VNFEKQWAELQKHYS"
FT   CDS_pept        474086..474709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0431"
FT                   /locus_tag="GK0431"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0431"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74716"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2W4"
FT                   /protein_id="BAD74716.1"
FT                   /translation="MSVFSRLKTIIEADLHEWLDEKEKKNPIALLNHYLRQCEQEVERV
FT                   RQLLERQYVLKEQFAREHREAEQMVEKRSKQAEVAAQAGEMELAEFARREQAQYAERAA
FT                   RLKQLLEQASRELFELEAKYEEMKHKLKDMQMRRMELMGRENAARAHYRIHRVVNGDAG
FT                   PALAAFADAEVYLDRLERQVRSDYYRSTIDARIAQLEKQLQEGK"
FT   CDS_pept        474774..475505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0432"
FT                   /locus_tag="GK0432"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0432"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74717"
FT                   /db_xref="GOA:Q5L2W3"
FT                   /db_xref="InterPro:IPR016975"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2W3"
FT                   /protein_id="BAD74717.1"
FT                   /translation="MLDQRKKTDYVSWVVLVTLLLFAIEISFFRPGVLFSLSISVCLIY
FT                   VGRKKWHRRKGKWLFWLGCIMLAIHVLTMMAARFVMVALLGYALWQLFQSKRHPTVIRP
FT                   TMAENSYGGEEIVRRQPLFQNVWVGRQATSERVYEWNDVNIQTGIGDTVIDVSYTVLPK
FT                   GEAVIIVRGLIGNIRILVPYEIETRLVHSAIFGVASLFGKEQEKMFNETLIYQTSSYDQ
FT                   AEQKLKIVTSMIIGNVEVTRV"
FT   CDS_pept        475502..476536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0433"
FT                   /locus_tag="GK0433"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0433"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74718"
FT                   /db_xref="GOA:Q5L2W2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017202"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2W2"
FT                   /protein_id="BAD74718.1"
FT                   /translation="MSRPMLASVLLALALAVALLISFLYFLPPGMWSSLWDQTVMGLPF
FT                   LLFVFAVSLCMGIAVGLMLDSFFRQQWQAVVQALRHIEQGEMGELHREEPPPELQELWR
FT                   QIVKLQAQWRAQTKRVQKLAAEKAEQEERLVERILSEERTRLARELHDSVSQQLFAASM
FT                   MMSAVMETMPPDDERHRKQLKMVEQMIHQSQLEMRALLLHLRPVQLKGKSLQEGMTELL
FT                   TELAGKVPLEMKWNIEDVPLDKGVEDHLFRILQESLSNTLRHAKAKSLEVLLIERDGFA
FT                   ILRVTDDGVGFDVERSKSGSYGLQHMYERAAEIGGMLKIVSLKGQGTRLEVKVPLLHRG
FT                   DDRD"
FT   CDS_pept        476529..477161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0434"
FT                   /locus_tag="GK0434"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GK0434"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74719"
FT                   /db_xref="GOA:Q5L2W1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2W1"
FT                   /protein_id="BAD74719.1"
FT                   /translation="MIRVLLVDDHEMVRLGVSAYLSAQPDMEVIGEAEDGKKGVELALQ
FT                   LRPDVILMDLVMEPMDGIAATREIIGAWPEAKIIVVTSFLDDENVFAALEAGATSYLLK
FT                   TSKASEIADAIRATFHGQSVFEPEVAGKVMRNYRKQEERLPHEQLTSREMEVLLLMAQG
FT                   KTNQEMADELFISLKTVKVHVSNILAKLGVQDRTQAVIYAFRHGLVK"
FT   CDS_pept        complement(477354..477821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0435"
FT                   /locus_tag="GK0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0435"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74720"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2W0"
FT                   /protein_id="BAD74720.1"
FT                   /translation="MEEKTIIQAVLQALEQHSDKISSKMQEMEQRLHHEMQTMEQRLHH
FT                   EMQTMEQRLRSEMQEMGQQLRNEMQEMGQQLRSEMQEMGQQLRAEIHAVETRLEAKIDS
FT                   LREEMQQMNRQLNERIDHLEEELTDTQASVEVLTTKVLHHDRKLRQLTKQA"
FT   CDS_pept        478018..479472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0436"
FT                   /locus_tag="GK0436"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0436"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74721"
FT                   /db_xref="GOA:Q5L2V9"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2V9"
FT                   /protein_id="BAD74721.1"
FT                   /translation="MDAGWKFDNSYARLPERFFSKVLPTPVRAPKLAVLNRSLAVKLGL
FT                   NEEALRSEDGVAVFGGNQIPGGAEPLAQAYAGHQFGYFTMLGDGRAVLLGEHVTPSGER
FT                   VDIQLKGSGRTPYSRGGDGRAALGPMLREYIVSEAMHALGIPTTRSLAVVTTGETIMRE
FT                   TELPGAVLTRVASSHLRVGTFQYAAQWGTIEELRALADYALWRHFPGFEEAENRYLFLL
FT                   EQVIERQAELIAKWQLVGFVHGVMNTDNMTISGETIDYGPCAFMDTYSLETVFSSIDTE
FT                   GRYAYGNQPYIGGWNLARFAESLLPLLDENEEKAIALAQGALDEYPKRYHHHWLSGMRA
FT                   KLGLAEEQEGDQELIADLLRLMEAHRADYTNTFRALTLGEYTGMALFDSAEFREWQERW
FT                   QTRLSQESVSREEAYERMRRHNPAVIPRNHRVEEALAAAVHDGDYSVMERFLEALSDPY
FT                   AYSPEQEKYAELPPPSDRPYRTFCGT"
FT   CDS_pept        479553..479837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0437"
FT                   /locus_tag="GK0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0437"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74722"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2V8"
FT                   /protein_id="BAD74722.1"
FT                   /translation="MKRSVLLFAVVGMLFVCDAVFPSQLAETDKTKEPYASFRQRIIIR
FT                   DSVDQPLSPHVKQAGAMETTSEPQLLPNVDLNHSIVITKMPHIEETRKN"
FT   CDS_pept        479971..480738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0438"
FT                   /locus_tag="GK0438"
FT                   /product="transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:GK0438"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74723"
FT                   /db_xref="GOA:Q5L2V7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2V7"
FT                   /protein_id="BAD74723.1"
FT                   /translation="MEYTVHELAKLAGITSRTLRYYDEIGLLKPARWSEAGYRLYGPRE
FT                   VDRLQQILFYRELGVDLETIKQIIHSPSFDELKALREHRQQLLEKRRHLDALIASVEKT
FT                   IAAKEGGIMMSDKEKFAAFKEQLIEENERKYGEEIRQKYGDEQVDRSNDRLRKMTKAQF
FT                   DEAERLSQDVLEALKEAMQDGNPAGEAAQRAADLHRQWLGLWWDHYSKEAHAGLARLYV
FT                   EDGRFKAYYDQVHPGAAEFFKEAIWIYTGMKDR"
FT   CDS_pept        480988..482694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0439"
FT                   /locus_tag="GK0439"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0439"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74724"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2V6"
FT                   /protein_id="BAD74724.1"
FT                   /translation="METLRQRLRSIDQKGYKAYKAIEGTYRFPTFTLAIDHVQGDPFAE
FT                   PSKVRVIVPRAKTALAAEWTDTKPRRIRCEDLLLRRVHRELRQWPLRARGSGKSGLVLI
FT                   DAPGQKVLERTAVQVADETITVCLSVGLPANGRRILAKEAEAIFFEQIPSVIERAVYGL
FT                   REEDIRPAVELADQQHAIRRYLREHGLVAFVKNGAILPRESGVSDKPLQCEAVPFQSPP
FT                   ELEIAIPIPHCTEPVKGMGIRKGITLIVGGGYHGKSTLLQALEHGVYDHIAGDGREFVI
FT                   TDSGAVKIRAEDGRSVASVDISPLIGALPYGKETTQFSTENASGSTSQAASMIEMIEAG
FT                   ASAFLIDEDTSATNLLIRDGRMQALVAKEAEPITPYIDKARQLFRDYGISTVLVVGGLG
FT                   DYLDIADCVIKMEQYVPFDVTGEAKRIAAEMPSGRKAEGGESFGRIRERIPLPESLNSQ
FT                   KGKKAKAVARGRHVIQYGQTDLLLYALEQLVDDSQTRAIAAALLYMERKGWLDGKKTIR
FT                   QLLDAIEEQWDRQGLGSVSFRKGNPGELARPRRFELAAALNRLRSLRCIQQ"
FT   CDS_pept        482730..483113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0440"
FT                   /locus_tag="GK0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0440"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74725"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2V5"
FT                   /protein_id="BAD74725.1"
FT                   /translation="MATFPCRLDYGVIGEEEWLGFCFSQLQQKIGPQDVRQGRLFSLLA
FT                   NGTTDALVSTGAAVCRYRPRRDRCGAAALVPIDDASCLRQNANESAFCRRLAHFALALS
FT                   TNYGYNNVYQCNVADGGGKPRVG"
FT   CDS_pept        483126..483494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0441"
FT                   /locus_tag="GK0441"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0441"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74726"
FT                   /db_xref="InterPro:IPR018745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2V4"
FT                   /protein_id="BAD74726.1"
FT                   /translation="MNKSKGWMESEISKALTKWEKDFLGRGSVSVKTDILRDMIIVSLH
FT                   GILTPAEYALCESKEGMLAVKRSRTSLVESGVDDLKKMILEITGEKVKSFHTDLSTRTG
FT                   ERIIVFKLFNDLEKQLTK"
FT   CDS_pept        483828..485333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0442"
FT                   /locus_tag="GK0442"
FT                   /product="NADH dehydrogenase (ubiquinone) chain 5"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:GK0442"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74727"
FT                   /db_xref="GOA:Q5L2V3"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2V3"
FT                   /protein_id="BAD74727.1"
FT                   /translation="MGNEWFAWGWLAAIAVVFLSAIVWLFPRVSERYVHVHVWLLLLPG
FT                   TAALFGWIGAGGAVDIGPWRFDATSWLSAVYISLLSWAIQRFAVRYLHGDRRYRLYFSL
FT                   LTWTSFAASLTWAAGDLRLIAVCWGLPLVGLVALTALKKEWEPAQFVAWQMGMLFLASW
FT                   IAVALTAVWLGARVGEWTLVSALSAERLARLALWERAVMSGLLMLAAVIPAGQWPFHRW
FT                   LMESAVTPTPVSAVMHAGLVNAGGLLLWRFSPLFNETWAHVALFLIAFASILIGTGVSF
FT                   VHVDYKRQLVGSTMAQMGVMLVQCALGAYGAAVVHLVLHGLFKATLFLQSGSVVPRVGR
FT                   AGLRKTGSSRPGGIILGVLFGWAFWQAAPHEPARLLSALLLAASATVAWGRLTDFREGR
FT                   WLGFAVVVALALASETVRHQFMALLHNGMPSAFLPPASFEWLVCALFVAAALVAVWIAN
FT                   RRSSMLAIQLYMWLVHLGEPRPAATEAHPRYLASYLKEGMAHE"
FT   CDS_pept        485326..487938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0443"
FT                   /locus_tag="GK0443"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0443"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74728"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2V2"
FT                   /protein_id="BAD74728.1"
FT                   /translation="MSRSVISLERSTEAKKAAACPLEVIVSEAAKVIAPLWPISAFIAR
FT                   HPWMGMEDKSFVDAADRLQEAYGIDLYPPMAVFHAALSKGEIDVSFIERRLQRWLDDEP
FT                   LPAPRHEAERLCRALLWNDAVPEEALQMPKLIELAAAMPLRSVSIRTRSVRLGLEKRLD
FT                   QQMIKWCKLFYDRGEAVWALPHREHGFYGSWRRLAPLDPSLSKEERKRLFDWPHHPEEA
FT                   LQRALEQLGVQDEEAVAYLEAHLLALPGWAGMMVWQSRRAGDEIGGLINYLAVRLSLEW
FT                   VFTAPHLPLKEEENEDDRAVGPLLAAWIHWGGMTLDDWRRLPLEDRQARLVFADRFWRI
FT                   GRRHLWLEAWEDTYEAKLKEAVLTRQPEEPKEQAAAQLLFCIDVRSEPFRRHVEAVGPF
FT                   ETYGCAGFFGLPIQTRVLDSDDAHPSCPAIVAPRHEINETASPETAAPYRRRRDLFRFV
FT                   GRTFKKIKRHLLAGLLLPEMSGPWLGLHTIARSAAPAWAGQAIHQAEMSAQQKPKTTLS
FT                   LDCQGHDETTGLPIGLTKEEQVQYVKQLLVNIGLTSSFAPLVVVCGHESETTNNPYASA
FT                   LDCGACGGAAGAFNARVFAALANLPHVRDGLAKEGIVIPDETVFVAAEHITTVDELRWV
FT                   EVPPLSEAAEAAFRQLKQALAGVSRQANAERMAKLPHVGAMPRDPVAEARRRAVDWSEI
FT                   RPEWGLAGNAAFLIGRRALTKGVHLDGRVFLHSYDWREDPTGEALAGIIAGPATVGQWI
FT                   NLQYYASTVAPNYYGSGDKTTQTVTGGIGVMQGNGSDLLAGLPWQSVAASDREWFHSPL
FT                   RLLVIIEAPFSYIERLLDENSEFRRKVQNGWLRLASIDPDSGAWVNWEAGRLASVQQR"
FT   CDS_pept        488090..488407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0444"
FT                   /locus_tag="GK0444"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0444"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74729"
FT                   /db_xref="InterPro:IPR024617"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2V1"
FT                   /protein_id="BAD74729.1"
FT                   /translation="MKTQFIAGHARLPAGMAAKSLYDTLTITAEIDKKYGVIVEASCTL
FT                   ATEHGRDYVARLLRGHSLRDGIDGLLAELDEGYLGKAHSALCAALKDLYKQYCKMEEKE
FT                   P"
FT   CDS_pept        complement(488492..489688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0445"
FT                   /locus_tag="GK0445"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0445"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74730"
FT                   /db_xref="GOA:Q5L2V0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2V0"
FT                   /protein_id="BAD74730.1"
FT                   /translation="MNFDFTPEQEMLRQTVRKFVDKEIMPYIKEWDERGEFDRNIFKRL
FT                   AELNLMGVCIPEEYGGMGMDYNSLAIVCEELERGDTAFRTAVSVHTGLNSLTLLQWGTE
FT                   EQKQKYLVPQARGEKIGAFGLTEPNAGSDVASIQTTAVRDGDDYILNGQKTWISLADIA
FT                   DHFLVFAYTDKSKKHRGISAFIVERTMPGFSSRPIKGKLGIRSGNTGELFFDNVRVPKE
FT                   NLLGEEGEGFKIAMSALDNGRFTVAAGAVGLIMACLEASVKYCHERKTFGKEIGRHQLV
FT                   QQMIARMEAGLQISRLLVYKVGFLKNEGRRCTRETSLAKWIACDYANQAADDAVQIHGA
FT                   YGYSNEYPVERYLRNSKAPVIYEGTREIHTIMQAEYVLGYRQDKPLRKTLPAWRPAEN"
FT   CDS_pept        complement(489799..490983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0446"
FT                   /locus_tag="GK0446"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0446"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74731"
FT                   /db_xref="GOA:Q5L2U9"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2U9"
FT                   /protein_id="BAD74731.1"
FT                   /translation="MPGALDGVRVLDLSRVLAGPYATMILGDLGADVIKVEAPGGSDDT
FT                   RFWGPPFQNGMSAYYTAVNRNKRSITVNLKSAEGQETIRRLAETADVLIHNFKTGTMEQ
FT                   WELGYESLSRLNPRLIYCSITGFGETGPLAPLAGYDYIIQAMSGWMSINGTADTGPLKV
FT                   GVAVTDVFTGLYAAIAIEAALLAREKTGRGQKIDLALFDCAVSALVNVAANYLLSGDVP
FT                   KPLGNEHPNIVPYSTYMASDGPIVIAVGNDRQFQALCSLLSDHSLGTDPRFQTNPGRVA
FT                   HREELNRRLNEEIKRRTRAEWQRLLAEKGIPCGPVQTLDELFRHPQTAAREMTVTVHHP
FT                   IVGPLTLVASPLKLSDTAVSYRLPPPLAGEHNREVEAGWQGNPAAENGPHDKSQ"
FT   CDS_pept        491468..492298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0447"
FT                   /locus_tag="GK0447"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74732"
FT                   /db_xref="GOA:Q5L2U8"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2U8"
FT                   /protein_id="BAD74732.1"
FT                   /translation="MFHVLVTTDANYLPPLRVLMHSLFCNNRRPFTFYLLYSRIAEEEI
FT                   QALGEFVRRQGHELVPIYVDPQLFHDAPVFRHYTVEMYYRLAAHLFLPPDVDRVLYLDP
FT                   DIVAINPMDELYDMDFEGNLFIAAEHTHSTKVANLFNKLRLKTPNAKGYFNTGVMMMNI
FT                   AMMREHVRLADIYQFIRDNRFKLVLPDQDVLNGLYWDKIKPVDCYRYNYDARYYDFLQL
FT                   LPNPKHDLAWIEENTVFIHYCGKEKPWKDNYKGELGRFYKRYSQVLELEGEATV"
FT   CDS_pept        complement(492408..492593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0448"
FT                   /locus_tag="GK0448"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0448"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74733"
FT                   /db_xref="InterPro:IPR025435"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2U7"
FT                   /protein_id="BAD74733.1"
FT                   /translation="MGRSRGQRTRDKNKATLPQVPKQLKSDGIDVEYSAEFADHEDLEA
FT                   QARAAAAGIRRQERKQ"
FT   CDS_pept        complement(492683..492811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0449"
FT                   /locus_tag="GK0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0449"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74734"
FT                   /db_xref="InterPro:IPR025437"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2U6"
FT                   /protein_id="BAD74734.1"
FT                   /translation="MAEKRKREKSKHTLTSAQEVSYARDFKMADQAGGYTAKKARH"
FT   CDS_pept        complement(492942..493496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0450"
FT                   /locus_tag="GK0450"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0450"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74735"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2U5"
FT                   /protein_id="BAD74735.1"
FT                   /translation="MLKKRELQDCHALYELMVHPDVFPFVRQKASSYEEFLFMTKQLME
FT                   AEERGELISRTILDEWGNPIGTISLFDIQDGAGFLGTWLGKPYHGLGYNRRAKEAFFHE
FT                   LFYELSIETVFLRIRKVNVRSIKAAEKLPYVTPANETRRALLEQIGADVYNLYEITKDN
FT                   YTLYTMRHPSFAHNEEQRKEA"
FT   CDS_pept        complement(493741..494658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0451"
FT                   /locus_tag="GK0451"
FT                   /product="cell-division inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:GK0451"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74736"
FT                   /db_xref="GOA:Q5L2U4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2U4"
FT                   /protein_id="BAD74736.1"
FT                   /translation="MRIAINGGTGLIGQALARHFSKQGHEIYIFTRSPKPSEGNIHYLS
FT                   FDNHRKPEAVDVAINLAGEPLNRKRWTAKQKEIILDSRLRATEAMGRYIDSLSRPPSLF
FT                   INASAIGIYGTSDSATFTEQTTDYGGDFLAQTVQAWEASARPIEQLGIRTVYARFGVVF
FT                   ARHGGALPMMIKPYLLFVGGPIGSGRQWLSWIHLEDVVRAVSYIIEHEELSGPINFTAP
FT                   HPVQMEEFGLTAARLLHRPHWLPVPAWALRLLLGEMSMLVTEGQRVIPEKLLQDGFRFS
FT                   FPTLEGCLTDLLLPHDRQKISKKN"
FT   CDS_pept        494752..495561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0452"
FT                   /locus_tag="GK0452"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0452"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74737"
FT                   /db_xref="GOA:Q5L2U3"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2U3"
FT                   /protein_id="BAD74737.1"
FT                   /translation="MGTIADIAATEQNAERFWIVVHRDGAPSLRLTVDQDVLLQFRLKK
FT                   GMEISDDLLQHIVYADEVKKAYQQALYFLAHRMRSEHEVAAHLRKKGAPDSVIDEVLKK
FT                   LRAERYVDDEAFAAAYVRTQKKTAAKGPLLVRAELERLGVPDRLIEQSLAEYTLDEQMA
FT                   IARSLYEKAKKQRRDESARAFLERVRQQLMRKGFPHEVIAAVLADGGTHTEQEEREALS
FT                   VQAEKAHRRYAHHPRPLYEQKMRQALYRKGFALDLINEWLRMHGNDE"
FT   CDS_pept        495730..496071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0453"
FT                   /locus_tag="GK0453"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0453"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74738"
FT                   /db_xref="InterPro:IPR014938"
FT                   /db_xref="InterPro:IPR036289"
FT                   /db_xref="PDB:2YXY"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2U2"
FT                   /protein_id="BAD74738.1"
FT                   /translation="MIKGEQKRYSEMTKEELQQEIAMLTEKARKAEQMGMVNEYAVYER
FT                   KIAMAKAYMLNPADFHPGEIYEIEGAPGEYFKVRYLKGVFAWGWRLKGNGEEEALPISL
FT                   LRKPNLPQS"
FT   CDS_pept        complement(496147..496308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0454"
FT                   /locus_tag="GK0454"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0454"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74739"
FT                   /db_xref="InterPro:IPR025413"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2U1"
FT                   /protein_id="BAD74739.1"
FT                   /translation="MGHHRHKKFYDNFYSNPFQQPWANPKHAHSQVNGETQQTLDLIIL
FT                   ERQTRKQS"
FT   CDS_pept        complement(496376..496537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0455"
FT                   /locus_tag="GK0455"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0455"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74740"
FT                   /db_xref="GOA:Q5L2U0"
FT                   /db_xref="InterPro:IPR012611"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2U0"
FT                   /protein_id="BAD74740.1"
FT                   /translation="MRNKAHNFPNQNNNKLEGEPRAKAEYASKRADGTTNTHPQERMRA
FT                   SGERSDFF"
FT   CDS_pept        complement(496645..497628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0456"
FT                   /locus_tag="GK0456"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0456"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74741"
FT                   /db_xref="GOA:Q5L2T9"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2T9"
FT                   /protein_id="BAD74741.1"
FT                   /translation="MDTGTHVLMGVALGSLASLDPAIAHDPLLSHAVLIGALAGSQAPD
FT                   IDTIFKLRNNAQYIRNHRGITHSIPAVVLWPLLIVSVMAAIYPKTDWLRVWLWTFVAVA
FT                   LHVFVDIFNSYGTQALRPFTKKWIALGVIHTFDPVIFGLHLVGVGGLFLGAHPGYTFLV
FT                   VYVLIAAYYGLRFRQQANIKRLVHASIAGVTEIITVPTWRPREWHLAISTCDKFYVARV
FT                   KRGELIILDRFQKRALPDHPVMNAAKRDENIAAFLSFSPVYRWEMNEYDDYYEVRFTDL
FT                   RYRSKGYYPFVAVVQLDRDLNIVSSYTGWIFSEGKLRKKLELAPNG"
FT   CDS_pept        497684..498046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0457"
FT                   /locus_tag="GK0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0457"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74742"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2T8"
FT                   /protein_id="BAD74742.1"
FT                   /translation="MSLGRSTSFFFMQLLVCPTLCSANNRLRHWPKGGERQTRLWLVYH
FT                   RETIVGERRNDQFHNDSKKETIDRQWSEKKKTGSKPFVRRKGKRFNQKRKAPRMRRDVL
FT                   LIISDREAPHFNVYKV"
FT   CDS_pept        complement(498141..498629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0458"
FT                   /locus_tag="GK0458"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0458"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74743"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2T7"
FT                   /protein_id="BAD74743.1"
FT                   /translation="MAKPITTIQKRQMTEEEKRTEALAKLKAAVGDSEEAVRELLAFIE
FT                   QLHESGLLEAANALLKAREDVAKIVVGQLNQKPVTTMINHAFAIAGLVASLDPEKTAKL
FT                   LEHIAAGALEAYEQNSAETKKIGLFDLLKALNDPDINRAIRFFLSALKAIGKRFRNDG"
FT   CDS_pept        complement(498622..501585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0459"
FT                   /locus_tag="GK0459"
FT                   /product="formate dehydrogenase chain A"
FT                   /db_xref="EnsemblGenomes-Gn:GK0459"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74744"
FT                   /db_xref="GOA:Q5L2T6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2T6"
FT                   /protein_id="BAD74744.1"
FT                   /translation="MEAQMVTVTINGRAYRAKPGMTILEVVNEHGLPHPQVCYTPELGA
FT                   IQTCDTCIAEVNGTLLRACATPVEDGMVVELGSPRAKAAQKEAMDRLLENHLLYCTVCD
FT                   NNNGNCKLHNTAEMMQIEHQTYPYRPKVDPSEVDMSHPFYRYDPNQCIACGQCVEACQN
FT                   LQVNETLSIDWEAERPRVVWDGGVPINESSCVSCGQCVTVCPCNALMEKSMLGEAGFLT
FT                   GLDKDVLNPMIDFVKEVEPNYTSIFAISEIEAAMREQRIKKTKTVCTFCGVGCSFEVWT
FT                   KGRKILKIQPVSEAPVNAISTCVKGKFGWDFVNSEERLTKPLIRKGDVFVESTWDEALD
FT                   LVAEKLGAIKRQYGGNAIGFISSSKISNEENYLMQKLARQVFETNNVDNCSRYCQSPAT
FT                   DGLFRTVGMGGDSGTIHDIATAGLVIIIGANPAEGHPVLATRVKRAHKLFGQKLIVADL
FT                   RRNEMAERADLFIRPKQGTDQVWLMAVTKYIIDQGWHDEAFIRERVHFFEEFKQLLEKY
FT                   TLDYAEQVTGIAKADLIRIAEMIHEADGTCVLWGMGVTQNTGGSDTSAAISNLLLATGN
FT                   YGRPGAGAFPLRGHNNVQGACDMGSLPAWLPGYQHVTDDEARAKFEQAYGVRIDAKPGL
FT                   DNIQMLEAAERGELKAMYIVGEDMALVDCNANHVQETLAKLDFVVVQDIFLSKTAQFAD
FT                   VILPAAPSLEKEGTFTNTERRIQRFYQALEPLGDSKPDWWIIQEIAKRLGADWNYAGPK
FT                   EIMDEIASLAPLYSQAHYDRLEGWNSLCWGSHDGADTPLLYKERFNFPDGKARFALADW
FT                   VEPVQYPEEYDLLVNNGRLLEHFHEGNLTYKSKGIEHKFPEVFVEVSPELAKERGIEDG
FT                   ALVRLISPYGRVKVRVLVTDRVRGNELFLPMHSTANESAINILTGPATDRRTNTPAYKQ
FT                   ARVRMEVIERSGKTPLPRTNPRFKKRHPQNGVEVERKWRRSDYVPLTEENKGVTIGG"
FT   CDS_pept        501852..502199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0460"
FT                   /locus_tag="GK0460"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0460"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74745"
FT                   /db_xref="InterPro:IPR018745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2T5"
FT                   /protein_id="BAD74745.1"
FT                   /translation="MSKKEAAFNDIVRKVRKQLFGKGPERIKTYFVDNLAITILHGNLT
FT                   PTEKFIARTPEGREMVHAARTKMIQDVYAQHVPDGMEELIGSKLLYLFSDIKVEEDMAV
FT                   SVFVFEKPIEL"
FT   CDS_pept        502460..503251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0461"
FT                   /locus_tag="GK0461"
FT                   /product="protein required for formate dehydrogenase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:GK0461"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74746"
FT                   /db_xref="GOA:Q5L2T4"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2T4"
FT                   /protein_id="BAD74746.1"
FT                   /translation="MSGFAAKRRPIAKYRNGRFVEEEDEIALEFPLTITVNGEEFATIV
FT                   CTPAHLDELVIGFLASEGAIRTCSDIKGMTIDGERGFAYVELAAGGLPAKQFYAKRFIG
FT                   SCCGKSRQFYFYNDMKTAKTIVGGITVKADDCIRLMKALHERSTDFAATGGLHNAALAT
FT                   PDEMVVIRSDIGRHNALDKLYGYCLRHQVAMKDKLIVFSGRVSSEVLLKAAKMGVSVLL
FT                   SKSAPTTLALDLADELGITVVGFLRGQAFNVYTHESRIIIG"
FT   CDS_pept        503268..504533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0462"
FT                   /locus_tag="GK0462"
FT                   /product="oxalate:formate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:GK0462"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74747"
FT                   /db_xref="GOA:Q5L2T3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2T3"
FT                   /protein_id="BAD74747.1"
FT                   /translation="MKNRWLIALSAVGIHISIGSVYAWSNFTNPLKQLFGWSDQEVALT
FT                   FSIAILFLGLSAAFLGHFVEKHGPRKSGLLAAIFFGLGVTGSGLAVALGSKYLLYLFYG
FT                   VLGGIGLGVGYIAPVSTLVKWFPDRRGLATGLAIMGFGFAAAIASPVMNSLIASVGVQN
FT                   TFFILGITYFVIMTLSSLYLEKPPEGWLPEGFQEKVKAGKAKPSLDLAQLTANDAVKTR
FT                   RFWYLWFMLFINVTCGIAVLAVAKPLAVESIGISQTAAAALVGAIGVFNGLGRIGWASA
FT                   SDYIGRPNTYTTFFVLQILIFFLLPNVSIKWLFVVMLTIVYTCYGGGFACIPAYIGDLF
FT                   GTKQLGAIHGYILTAWAAAGLVGPMFAAYIKDTTGSYEGSLAFFGGLFVIAFIISLLVR
FT                   IDIRRLRAQHEQIAYVSAAKES"
FT   CDS_pept        504639..505739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0463"
FT                   /locus_tag="GK0463"
FT                   /product="adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0463"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74748"
FT                   /db_xref="GOA:Q5L2T2"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2T2"
FT                   /protein_id="BAD74748.1"
FT                   /translation="MTRETERFPAREFQRDLLDWFARERRDLPWRKGRDPYKVWVSEVM
FT                   LQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKT
FT                   RYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDIAK
FT                   PSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQVYCQAFAEGVA
FT                   EELPVKTKKTAVKQVPLAVTVLADDEGRVLIRKRDNTGLLANLWEFPSCETDGADGKEK
FT                   LEQMVGEQYGLQVELTEPIVSFEHAFSHLVWQLTVFPGRLISSESTKEPFRLVSEDELE
FT                   AYAFPVSHQRVWREYKEWAGGVRRPD"
FT   CDS_pept        complement(505736..505960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0464"
FT                   /locus_tag="GK0464"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0464"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74749"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2T1"
FT                   /protein_id="BAD74749.1"
FT                   /translation="MYVGRDMTELSMIPKTEWTDDELAYFHHSFQQIAPYLNVEGQTIH
FT                   REIIEEIEARGGLGRREATYTHGTMPVPD"
FT   CDS_pept        506021..506770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0465"
FT                   /locus_tag="GK0465"
FT                   /product="glucose 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0465"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74750"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2T0"
FT                   /protein_id="BAD74750.1"
FT                   /translation="MSGKVAVVTGSSRGIGKAIALRLAKEGYDIVVNYARSKTAAEETA
FT                   REIEALGRKALVVKANVGDVEKIHAMFAQIDEVFGRVDVLVNNAASGVLRPAMELEETH
FT                   WNWTMNINSKALLFCAQEAAKRMEQVGGGKIVSISSLGSIRYLENYTAVGVSKAALEAL
FT                   TRYLAVELAPKNIAVNAVSGGAVDTDALKHFPNREELLADAAANTPAGRPVKPDDIVNA
FT                   VLFLLSDAAEMIRGQTIIVDGGRSLLL"
FT   CDS_pept        506829..507020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0466"
FT                   /locus_tag="GK0466"
FT                   /product="gamma-type small acid-soluble spore protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0466"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74751"
FT                   /db_xref="GOA:Q5L2S9"
FT                   /db_xref="InterPro:IPR006341"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2S9"
FT                   /protein_id="BAD74751.1"
FT                   /translation="MAKQPNKTAAGTNIQEVRQQNAQSAQAAQAGQFATEFAAETNVQH
FT                   VKQQNAQAEARKAQNVNQ"
FT   CDS_pept        507248..507457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0467"
FT                   /locus_tag="GK0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0467"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74752"
FT                   /db_xref="InterPro:IPR025572"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2S8"
FT                   /protein_id="BAD74752.1"
FT                   /translation="MAMEHAWTNVGDEALFLQQEMERCEEITRQLDELEREAPTAALRE
FT                   EVRQMKREVEAIRRAFLGQMAPGV"
FT   CDS_pept        507592..508125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0468"
FT                   /locus_tag="GK0468"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0468"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74753"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2S7"
FT                   /protein_id="BAD74753.1"
FT                   /translation="MPVYPREGKIIQIHSYKHNGTIHRIWQETVVLKGTPSYVIGGNNK
FT                   TLVMEADGRTWVTREPAICFFHAKHWFNIIAMIREDGVYYYCNLSSPFVWDEEALKYID
FT                   YDLDIKVFPDMTYMLLDEDEYERHRREMHYPDVIDRILKNNVQKLIGWIKERKGPFAPE
FT                   FIDKWYGVFQAYQT"
FT   CDS_pept        508463..509362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0469"
FT                   /locus_tag="GK0469"
FT                   /product="dipeptide ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0469"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74754"
FT                   /db_xref="GOA:Q5L2S6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2S6"
FT                   /protein_id="BAD74754.1"
FT                   /translation="MAELARTPATPPAAIRETESVSLWKEAWRRFRKNKIALVGAGIVL
FT                   FFILVAILAPWLAPYDYKDQQLAERLQPPSSEHWFGTDDFGRDIFSRVIYGARISLWVG
FT                   FFSVLGSVMVGSLLGIIAGYYGRWIDGVISRLFDIMLAFPSILLAIGIVAVLGPSLQNA
FT                   LIAIAVINVPNFGRLIRSRVLSIKQEEYIMAAKAIGMSDWRILIHHILPNSLAPIIVQG
FT                   TLAIATAIIEAAALGFLGLGAQPPNPEWGKMLSDAKDFLTQAPWTMIFPGLAIMLTVLG
FT                   FNLMGDGLRDALDPRMKN"
FT   CDS_pept        complement(509623..510456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0470"
FT                   /locus_tag="GK0470"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0470"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74755"
FT                   /db_xref="GOA:Q5L2S5"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2S5"
FT                   /protein_id="BAD74755.1"
FT                   /translation="MKLGARIFKTGIAVALALFLAALFQFPSPSFAGISAVFAMQPTIY
FT                   RSYLSLIEQVQANVIGALFAIAAVFILGRDPLVVGLTLMIVIALCLKMRLESSTISVAL
FT                   VTVIAIMEYTDRQFIQFAAIRFLTMMLGIFAAFVVNLIFLPPKYEKKVYEKISEETEAI
FT                   LKWIRLHKQQAADHHHLKEEIEARHEEMTKLEHLYFMYKEERTYFRRQRFQKSRKLVLY
FT                   RQMIAAADRALSVLKWLHRLENEFSRLPAELRQAVCLHLGCLLDYHEQLLLEIYP"
FT   CDS_pept        complement(510585..511871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0471"
FT                   /locus_tag="GK0471"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase 2 (GSA)"
FT                   /EC_number="5.4.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:GK0471"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74756"
FT                   /db_xref="GOA:Q5L2S4"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2S4"
FT                   /protein_id="BAD74756.1"
FT                   /translation="MQWTKSEQLYKEALQHIVGGVNSPSRSYKAVGGGAPVVMERAQGA
FT                   YFWDVDGNKYIDYLAAYGPIIAGHAHPHIAEAIRRAAETGVLYGTPTPHEITFAKMLKE
FT                   AIPSLEKVRFVNSGTEAVMTTIRVARAYTGRSKIVKFEGCYHGHSDLVLVAAGSGPSTL
FT                   GTPDSAGVPPSIAQEVITVPYNDVESFREAMNVWGEQVAAVLVEPIVGNFGIVLPKPGF
FT                   LEAINEIAHKEGALVIYDEVITAFRFMYGGAQNLLGVEPDLTAMGKIIGGGLPIGAYGG
FT                   RQDIMEQVAPLGPAYQAGTMAGNPASVLAGIACLEVLKQEGVYEHLDRLGAMLEEGILA
FT                   HARQCGLPVTVNRLKGALTVFFTDEKVENYKQAQRSDGELFAKFFKLMLKQGINLAPSK
FT                   YEAWFITLAHTEDDIAYTIDAVGKAFRQL"
FT   CDS_pept        512265..513269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0472"
FT                   /locus_tag="GK0472"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0472"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74757"
FT                   /db_xref="GOA:Q5L2S3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2S3"
FT                   /protein_id="BAD74757.1"
FT                   /translation="MNAIEVEHLRKEFKVHKSRSGLVGAFRDLWTRRYTLVRAVDDISF
FT                   AVKQGEIVGYIGENGAGKSTTIKMLTGILTPTSGRIVVNGMNPHKEREKFVRTIGVVFG
FT                   QRSQLWWDIAVQESFRLLKKVYRVSDEQYRRHMAEVIDMLEIGPLLDKPVRKLSLGQRM
FT                   RCELAAALIHNPPLLFLDEPTIGLDVLVKLNIRQFLKQLNERYGTTILLTTHDMSDIEA
FT                   LCERVIMLDEGKIIYDGSLERLKERWGQGKRVAFTFAEAVTAAFLQQLTEGLDVVWKKG
FT                   EQPNVWVSHVPSGGVPEVVSRVAARCALNDIHIHEVPTEEIIRNIYEEGAVHG"
FT   CDS_pept        513262..514053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0473"
FT                   /locus_tag="GK0473"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0473"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74758"
FT                   /db_xref="GOA:Q5L2S2"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2S2"
FT                   /protein_id="BAD74758.1"
FT                   /translation="MGKYVEMVRIRFLMMLAYRTNYYTGILIYAINIAAYYFLWSAIYG
FT                   GKSSMQGMSLGQMTTYVAISWLARAFYFNNLDREIAMEIRDGKVAIELIRPYSYLGMKA
FT                   VQGLGEGLFRLFFLSLPGLLVVSLFLPLQFPGHAKTWLSFGLSLLFSFIIFSELNLLAG
FT                   VVTFFTFRNEGLLRAKRFIIDLFSGLILPLSFYPDWAQRAMMYFPFQAISYIPSMIMTE
FT                   SFKGAAVRDGLLLQATWCIVLLFPIGWLWRAAKKRLVVQGG"
FT   CDS_pept        514057..514842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0474"
FT                   /locus_tag="GK0474"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0474"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74759"
FT                   /db_xref="GOA:Q5L2S1"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2S1"
FT                   /protein_id="BAD74759.1"
FT                   /translation="MFYVSVFFQYMAQYMKTKLQYRADLFVEWLSDFMAQAVNLVFLLV
FT                   VFGHTTLLHGWSRDEILFIYGFFLVPYAVFGAFFNLWDFNERYIVQGEMDRVLTRPLNS
FT                   LFQIVLERMELESLLGAVPGLIIMLYAGSRLSLSFHWYDVFVFILFVIGGALIYAGIFI
FT                   SLATISFFADARTSIMPMMYNISSYGRYPIDIYHRVIRYILTWVLPFAFVGVYPAAYFL
FT                   DKKEWYSYAFFTPVVGMVCFTVSVMLWNAGVRRYRGTGS"
FT   CDS_pept        514988..515941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0475"
FT                   /locus_tag="GK0475"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:GK0475"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74760"
FT                   /db_xref="GOA:Q5L2S0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2S0"
FT                   /protein_id="BAD74760.1"
FT                   /translation="MKNGRGNRVAVVGTGFVGASYAFALMNQGIADEIVLIDANENKAE
FT                   GDAMDFNHGKVFAPKPADIWHGDYDDCRDADLVVICAGANQKPGETRLDLVDKNIAIFR
FT                   SIVESVMASGFQGLFLVATNPVDILTYATWKFSGLPQERVIGSGTILDTARFRFLLGDY
FT                   FAVAPTNVHAYIIGEHGDTELPVWSQADIGGVPIRKLVESKGEEAQKELERIFVNVRDA
FT                   AYQIIEKKGATYYGIAMGLARVTRAILHHENAILTVSAYLDGPYGERDVYIGVPAVINR
FT                   NGIREVIEIELDEEEKKWFHRSAATLKGVLARYFAQ"
FT   CDS_pept        516112..516516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0476"
FT                   /locus_tag="GK0476"
FT                   /product="K+ channel subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GK0476"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74761"
FT                   /db_xref="GOA:Q5L2R9"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2R9"
FT                   /protein_id="BAD74761.1"
FT                   /translation="MDYAFLGIVAAVLLGSITSLWTVRVQATHRLSLDSLWVLVQWYLT
FT                   MLLGFAMIYMILQVNGHAVFTPSPNSASKDRLSLLEDSLYLSGMTLLSVGYGDVTPIGV
FT                   GRWIAIAEALLGYIMPAVIVTRTVFDWDHR"
FT   CDS_pept        516583..517059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0477"
FT                   /locus_tag="GK0477"
FT                   /product="bacterioferritin comigratory protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0477"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74762"
FT                   /db_xref="GOA:Q5L2R8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2R8"
FT                   /protein_id="BAD74762.1"
FT                   /translation="MTIAIGQPAPDFTLPASNGKMVSLSDFRGRYVVLYFYPKDMTPGC
FT                   TAEACDFRDRHAQFAELNAVILGVSTDPMNRHEAFIEKYELPFLLLSDERHEVAELYGV
FT                   WKKKKNFGKEYMGIDRSTFIIAPDGTLVQEWRGVKVKGHVDEALAEVARLASSR"
FT   CDS_pept        517290..517742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0478"
FT                   /locus_tag="GK0478"
FT                   /product="transcriptional regulator (Fur family)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0478"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74763"
FT                   /db_xref="GOA:Q5L2R7"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2R7"
FT                   /protein_id="BAD74763.1"
FT                   /translation="MSDNEQLKEALDMLKKTGIRITPQRHAILEYLISSMSHPTADEIY
FT                   KALEGKFPNMSVATVYNNLRVFKEIGLVKELTYGDSSSRFDFVTSNHYHVICEECGKIV
FT                   DFHYPALDEVEQLAAHVTGFKVDHHRMEVYGVCPDCQKSGAPAHSH"
FT   CDS_pept        complement(517767..518120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0479"
FT                   /locus_tag="GK0479"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0479"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74764"
FT                   /db_xref="GOA:Q5L2R6"
FT                   /db_xref="InterPro:IPR020912"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2R6"
FT                   /protein_id="BAD74764.1"
FT                   /translation="MSIKYSSKINKIRTFALSLIFIGVIVMYLGLFFRTSPVIMTLFML
FT                   FGMLFLVASGIVYFWIGTLSTRAVQVVCPSCGKVTKMLGRVDLCMFCREPLTLDRELEG
FT                   KEFDEKYNKKRKS"
FT   CDS_pept        518373..519359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0480"
FT                   /locus_tag="GK0480"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0480"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74765"
FT                   /db_xref="InterPro:IPR029348"
FT                   /db_xref="InterPro:IPR041143"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2R5"
FT                   /protein_id="BAD74765.1"
FT                   /translation="MQKKQPAQNRNVWLSVNRYVGISEGFVRPDIAAGFLQRTRGMKEL
FT                   LHPICHEWANRCNTHGILMIEKTACHAATTDTFDVVLLVIVDPQSEPMLLRQYSLNEKK
FT                   AVLYAVSERQLNEWLVLGSHRKAVDWVFNGTVVFDRNGYVQQLRQRLEQFPPKERRLKM
FT                   GLEFAKLIRHYTEGKALFAAKHWLDSYNHMVQALHHLARLTVIEHGLYPEVTVWNQVKR
FT                   MDGRIYKLYEELVGSEEPLPKRLELLLLASEFLIHSYVESGSSHLCEALKEKNGAWSIE
FT                   EMTGHPQFAPYSVDLVIMLEYLVERKVLTVVEMPTKGNTMLERYYTL"
FT   rRNA            519816..521369
FT                   /gene="rrnG-16S"
FT                   /product="16S ribosomal RNA"
FT   rRNA            521910..524837
FT                   /gene="rrnG-23S"
FT                   /product="23S ribosomal RNA"
FT   rRNA            524951..525067
FT                   /gene="rrnG-5S"
FT                   /product="5S ribosomal RNA"
FT   tRNA            525076..525151
FT                   /gene="trnG-Val"
FT                   /product="transfer RNA trnG-Val"
FT   tRNA            525333..525409
FT                   /gene="trnG-Met1"
FT                   /product="transfer RNA trnG-Met1"
FT   tRNA            525415..525490
FT                   /gene="trnG-Asp"
FT                   /product="transfer RNA trnG-Asp"
FT   tRNA            525665..525740
FT                   /gene="trnG-Phe"
FT                   /product="transfer RNA trnG-Phe"
FT   tRNA            526123..526195
FT                   /gene="trnG-Thr1"
FT                   /product="transfer RNA trnG-Thr1"
FT   tRNA            526379..526451
FT                   /gene="trnG-Lys"
FT                   /product="transfer RNA trnG-Lys"
FT   tRNA            526459..526533
FT                   /gene="trnG-Gly1"
FT                   /product="transfer RNA trnG-Gly1"
FT   tRNA            526539..526624
FT                   /gene="trnG-Leu"
FT                   /product="transfer RNA trnG-Leu"
FT   tRNA            526630..526703
FT                   /gene="trnG-Arg"
FT                   /product="transfer RNA trnG-Arg"
FT   tRNA            526710..526783
FT                   /gene="trnG-Pro"
FT                   /product="transfer RNA trnG-Pro"
FT   tRNA            526792..526867
FT                   /gene="trnG-Ala"
FT                   /product="transfer RNA trnG-Ala"
FT   tRNA            526882..526958
FT                   /gene="trnG-Met2"
FT                   /product="transfer RNA trnG-Met2"
FT   tRNA            526964..527040
FT                   /gene="trnG-Met3"
FT                   /product="transfer RNA trnG-Met3"
FT   tRNA            527060..527150
FT                   /gene="trnG-Ser1"
FT                   /product="transfer RNA trnG-Ser1"
FT   tRNA            527507..527582
FT                   /gene="trnG-Thr2"
FT                   /product="transfer RNA trnG-Thr2"
FT   tRNA            527590..527662
FT                   /gene="trnG-His"
FT                   /product="transfer RNA trnG-His"
FT   tRNA            527836..527906
FT                   /gene="trnG-Gly2"
FT                   /product="transfer RNA trnG-Gly2"
FT   tRNA            527913..527986
FT                   /gene="trnG-Ile"
FT                   /product="transfer RNA trnG-Ile"
FT   tRNA            528196..528270
FT                   /gene="trnG-Asn"
FT                   /product="transfer RNA trnG-Asn"
FT   tRNA            528278..528370
FT                   /gene="trnG-Ser2"
FT                   /product="transfer RNA trnG-Ser2"
FT   tRNA            528375..528446
FT                   /gene="trnG-Glu"
FT                   /product="transfer RNA trnG-Glu"
FT   CDS_pept        complement(528750..529415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0481"
FT                   /locus_tag="GK0481"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0481"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74766"
FT                   /db_xref="GOA:Q5L2R4"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2R4"
FT                   /protein_id="BAD74766.1"
FT                   /translation="MKCVISEQLKQRLPSGKFGVIRYHHIEVSDSPQMLRGRLELFQES
FT                   LYIELQEKSIADIPEMVEWRRTFKQIGTDPSRYRPSSESLYRRIQKKSFIPPIHSAADI
FT                   NNFFSLYYKIPLGIYDLDRINGTVTLTIGTEQDEYIALNGRTVNFANKLVSKDERGPFG
FT                   SPIVDSERTAVTRETKNALQIVYFLPSTPEETAKRQLQAIQTMFVQIHGGEADAQLFI"
FT   CDS_pept        529468..530610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0482"
FT                   /locus_tag="GK0482"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0482"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74767"
FT                   /db_xref="GOA:Q5L2R3"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2R3"
FT                   /protein_id="BAD74767.1"
FT                   /translation="MDVMALKQEVIEYSRSIGIDKIGFASADPFVELKERLRRQQELGY
FT                   QSGFEEPDIEKRTNPSLLLPEAKSIIAIALAYPSKMKNAPRGTKTERRGVFCRASWGKD
FT                   YHDVLRERLQQLEEFLLAKVPHARVRSMVDTGELADRAVAERAGIGWSGKNCSIITPEF
FT                   GSYVYLGEMITNIPFPPDEPVENRCGTCTKCIDACPTGALVQGGQLNAQRCLSFLTQTK
FT                   GFLADEFREKIGNRLYGCDTCQQVCPENKGKDFHLHPEFEPDPEAVKPKLIPLLQMSNR
FT                   EFKETFGAMAGSWRGKKPIQRNAILALAHYKDQTAVPHLLRLLKEDSRPVIRGTAAWAL
FT                   GKIGDPSAKPYLEAARQTEADADVIAEIEKGLKLLAEAKE"
FT   CDS_pept        530672..531535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0483"
FT                   /locus_tag="GK0483"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0483"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74768"
FT                   /db_xref="InterPro:IPR024301"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2R2"
FT                   /protein_id="BAD74768.1"
FT                   /translation="MKKQLRAWLDERARSFVSESNIRSEEAARKQRLCQKRGAEIVRCT
FT                   IRGQIVGRQTIEREAKVMYIAHHQFLIKQRGSLYIEEQVEERCACFVRGELVTDEPINR
FT                   LGRDMEAPRVEREQWTGERLSYQYDRARAVRYAETWWNRHNPVFPSFPVDCTNFVSQCL
FT                   YAGGAPMTGYPNRARGWWCQNGSWSYSWAVAHAFRWYLSGSRIGLQAVEVAEPEQLMAG
FT                   DVICYDFQGDGRFDHSTIVVAKDQNGMPLVNAHTTNSRMRYWSYEDSSAYTPNIRYKFF
FT                   HIIDRK"
FT   CDS_pept        531556..532029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0484"
FT                   /locus_tag="GK0484"
FT                   /product="rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0484"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74769"
FT                   /db_xref="GOA:Q5L2R1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2R1"
FT                   /protein_id="BAD74769.1"
FT                   /translation="MPLHVVLYQPEIPANTGNIARTCAATDTSLHLIRPLGFSTDDKML
FT                   KRAGLDYWPYVNISYYDSLDELFARFPEGEFYFITKFGRRYYDSFDFSDTEKHIFFVFG
FT                   RETTGLPKELLEANMDRCLRIPMNDKVRSLNLSNTAAILVYEALRQQRFYGLS"
FT   CDS_pept        complement(532071..532163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0485"
FT                   /locus_tag="GK0485"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0485"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2R0"
FT                   /protein_id="BAD74770.1"
FT                   /translation="MRTLLVLGVIIAFLTAIFTAGYEDKPGVRQ"
FT   CDS_pept        532355..534250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0486"
FT                   /locus_tag="GK0486"
FT                   /product="serine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:GK0486"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74771"
FT                   /db_xref="GOA:Q5L2Q9"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Q9"
FT                   /protein_id="BAD74771.1"
FT                   /translation="MDILQKIARYREEEEKLKWEGTFAEYLKILKEKPWVAQSAHSRVY
FT                   NMIKDAGVEEVNGRKRYKFFSQHLFGLEEALERLVEEYFHPAAKRLDVRKRILLLMGPV
FT                   GGGKSTLVTLLKRGLEEYSKTERGAVYAIKGCPMHEDPLHLIPHHLRDDFYREYGIRIE
FT                   GELSPLNMMRLEKEYGGRIEDVLVERIFFSENRRVGIGTFSPSDPKSQDIADLTGSIDF
FT                   STIAEYGSESDPRAYRFDGELNKANRGIMEFQEMLKCDEKFLWHLLSLTQEGNFKAGRF
FT                   ALISADELIIAHTNETEYRSFIANKKNEALHSRIIVMPIPYNLRVSEEERIYEKMIRES
FT                   DVADVHIAPHTLRIAAMFTILTRLKESKRPDVDLLKKMRLYDGEMIEGFSEVDVEELKK
FT                   EHPDEGMSGIDPRYVINRISACIIRKGVPSINALDVLRSLKEGLDQHPSITKEDRERYL
FT                   NFISLVRKEYDEIAKQEVQKAFVYSYEESAKTLMDNYLDNVEAYCNKTKLRDPLTGEEM
FT                   NPDEKLMRSIEEQIGISENAKKAFREEILIRISAYARKGQRFDYNSHERLREAIQKKLF
FT                   ADLKDIVKITTSTKTPDEQQLKKINEVVARLIDEYGYNSTSANELLRYVGSLLNR"
FT   CDS_pept        534559..535743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0487"
FT                   /locus_tag="GK0487"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0487"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74772"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Q8"
FT                   /protein_id="BAD74772.1"
FT                   /translation="MKGNFVVSKEDWSLHRKGYDDQKRHQEKVKEAIKNNLPDLITEES
FT                   IYVNGRDVIKIPIRSLDEYKIRYNYEKNKHVGQGNGDSQVGDVVARDGSGEGQGPGKGQ
FT                   GAGDLPGQDYYEAEVSLMEIEEAFFSQLELPNLQRKELDQNVTQHIEFNDIRRTGLMGN
FT                   IDKKRTMLAAFKRNAMNGKPGFYPIYREDLKFKTWNEVVKPESKAVVLAMMDTSGSMGM
FT                   WEKYMARSFFFWMTRFLRTKYETVDIAFIAHHTEAKVVSEEEFFTKGESGGTICSSAYR
FT                   KALELIETKYPPSRYNIYPFHFSDGDNLTSDNARCVKLVQELMNVSNMFGYGEVNQYNR
FT                   SPSTLMRAYGSMKHEKFKYYILKQKSDVFEALKYFFSAEKKEAVASKSWGKAES"
FT   CDS_pept        complement(535715..537259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0488"
FT                   /locus_tag="GK0488"
FT                   /product="site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0488"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74773"
FT                   /db_xref="GOA:Q5L2Q7"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Q7"
FT                   /protein_id="BAD74773.1"
FT                   /translation="MYRPRNLDVFIYLRKSRKDIEEEKKAAESGASYDTLQRHRDNLLA
FT                   VARKEGHNILGIFEEIVSGESIAERSEIQKLLRELETGVADAVLVMDIDRLGRGDMLDQ
FT                   GILDRAFRYSGTKIITPTEVYDPESETWELVFGVKSIVSREELKVITKRLQGGRRDSAA
FT                   KGRSISKKPPYGYLRDEQLKLYPDPETSWVVVKIFEMVRDGHGRQAIAAELDRLGVKPP
FT                   DEKRAFWSPSTISAIIKNEVYLGHIIWGKVKYIKQNGRYKRKKMPRERWYVKENAHAPL
FT                   VSKELWEAANKAYRSRWRPSTVESKPLANPLAGLLKCEVCGYTMWYQPRKDRPHPLVRC
FT                   PNPKCKGVQKGALLPLVEEKILQSLAEFVDQFEVQEDRKEQRSVIPLKQKAIEKKEKEL
FT                   RELHKQKDALHDLLERGVYTIETFLERQQTIVSRIKKTQEEIDQLREEIAKEQLKEKNI
FT                   SEYVPTVKKVLDAYRLTDDVEKKNRLLKSVLEKATYLRKPEWTKKDQFTIQLYPRI"
FT   CDS_pept        complement(537377..538072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0489"
FT                   /locus_tag="GK0489"
FT                   /product="phage-like element PBSX protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0489"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74774"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Q6"
FT                   /protein_id="BAD74774.1"
FT                   /translation="MNFSSYQFTPLEQYICELYEHLEIKKPHQLDMIDIAAKLNVWLHF
FT                   ADIRSTAIERNGVYSIIVDRRLSRQQQWQEFGHELGHVLRHAGNQMLLPASLVQLQEAQ
FT                   ATNFALHFCVPTFMLLELELPYTEKEIVYVLSETFGVEPLFAKRRWDRFKEQWESYRFY
FT                   EALFGHMQVAEPIVAAVGRNAESDLHLLREYAASHGGSLFIDGALTDEEQQEIIRYLQQ
FT                   MDRRNDPTA"
FT   CDS_pept        complement(538154..538414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0490"
FT                   /locus_tag="GK0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0490"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74775"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Q5"
FT                   /protein_id="BAD74775.1"
FT                   /translation="MTRAPKIINNALTKYDKSHDVLHIFFFPELLSVDDEEFPGIVIRR
FT                   AVRDDRITGITILDFSRKDEDLLNNLLPEFDFSGLHKQIIQ"
FT   CDS_pept        complement(538780..539085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0491"
FT                   /locus_tag="GK0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0491"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74776"
FT                   /db_xref="InterPro:IPR021857"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Q4"
FT                   /protein_id="BAD74776.1"
FT                   /translation="MEKGNDLRIALEMDNFRSNFSDLVQVETSPEHVYINFLERLPLSG
FT                   ENEPNAKVISRIVVSWPHFIRIVKLFNNVLMSNKNLAQDTFMSLMKEVEGSNDVRS"
FT   CDS_pept        complement(539239..539604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0492"
FT                   /locus_tag="GK0492"
FT                   /product="transcriptional repressor of PBSX genes"
FT                   /db_xref="EnsemblGenomes-Gn:GK0492"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74777"
FT                   /db_xref="GOA:Q5L2Q3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Q3"
FT                   /protein_id="BAD74777.1"
FT                   /translation="MTFGKRLRFLRKKMNMTQKDLADKFSLGESTIGMYERDEREPSFE
FT                   FVRQLADFFNVTTDYLLGRTDHPNPSEQDDIPEELKDPELGLFFKELAEAPEERREQLL
FT                   KIWEILKSEGDRKPKGK"
FT   CDS_pept        complement(539640..540017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0493"
FT                   /locus_tag="GK0493"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GK0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74778"
FT                   /db_xref="GOA:Q5L2Q2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Q2"
FT                   /protein_id="BAD74778.1"
FT                   /translation="MKVFYVLGDRLRKLRQEKKLTQEELGKKINVTKVSISGYENGNRT
FT                   PDTETLQKLADFFNVTTDYLLGRTDHPNPPDQDDIPEELKDPELGLFFKELAEAPEERR
FT                   EQLLKIWEILKSEGDRKPNGR"
FT   CDS_pept        complement(540014..540376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0494"
FT                   /locus_tag="GK0494"
FT                   /product="transcriptional repressor of PBSX genes"
FT                   /db_xref="EnsemblGenomes-Gn:GK0494"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74779"
FT                   /db_xref="GOA:Q5L2Q1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Q1"
FT                   /protein_id="BAD74779.1"
FT                   /translation="MFPNRLKMLRLQKKLTHQDMADFLGITRQGYSKYENGQSQPDIDT
FT                   INKLAEFFNVTTDYLLGRTDDPTPPEQDDIPEELKDPELGLFFKELAEAPEERREQLLK
FT                   IWEILKSEGDRKTKDK"
FT   CDS_pept        540553..540798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0495"
FT                   /locus_tag="GK0495"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GK0495"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74780"
FT                   /db_xref="GOA:Q5L2Q0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2Q0"
FT                   /protein_id="BAD74780.1"
FT                   /translation="MTKEQLRDTLIRAREAKQLTQEQVVSMSGANITRQYYSMIENGDR
FT                   RPSVDVAKKIAPVLGVSWTIFFEIESNQKLRKTSSS"
FT   CDS_pept        complement(540660..540821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0496"
FT                   /locus_tag="GK0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0496"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74781"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2P9"
FT                   /protein_id="BAD74781.1"
FT                   /translation="MARSDGAYHDELVLRNFWLLSISKKMVQLTPRTGAIFLATSTDGL
FT                   LSPFSIIL"
FT   CDS_pept        540858..541163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0497"
FT                   /locus_tag="GK0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0497"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74782"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2P8"
FT                   /protein_id="BAD74782.1"
FT                   /translation="MNLEQRLSELEARVSQLEKEAAAATTAETEKHLQGLPNSTKTIIF
FT                   KEIEKTKQDERPVGIDPESYLAKEILWQSRKIIELEHSIAEILNTVKHLKYLLTKS"
FT   CDS_pept        complement(541169..541537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0498"
FT                   /locus_tag="GK0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0498"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74783"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2P7"
FT                   /protein_id="BAD74783.1"
FT                   /translation="MDNRFDHQLKTIAFFISEGFHASRLCHELIFAENGKDNMNLALTF
FT                   LNQANTFITSAKTLYAQLSSEGESQELETFFHQFMVFNNEVLTNVRTNHSHQWSDIEFK
FT                   QLEESFDSLTDLLNAWAK"
FT   CDS_pept        complement(541785..542126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0499"
FT                   /locus_tag="GK0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0499"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74784"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2P6"
FT                   /protein_id="BAD74784.1"
FT                   /translation="MYEPKAVDHITSNGRHILIYDYLDYPVTIMLANDIVVGINPEADE
FT                   ICLMVPDQNNVYRDITDIISTKPTMGAIELFLKADNLWAVESYKNAKQIGKQILNKSLT
FT                   ELKLCYSKR"
FT   CDS_pept        542198..542413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0500"
FT                   /locus_tag="GK0500"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0500"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2P5"
FT                   /protein_id="BAD74785.1"
FT                   /translation="MNTIQDQWAMAELKHRLLVIIMRLKDDPAFTKDDAATQIPLSVKE
FT                   VTKCQTKSKNSSVSLRNSFSLFRRMS"
FT   CDS_pept        complement(542513..542962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0501"
FT                   /locus_tag="GK0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0501"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74786"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2P4"
FT                   /protein_id="BAD74786.1"
FT                   /translation="MRKYLWHLDLRTIPCGWEDVYQDALEKCPNGMPLLINGTKFFYHP
FT                   VKYRETLLDIFSTAKEKCAELMKNEPLNRKQLSELLENDIILFNVLFEWCLEDVEQPFF
FT                   DINRLKNKHHFKNVSIYFEEDDSPDALIRDFYYLKYFRVNNATAR"
FT   CDS_pept        543042..543338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0502"
FT                   /locus_tag="GK0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74787"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2P3"
FT                   /protein_id="BAD74787.1"
FT                   /translation="MTIEQQTNKEMVQAIEQYVEQESEKWAQHVLSNAKTVDDLMTALW
FT                   EHGKVKKDGTEVERMLHRLIYERGASRIKALMTEIETLTLKRALSPKGDSAIR"
FT   CDS_pept        complement(543335..543700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0503"
FT                   /locus_tag="GK0503"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0503"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74788"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2P2"
FT                   /protein_id="BAD74788.1"
FT                   /translation="MDKYRLIELLNNCTELFHKTNSLYQETVNNPKNPSPIVSVYLSEI
FT                   YTLSEKAKLFLAMNEELAHYEITSLFNFWNDVYFELKEVIGQRDRNTSWLYSKFENYKR
FT                   QHEIVERMLKDQIQQLN"
FT   CDS_pept        543772..543969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0504"
FT                   /locus_tag="GK0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0504"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74789"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2P1"
FT                   /protein_id="BAD74789.1"
FT                   /translation="MNTIQDQWAMAELKHRLLVIIMQLKDDPAFTKDDAALEIAKVLDW
FT                   LNETAPVVDYQTMVRYYDAR"
FT   CDS_pept        544032..544259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0505"
FT                   /locus_tag="GK0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0505"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74790"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2P0"
FT                   /protein_id="BAD74790.1"
FT                   /translation="MKEFKYGNTTVIVHSPLVLMSPEERKQWFEQEWQKGNPILRQIAE
FT                   AVLDCYRSMDTVPQSLKDDGRKGSREDETR"
FT   CDS_pept        544246..544767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0506"
FT                   /locus_tag="GK0506"
FT                   /product="bacteriophage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74791"
FT                   /db_xref="GOA:Q5L2N9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2N9"
FT                   /protein_id="BAD74791.1"
FT                   /translation="MKRGRAADAVKEARQKTGMTQQQLSFEIYESRESVSHQENGRYRV
FT                   QPNISKYFAEKHNNPWVALEAAAEYTGWGPVKLDGDAVDLHRASVTMKTREELTEALEA
FT                   IESVCVANHPRSIREFDKQRLEEAMMQAIDAIVALTQYVAVICMDYGFSWWKMWQKHRA
FT                   KLQAKGFIRQ"
FT   CDS_pept        544785..544964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0507"
FT                   /locus_tag="GK0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0507"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74792"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2N8"
FT                   /protein_id="BAD74792.1"
FT                   /translation="MFQLPNLAEMTDLEAVHWYTSEFLRLSRERKLDSEYGKALLEWKK
FT                   QMNERLEKSRKEWW"
FT   CDS_pept        544964..545131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0508"
FT                   /locus_tag="GK0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0508"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74793"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2N7"
FT                   /protein_id="BAD74793.1"
FT                   /translation="MYVVWVASSLMTAREVQEVCAELRNHPELIEAIEQEAKAKLVSMK
FT                   EAASQTPTAS"
FT   CDS_pept        545323..545634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0509"
FT                   /locus_tag="GK0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0509"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74794"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2N6"
FT                   /protein_id="BAD74794.1"
FT                   /translation="MVIATTPGDHNEGGMAVIHMIVYQEADLRQKASRCIEYIQEALQN
FT                   RDYETMAIEISELQYLVRQLQELERKEARRQQLLSIIRDMQRRGIQIDFLKLGEERNA"
FT   CDS_pept        545892..546026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0510"
FT                   /locus_tag="GK0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0510"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74795"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2N5"
FT                   /protein_id="BAD74795.1"
FT                   /translation="MFYLWHHRKVLTIDELANRLNREPKAVYEKLKQLLQKGGISDAG"
FT   CDS_pept        546016..546243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0511"
FT                   /locus_tag="GK0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0511"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74796"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2N4"
FT                   /protein_id="BAD74796.1"
FT                   /translation="MLVEKGGPEAPILRYASRVKNMLFEVEFVVKENGHFETIQTALVY
FT                   ALTVTECRRIADEMASEFEVDGIQFFISEL"
FT   CDS_pept        546292..547287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0512"
FT                   /locus_tag="GK0512"
FT                   /product="bacteriophage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0512"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74797"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2N3"
FT                   /protein_id="BAD74797.1"
FT                   /translation="MATLLLDDQPLVILPQLAVAIGLNESIVVQQLHYWLEKSENVHDG
FT                   YKWIYNTYEDWREQFPFWSESTIRRIITKLEKIGIIVSANFNRSRIDKTKWYRIDYDKL
FT                   AEFTSSNQDEQTTDQNDVSTVQNEQTTDEIDSPSGQNEQSICSNWTDEALNLNRPIPEN
FT                   TTEITTEKKEEVEEDARAHSFREIIQFVEQNGFGTVGSYIGEKIVSWVDDTSEELVLEA
FT                   LKIAVENGAKTWKYVETILRDWFEKGYRTVDQVRAAQLAFREQQLKKRQASTSSDSGRK
FT                   IRTPVRTEIVPDWLKMDYSQPEDDDFDVEQARRELEERLKKYKDDPEGWY"
FT   CDS_pept        547514..547702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0513"
FT                   /locus_tag="GK0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0513"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74798"
FT                   /db_xref="InterPro:IPR025072"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2N2"
FT                   /protein_id="BAD74798.1"
FT                   /translation="MLMKYALIQHLRRKGIFSASDGRALSKLTTEEIQREYERVRGDQS
FT                   HGLVQGDRTATGDHHSL"
FT   CDS_pept        547771..547941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0514"
FT                   /locus_tag="GK0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0514"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74799"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2N1"
FT                   /protein_id="BAD74799.1"
FT                   /translation="MKKQRQSLHGPMKISYLTPEELETYRNRPRKKYYDEDNRRTIDWR
FT                   WPQNRKKRGAK"
FT   CDS_pept        547941..548423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0515"
FT                   /locus_tag="GK0515"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0515"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74800"
FT                   /db_xref="InterPro:IPR014871"
FT                   /db_xref="InterPro:IPR016947"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2N0"
FT                   /protein_id="BAD74800.1"
FT                   /translation="MDLSKLFEMQRELDERIVREKGLDGQNLLPNKVLALQVELAELAN
FT                   EWQGFKHWKTNRQPKEGMLEEYVDCLHFILSIGLNGNIGTIEWEQIEPYKAKSTIQQFI
FT                   GLFEYTSRLLEDITVYVDIWSSFIGLGEMLEFTWDEVEAAYMRKNAVNHHRQESGY"
FT   CDS_pept        548425..548685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0516"
FT                   /locus_tag="GK0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0516"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74801"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2M9"
FT                   /protein_id="BAD74801.1"
FT                   /translation="MDAKHWMEELNKNQILRNVQKLLEIQTEKGIEKYGTTVNPSDYTL
FT                   IGWLEHLQQEMIDAIVYCEVLKFKFAHLIALEKLNSDVNDE"
FT   CDS_pept        548902..549090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0517"
FT                   /locus_tag="GK0517"
FT                   /product="phage-like element PBSX protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0517"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74802"
FT                   /db_xref="InterPro:IPR035530"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2M8"
FT                   /protein_id="BAD74802.1"
FT                   /translation="MQIDIDSMTVSHPVVPGKVIVIIVDGVQGKAKVAEAVEHGYTIIE
FT                   TAKGKTARIKYEESELF"
FT   CDS_pept        549339..549542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0518"
FT                   /locus_tag="GK0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0518"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74803"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2M7"
FT                   /protein_id="BAD74803.1"
FT                   /translation="MDEELIIGKLAYKKQGFFSGLVGTIQENDNGITPYKLVFRSGVAV
FT                   GIRGKDDIVIVGEEDRKNITEK"
FT   CDS_pept        549595..550335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0519"
FT                   /locus_tag="GK0519"
FT                   /product="phage associated-antirepressor"
FT                   /db_xref="EnsemblGenomes-Gn:GK0519"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74804"
FT                   /db_xref="GOA:Q5L2M6"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2M6"
FT                   /protein_id="BAD74804.1"
FT                   /translation="MNQLQKVFIYSGSQVRTIIKDDEVWFVAKDVCEILDIADARKAVQ
FT                   RLDEDERSLIPVTDSLGRKQETFIVNEPGLYTLILGSRKSEAKQFKRWVTHEVIPTIRK
FT                   TGGYVANDDLFVETYLKHADEQTKLLFRATLETVRKQNEQIAAMQPKADYFDALVDRRL
FT                   LTNFRDTAKELKIKPKAFIDWLLEKKYIYRDQKGKLKPYAQYVPSLFELKEWERNGRAD
FT                   VQTLVTPKGRETFRILLQKAAVLI"
FT   CDS_pept        550452..550640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0520"
FT                   /locus_tag="GK0520"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0520"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74805"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2M5"
FT                   /protein_id="BAD74805.1"
FT                   /translation="MRTMKDQMQKWIKANNMAYRSERNRKERKRNKERLTEREIKELMG
FT                   VCRPVYRRGKGGAFRQR"
FT   CDS_pept        550652..551104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0521"
FT                   /locus_tag="GK0521"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0521"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74806"
FT                   /db_xref="InterPro:IPR006524"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2M4"
FT                   /protein_id="BAD74806.1"
FT                   /translation="MREFMLPEIDRAATKRAVEAALEKYRVYLLTLRLDEMPRVTQCYS
FT                   LVPTSSNQFRSSTESIAIRNVDYEREREEYIRRITSAVNRLSKWERAIIVRRYMSFEDV
FT                   YDYEVYPELGMSERKYYRLKSRAFYKLAFALKIEVYREEKSEVTLS"
FT   CDS_pept        551101..551643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0522"
FT                   /locus_tag="GK0522"
FT                   /product="site-specific recombinase (phage integrase
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0522"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74807"
FT                   /db_xref="GOA:Q5L2M3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2M3"
FT                   /protein_id="BAD74807.1"
FT                   /translation="MNFVQPIRDPEKIAAMKKYLLQRSKRNYILFVLGINTGLRISDLL
FT                   QLKKEDLLQTHLKLREKKTRKEKRIRIPPSIRKELIEYAKTLKDGEYAFRSRQGGNRPI
FT                   DRSTAYRILREAAEYVSLDEVGTHTLRKTFGYHFYQQTKDVAMLQELFNHSSPHITLKY
FT                   IGVNQDAMDKAMLKYKI"
FT   CDS_pept        551788..552081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0523"
FT                   /locus_tag="GK0523"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0523"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74808"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2M2"
FT                   /protein_id="BAD74808.1"
FT                   /translation="MLVEEAKKRIEYLQDYIRKIESYTPTTMEEEAVYLYVQLESVTKV
FT                   VQELNKKGYRIGKRKLTTVDVSNMIRSKPKDEMHEMARRLFKKNRKRGSRHW"
FT   CDS_pept        552279..553022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0524"
FT                   /locus_tag="GK0524"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0524"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74809"
FT                   /db_xref="GOA:Q5L2M1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2M1"
FT                   /protein_id="BAD74809.1"
FT                   /translation="MESFISLLVFTLPGLLAYFWIQLFGLTPTVKHQSTEMLAISALLW
FT                   IPVVITVLFVYQLLAYVSSLDVIHLKVDVPILKKDWTMINKLSDIATLSDNVWFLLYFV
FT                   ASSIIVSFYLAKFICKKGYKKFLDKVNQVRKENGLAPLSENTTVWNEVFLGNEGQVVEV
FT                   YKIDKPDEKVIGCIKKVSRAFEPEKNIVLEGVEHWTKVMEHYEVETEDAFIDTKTGLVI
FT                   KIYNLEQALEAQDLYNKKVSNSTTS"
FT   CDS_pept        553466..553711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0525"
FT                   /locus_tag="GK0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0525"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74810"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2M0"
FT                   /protein_id="BAD74810.1"
FT                   /translation="MAIVTNAEEKFKIVIENLPSDYSETDFIEKFKELYPKDWNKILRR
FT                   YEEHERRARKQKKRSHPMPNPEKYLLNISHKIRGKK"
FT   CDS_pept        553920..554273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0526"
FT                   /locus_tag="GK0526"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0526"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74811"
FT                   /db_xref="GOA:Q5L2L9"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2L9"
FT                   /protein_id="BAD74811.1"
FT                   /translation="MVLMNNQQYYDKYKRNKEAKKFYNSTAWRKCREYVLKRDNYLCQR
FT                   CLRRGIIQPADVVHHKEHLEDNPAKALDPENLESLCNACHNEEHPEKGQKAKSEKKTRK
FT                   VRVIKSEANPLII"
FT   CDS_pept        554399..554764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0527"
FT                   /locus_tag="GK0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0527"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74812"
FT                   /db_xref="InterPro:IPR006448"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2L8"
FT                   /protein_id="BAD74812.1"
FT                   /translation="MSMKTIKPKKIIKNKEAKKLFQILIQELEKENNLNDRTLMIVDNM
FT                   VLLEQLKQEHMEDIKQRGVMELFKNGSQEMFRENKSVDKILKIVEQQRKLQAELKLTPA
FT                   SEKKVTEVVEVDDFEKF"
FT   CDS_pept        554745..556460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0528"
FT                   /locus_tag="GK0528"
FT                   /product="phage-terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GK0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74813"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2L7"
FT                   /protein_id="BAD74813.1"
FT                   /translation="MILKNSNVILTKPSDKLLTTWYAEQVVKGKIIASKKVKLACKRHL
FT                   NDLKRQGTKEFPWIFDEEKGHRPIKFIETFCRPSKGNFQSLVAQAWQHFIIGSLYGWVH
FT                   KDTGLRRFKEGLVFVGRKNGKSTMVSGLANYGCSKDGEKGADVYLLANSMKQARVIFEE
FT                   CQKMIWSSHLLFKHFRVLRDAIHYDKTFSKIEPQASDSEKLDGLNAHLAIFDEIHEYKD
FT                   YKLINVIKNSTGARRQPLILYITTAGYQLDGPLVDYYSKAADVLDGVIEDERSFYFIAE
FT                   VDEGDDIEDPKNWIKANPNIGVTLDLDTLIEEWNARKHIPAERNDFITKRLNVFVKSDE
FT                   QSFLDYEVIKRNDKTIDIEKLVGMPCIGGFDLSQTEDFTSACLEFWLDTREIFVLSHSW
FT                   IPRKKVIADNEKIPYHEWEKEGLLTICEGDYVEYEKVLNWFIEQSKRFCIELITYDPAN
FT                   AFRLVKDLENYGFKTEVVRQGAITLSPALKDVKELFLDGKVIFNNNRLFRWYINNVKLV
FT                   EDRNGNWLPTKQNRYRKIDGFMAFLNAHTEVMKRMTAPKGDGNISVITMSDLLK"
FT   CDS_pept        556483..557697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0529"
FT                   /locus_tag="GK0529"
FT                   /product="phage-related head portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0529"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74814"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2L6"
FT                   /protein_id="BAD74814.1"
FT                   /translation="MRWVTRIKNAIRGAITGWKGSGFDFSNWFGRTFWGIDNSTLATNE
FT                   TIFSVITRLSNSLAMLPLKLYKNYDLAVNQAADVLINSPNPNMTSFEFIRLLETVRNQT
FT                   GNSYALIGRDIRGQVERLTPLDPAYVEPVIETESGELWYQVIGNNGTYYFHNLDMLHFK
FT                   HIIGAGGLKGINPIKVLTNTNDFDKAVREFSLKEMQSAPNSFILKYGANVDEKKRQQVI
FT                   EDFKRFYRDNGGILFQEPGVEIDPIERKFIAADIFTSERITRSRVANVFNIPVHMLNDS
FT                   EGQSYSSMEQMMREFVQLTLMPIVRQYEQEFNRKLLTPAERQAGFYFKFNVNALLRGDT
FT                   AAQSDYYTKAIRSGWMKPNEVRQLEDLPPEPEGNKLWISGDLYPMSMDPTQRKGVSKSE
FT                   NGTKE"
FT   CDS_pept        557675..558442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0530"
FT                   /locus_tag="GK0530"
FT                   /product="serine protease (phage related-protein, ClpP
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0530"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74815"
FT                   /db_xref="GOA:Q5L2L5"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2L5"
FT                   /protein_id="BAD74815.1"
FT                   /translation="MKTEQKNKFWEIKMSADGSNSADIFIYGDIVSYQWDETDTSAASF
FT                   KKDLDAVGDVDTINLYINSPGGNVFEGVAIHNMLKRHKAKINVYVDALAASIASVIAMA
FT                   GDTIHMPKNAMLMIHNPWTWTYGNAAELRKVADDLDRIGNSIKQTYLQKAGDKLTEEKL
FT                   QEMLDAETWLSADEAYEHGLCDVVLEASQIAASISDELFSKYKNVPKQLKNQVKNCQKT
FT                   VISAEEMAKRRQIAEESKANLAYINTILGGMLG"
FT   CDS_pept        558439..559572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0531"
FT                   /locus_tag="GK0531"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0531"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74816"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2L4"
FT                   /protein_id="BAD74816.1"
FT                   /translation="MKTLYELKQNLATIGQQLQKVENQLAEKAVDPNATMEEIQALQKS
FT                   RDDLKMRFDVIKQQHDALEAEQKAKFEANNNLKSIDNPKERIIKAKAELIRATMQGKPV
FT                   PVDVRAALGDRNSTGGEKFLPKTLSTEILTEPFVKNPLREISTVTQITNLEIPKLSFTL
FT                   DDDDFIADTETAKELEATGDVVTFGRHKFKVFAGISETVLNGSDSNLVMHVERALQSGV
FT                   AAKEKKVAFATTPKTGEEHMSFYSTGIKEVTGENLYKAIKAAIADLHEDYRENAKIVMR
FT                   YQDYSDMIETLANGNATLYTAQPEQILGKPVVFCDSAVNPVVGDFSYSHFNYDLTVLYD
FT                   RDKDVKTGIELFVITAWFDHQIKLKSAFRIAKVAPQV"
FT   CDS_pept        559591..559866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0532"
FT                   /locus_tag="GK0532"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0532"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74817"
FT                   /db_xref="InterPro:IPR006450"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2L3"
FT                   /protein_id="BAD74817.1"
FT                   /translation="MPNISLNEVKNYLRIDGSEDDAILTLLIDGAKEYLKNAGVPESDS
FT                   ALYKLAVMLYVALHYENRDPSAKMDKLNFAFESIVLQLKDYGGDTS"
FT   CDS_pept        559863..560063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0533"
FT                   /locus_tag="GK0533"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0533"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74818"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2L2"
FT                   /protein_id="BAD74818.1"
FT                   /translation="MKQYLVLNDFIDRFTKEYYPKGSMYSTNDAERAEELQQKGFLGDE
FT                   VKQPANRKGKGKNADEDRETE"
FT   CDS_pept        560035..560376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0534"
FT                   /locus_tag="GK0534"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0534"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74819"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2L1"
FT                   /protein_id="BAD74819.1"
FT                   /translation="MPMKIAKLNKRITFQRKTRVQDNEGNWVEGYEDAFTVWGAIEGGG
FT                   SMRNPEVTIAGALGIRAPRKITIRANKQLSHDMRAICDGRIFNVLDFSYAKNSKSYIEI
FT                   ICDEVGING"
FT   CDS_pept        560369..560755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0535"
FT                   /locus_tag="GK0535"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0535"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74820"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2L0"
FT                   /protein_id="BAD74820.1"
FT                   /translation="MANFEFDGIDELGQFFEKLADDIDKLDNQALKVGGEIIAKYQREN
FT                   VNRSDKNQPHIQDNITVSKPKETDEGKFVEVGPNKKVAWRAKFLEYGTSKMPPYPFVEK
FT                   GADEGEAEALEAMEKVYMDMIDRA"
FT   CDS_pept        561151..561729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0536"
FT                   /locus_tag="GK0536"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0536"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74821"
FT                   /db_xref="InterPro:IPR006490"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2K9"
FT                   /protein_id="BAD74821.1"
FT                   /translation="MGKIISGLDMFHIAQLIKDDSSGVQYATPEAVPGAVSIKVDPKTE
FT                   SETVYADNSAYAVLNSIGDIDVEMEATDLPLDIQQKLFGHTVENGVQFASIHDETMELA
FT                   LGFRAKVSTGGYRYYWLLKGKPELLPIEGKTEEGKPSPQTAKLKLKFMPLQYNGRWKAQ
FT                   AEDGTEFTQGNKWFDQVVYEGSVLNQTGA"
FT   CDS_pept        561790..562122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0537"
FT                   /locus_tag="GK0537"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74822"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2K8"
FT                   /protein_id="BAD74822.1"
FT                   /translation="MKSLSITLKIDGKDKRFVTPAFISGKLFRQASEIAEEIESANSEK
FT                   FDLDKYLQFVCDAFGNKFDVNQLEEGLDARMMIKTIFAVVNYVIGNIEKASALLAQDEE
FT                   GGEAKN"
FT   CDS_pept        562125..562289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0538"
FT                   /locus_tag="GK0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0538"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74823"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2K7"
FT                   /protein_id="BAD74823.1"
FT                   /translation="MREAVLDMYNALLEIGFTQNQIDDMDIVYHLQLLARRKQEVKKDE
FT                   VVYIDQVLG"
FT   CDS_pept        562303..567996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0539"
FT                   /locus_tag="GK0539"
FT                   /product="bacteriophage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0539"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74824"
FT                   /db_xref="GOA:Q5L2K6"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2K6"
FT                   /protein_id="BAD74824.1"
FT                   /translation="MAKDIRVRLYSNSKEFNSEMNAIAKQMRIVKSEFEATRTSVGVWG
FT                   DALKQSEAKIQYLTKQIELQKQKVDQLKKAYEDAATKKGQDANETQNLARRLNYATAEL
FT                   NKMQNELTQTNQKLNQFRENQSINQFENDIKSLSLAMQKVDAEFKVASSAAENFGNELK
FT                   QAGLQIQSLNQKIELQQQVVNRLEDEYRRVAQAKGQDANETKQLAIRLNEAKAELNGLQ
FT                   NELTQTTQKLNQMEREVAKQSTVWGKFTSNMDTIGNKMQHIGGSVAITAGAGFATLSFA
FT                   MKDAVSVGMEFGKQVSRVGAISDATAEQIQQLKDQALDLGASTSKSATEIAQAQEQLAA
FT                   SGFKVNEILAAMPGVIAAAEASGEDMATVSEIMAAAIRGFGLEASKSAHIADVFAMAAN
FT                   RSNASILDMGYSFKYAAPIAKQLGISVEELAAVTGLLRDRGMAAEQIGTSLRMGLTRLV
FT                   APTQEAGEVMKELGINIKDAEGKMLPLSEVIGILRDKTKDLSQEQKLYAFQTIFGTEAM
FT                   TGFLNLVDAGPQQIAELTQALRESDGASQKAATTMKDNLAGAVENMNGALETAKIKLTD
FT                   ALTPALEGAVNSITKLIEKWNSLDSGTQEVIAKTGALSVAIMGVVGVVGTLTAAVGALL
FT                   TFSGPIGLAIVGVTAALGALGLGLFAAHEKTEQLRKKQEEAERQAIRYGEGLSAGTKKA
FT                   VQGYTDLYEGAKLKMIELQTMSGEKARATSKEVVDAFSKMADQVIAALQTQKEKLVNAI
FT                   NDVYGIAGDAGKKKAKDMTDEIIKSFDKDIAAYKKALDTLKEAHEKYNNDLSKMPAEFA
FT                   AKYQEALKVMEGGAREFAQSQNELQAIQKSIIDKQGKILFDEAEGYVKRINETYQKSVA
FT                   AANKWYSEKQKVFEQALAQGRISQQQYDQLMLGVEARTNEMLAKAAQERDKSLSTLASH
FT                   LDQRGKLIDIATGKIFERQKKFLTDMNGFIVQVEESDKEYIERWKAHTEEVLEKTADFS
FT                   EKTKSQYQKDLAAFLQGTGMTRQEAVKMAKQMVDETLAEMKKGNKEAEKAGKDKGDSHK
FT                   KGIESTVADNKKAGEKVSKNTDDGLSQNKPNAQKHGKDKGDNHKKGVESTAGANKVAGA
FT                   NVSKSTDEGLAQGKGDAQKHGIDKGTKHGQGLKSTEGSNRSIASAISSLVSKILGSTTD
FT                   GGGGKKAGSTFASGLSSQKGAAQSAGSSVSSAAEKGLKSHDGRDAGEGFVSGFINAILS
FT                   KNGSVWSVAWNLGKTALSALKKSIDSHSPSKETEKEGKNFVEGFAIGVKKNTKSAASAT
FT                   QKMANEAKKAFEESFKNAQYKFKMGKIDETEYLRQLRALLKQAKTADQTRKVNLEIKRV
FT                   QDAKAKKDEEMARRLFEQGKQAIEYQKQIRNVSLEQELQWWNNLAKKFKEGTKERLEAE
FT                   KEVARVKEEITKRNFENEKRWFEEKKYYGQLSLAQELESLNTVAKRYKEGTEERIYWER
FT                   EIYRVKKEINDRLLEANNEYAQKVKEINERLQQDELKAKEEYEQKVKEINDRLIAEEQK
FT                   LTEEYEKAVEDRAKSLYSFAGLFDEFKRKNDVTGQRLLKNLSDQVSAFKDWQTNISSLA
FT                   ARGIDEGLLQELRDMGPKAVDEISALNSLSDEELQQYVQLWREKNALAKAQAVNELEGM
FT                   RQQTQLKIQQLRYTASLELEQVKTEYVNKIAQLRAQAAAELEQHKNEWIAKVKEISEGT
FT                   KTELNLMTASMADIGKNTVQGLIDGLNSMMGPLQQKAKEIANIVESTMKTTLKIKSPSQ
FT                   RIRDEVGRWVPAGLIEGMKEKTGSVMAAAKQLALAAIPDFSSVSDELANRINKMAFTIG
FT                   SAANAIRMNSDVLIVKNQIESPNLENKLDRLLLLLERSLLNKNVQPTINQYLTINSPKE
FT                   LSPSEIARKNLQASRQLAMEMGW"
FT   CDS_pept        567998..568867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0540"
FT                   /locus_tag="GK0540"
FT                   /product="phage-related protein (tail protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0540"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74825"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="InterPro:IPR038675"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2K5"
FT                   /protein_id="BAD74825.1"
FT                   /translation="MQRIVFTNARGQSVELKSSAPFLLQSIDGLGDVDADIQTQKAPFQ
FT                   DGSTYIDSVLQERPISMQIAILARDTATLLQHRQYLAAVFNPKLGPGTLRYENDEIVRE
FT                   IKAVPDGVPAFPSGKENRGPRFQKALVNLLCPDPFWLTEEKVDQLVVWEGGLEFPLELP
FT                   AFFAQQSDNKAKILFNGGDEKTPIFVTFHGPATAPIKIMNVTTDEFIEVNQSLLVGERL
FT                   EINTAFGQKRVTKILADGTEVNAFHYISLDSTFFQLIPGNNLLDYSTGADYERAAVTIT
FT                   WRNRYLSV"
FT   CDS_pept        568880..569566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0541"
FT                   /locus_tag="GK0541"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0541"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74826"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2K4"
FT                   /protein_id="BAD74826.1"
FT                   /translation="MAEEYGFFNSVNGDRKYDMEQFATYFKQFLSNGIYHTNNVPALRV
FT                   SHVSGMQTKLEPGSAYIEGYMYRNTEDIIFTHEAADPTNTRIDRIVLRLDRSVNARYIK
FT                   AFVKKGTPATNPQPPALQRDDIVYEISLAQVRIEAGKTTISSVKDERLDPNVAGLVSSL
FT                   ITVPTEQFLDEWNSWMAEMNEKKEDYQAAWESWFNGIQNQIGVRLLTGSSEPSGAVAGD
FT                   IWLKTV"
FT   CDS_pept        569576..570931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0542"
FT                   /locus_tag="GK0542"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0542"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74827"
FT                   /db_xref="InterPro:IPR029432"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2K3"
FT                   /protein_id="BAD74827.1"
FT                   /translation="MRPVRILTSSFQLLGEIDDYESLQFIRRFRKPGEFELHINMNKNL
FT                   TETLQEDSLVFLSPRKVGVILHRELSRDNTEQLVVKGYTLQGILSRRITVPPVGQAYDK
FT                   IKDNAETVLKHYVRQNAVEPADPNRIIPNLVIADDLQRGLIVDWQSRFKNLVDELESIS
FT                   FSAGIGWDVFLDLQQQKWVFEVYVPRNLTTSQNTLPPVIFSVDFDNIKNQTFTDSAINY
FT                   KNYGYIGGQGEGEDRAVVEVGNASGLSRIETFIDARDIEEGENLTTRGQQKLQEMQKIL
FT                   SFESEILTYGPFVYEKDWDLGDIVTVQDKKWGITLDTPITEIKEIYEPGGFRLEATFGN
FT                   TVPTLIERIKKTIDVPMVEKPIKTSVPTKLSELENDAGYITIDDIPQQQPFIHEQLSPS
FT                   NLWVINHNLSKYPSVTVTDSAGNVVIGDVKHVSLNTTEISFSAAFAGKAILV"
FT   CDS_pept        570945..573557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0543"
FT                   /locus_tag="GK0543"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0543"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74828"
FT                   /db_xref="InterPro:IPR005068"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2K2"
FT                   /protein_id="BAD74828.1"
FT                   /translation="MQFLTNIDLSKNELQNARIQNLATAPANPVAGQIYFNSTDKKFYG
FT                   YNGTGWVDLGQVLTGDSIISLLNTSASKIDDDNLSANVNDAISKRHSHANKAVLDAIEA
FT                   AYTAAEKNKLAGLPEIKQGLEADRPAATGSGMVYFATDTKKIWKDTAPNTWTQMGGQDT
FT                   IDWSAVTGKPSTFTPPIASATQLGGIKVGANLTILPDGTLNANDNPASFIRKQERFTVA
FT                   PGQNVFNLTQGTYKPGTNAVTWFLDGIKQDDRAMIELSPTSIQIDGLPEGADVMFEYYE
FT                   VINWHPFPNHANEHLTGGADPIPLATPTSDGLMPKDALAKLNGISPGAEPNQNAFSNVK
FT                   VGATTIAADSKTDTLELVAGANISLTPDAANDKVTIAVTGVAQNAFPNIKVGATTVSAD
FT                   SPTDTLELVAGSNVILTPDATNDKITISANVPVSSVNGKTGAVSLTASDVGAETPSGAQ
FT                   AKVDAHAADSVKHITDTERNAWNNKLDASEVVTSPTPNKVLKLDANGKLPASITGNADG
FT                   NAATATKLQTSRTISLTGDATGSTSFDGSANASIAVTLANTGVTAGTYPKVTVDSKGRV
FT                   TAGQALSPSDIPNLDWSKITSGKPTTLAGYGITDGVQNTGGAPSIQAGADASKPTAGVA
FT                   GRLYVATDTKKIYRDNGTSWDVIGTINWADIVGKPSTLSGYGITDAIPASQKGAANGVA
FT                   SLDGGAKVPASQLPSASTSAPGIVQLVDSTSSTSTTQAPTANAVKTAYDRAVSAENNAK
FT                   SYTDTKIANLVNSAPSTLDTLQELANALGNDPNFATTIMNQLALRTKKYVATIGDGTTT
FT                   TFTITHNLNTQDVVVTVRENASPYNVVFADVQITDNNNIKVLFATAPSSNQYRVVVVG"
FT   CDS_pept        573574..573810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0544"
FT                   /locus_tag="GK0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0544"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74829"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2K1"
FT                   /protein_id="BAD74829.1"
FT                   /translation="MKLFGLEFKINGFDIWHKGNLTKLSQLTNDVGYATTSQIPTKLSQ
FT                   LQNDIGAGGGVKITTSPTAPSNPSPGDFWYKEV"
FT   CDS_pept        573814..574182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0545"
FT                   /locus_tag="GK0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0545"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74830"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2K0"
FT                   /protein_id="BAD74830.1"
FT                   /translation="MADKNIQMTQRNASNTGWDNLYPITKAENVLTQDGSNLAAYLYNN
FT                   FQIYKSGKDSNGIFTIVEYKRADGTLYARSVLSGGTSPQYTTRTITYYAANGTTVLRTD
FT                   TYTLTYDTDGDLISEVKQ"
FT   CDS_pept        574182..575189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0546"
FT                   /locus_tag="GK0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0546"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74831"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2J9"
FT                   /protein_id="BAD74831.1"
FT                   /translation="MPLIDIRAHGGVFGGGKYRKNSKIPAGALTDLQKTTYSVNDTNIY
FT                   VVSVSPNGIYVAFSHQFAQTIRVYDAKTRQFIRQINVPDDYSRNDFIINDDGSIYYKYK
FT                   VDLVKLNADGSVAWRKTHSYNVGGLVPMTDGSVIIFLNDGKTCIRYAPNGSVIFSRTSQ
FT                   SIDYNSTSVGWNLKGDVFTSPNMTYIAKINTSTGVQIGSIYISVNGSTIIGALAVSPSG
FT                   NYVSATYWDNSHQVRRYKGDLSTNTPVAVTNIFDTVSTYRSFLMLNDNQLLMGAGSYTV
FT                   LKLLDFVALSWSDYETGFASGPVYVDMDLDGNLYLSASGGSAWRKVERYYTLLR"
FT   CDS_pept        575202..575528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0547"
FT                   /locus_tag="GK0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0547"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74832"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2J8"
FT                   /protein_id="BAD74832.1"
FT                   /translation="MIYLYDLQKVTDTDYIVCGYHMMPFDEKYGLGKTKEQLEAEGGIF
FT                   VDDLPQREYHEGKTPILHINPRTKEMWYEYQEVRNPITDEVDTLKERIALMQQVLDDLI
FT                   LGGM"
FT   CDS_pept        575742..576161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0548"
FT                   /locus_tag="GK0548"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0548"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74833"
FT                   /db_xref="GOA:Q5L2J7"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2J7"
FT                   /protein_id="BAD74833.1"
FT                   /translation="MKHNTNTLYTTITGGSASAIAYLIGGVDHLAIALGIMMAADYISG
FT                   LMVAVGTKEVSSKTAFRGLMKKVAMILAVIVANQLDAVTGSGDFMRNTMIMFLIGNEGI
FT                   SFIENLGRLGVSIPGQVSKVFVQLKSENQKGENKQ"
FT   CDS_pept        576158..576838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0549"
FT                   /locus_tag="GK0549"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0549"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74834"
FT                   /db_xref="GOA:Q5L2J6"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2J6"
FT                   /protein_id="BAD74834.1"
FT                   /translation="MSVWTEKFIRVNKYSRPGLKLKGVKKLVLHWTANPGASAANHFTY
FT                   FDRTIIQAQRYASAHIFVDKNEAINIIPLDEVAYHANDGTYRGVPELKPNANFLSIGVE
FT                   MCVEKDGTFHPDTISRTEDVFVELCKTFKLDPIKDIVRHYDITHKNCPAPWVKDSKAFE
FT                   DFKQRVKAKMSPPKANVSYYTVKPGDTLSGIAAKNKTTVATLQKLNNIKNPNIIRVGQK
FT                   IRIK"
FT   CDS_pept        576964..577311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0550"
FT                   /locus_tag="GK0550"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0550"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74835"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2J5"
FT                   /protein_id="BAD74835.1"
FT                   /translation="MGAKNKVIAGEYEGKNVMLIHGAVCIMTGFTKKVELTKENVEEYE
FT                   LLDETNNKSAVSAVSRGLVGSFLLGPVGLLAGLSAKTKGVHVVAIKFKDGKKSLLEVNE
FT                   KIYAALMKNLF"
FT   CDS_pept        complement(577320..577538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0551"
FT                   /locus_tag="GK0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0551"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74836"
FT                   /db_xref="GOA:Q5L2J4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2J4"
FT                   /protein_id="BAD74836.1"
FT                   /translation="MTGYKCMLKVILAQESIKHGEFAKRINISPGTLSAIVNDKQLPSF
FT                   NVAYAICEELGMPINEIWIKKEPTQSG"
FT   CDS_pept        577917..578240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0552"
FT                   /locus_tag="GK0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0552"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74837"
FT                   /db_xref="GOA:Q5L2J3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2J3"
FT                   /protein_id="BAD74837.1"
FT                   /translation="MIFKRQTEIIPFGKFMAKKRTKEKPSIVVPALFPVITQHHLFPVQ
FT                   DPDFVLLMAGVGAITLSAFIERGLVMMGMIDVAEKVTDCGRVVFPVIVYGAVLWLFFSL
FT                   GGM"
FT   CDS_pept        578452..579420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0553"
FT                   /locus_tag="GK0553"
FT                   /product="DNA segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0553"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74838"
FT                   /db_xref="GOA:Q5L2J2"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2J2"
FT                   /protein_id="BAD74838.1"
FT                   /translation="MFQQVFGQHVQLEGDYKRFTLTIYHRGLPNELSYSFEKIKPHLEG
FT                   LALPIICGMDRYGKYIAYDAIQEPHLLIAGESGSGKSTQLRSILTTLIQYYDENRLHIY
FT                   LADLKMSEFHIFKRCRQVKSICTTPEQIERMLARIQSEMKRRSKLLNEKEVAHINDLPE
FT                   AERPPYILVCIDELVIVKDNKDVMNALVQLVAIGRALGIIAILSMQRPSHDILDTKIRT
FT                   NLTVRMGFRTDSVTNARIIGTPGAEKISIEQRGRFLLKREDLIELQAPFLPLERAKKIL
FT                   ERYKVVEQKDVLPRGLEAASPQGDVSEEIILGVLDDATDQT"
FT   CDS_pept        579401..580081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0554"
FT                   /locus_tag="GK0554"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0554"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74839"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2J1"
FT                   /protein_id="BAD74839.1"
FT                   /translation="MPLTKRDKAIIADLQRFRVMSRDDIAEIHFKGLKRPQESANNVLL
FT                   RLVRDGHIQRSTAFIPYVYFCAESNIKKNSQKIPHYLEIVKTYKEILSFSPIETFVVEP
FT                   KYKKGLAEPDAFFIYQRTPFFLECQRSIYSEKIIEEKLNRYLALYESGIIAGEPWQPAG
FT                   KVVFPYVLIISDTRYALNRQYPFRVFQAQSFSNFLRSLKQPQQPQQPYSDIKVAGARLK
FT                   LRDQ"
FT   CDS_pept        580097..580270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0555"
FT                   /locus_tag="GK0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0555"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74840"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2J0"
FT                   /protein_id="BAD74840.1"
FT                   /translation="MDKLIVKLLVLHAFVADQKREYAKMETEDVVEQAFAEGIVAACEF
FT                   FEEALEHMMDYR"
FT   CDS_pept        complement(580527..581219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0556"
FT                   /locus_tag="GK0556"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0556"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2I9"
FT                   /protein_id="BAD74841.1"
FT                   /translation="MIRYWKLLFSLAVASVLLVGCGTKEHETTQAAKEEQTADDQKPSS
FT                   DAPSSKNPSPSKEAKEQTSTKKNEEEQRAAGGGQPAASQPTISLSYQDGNQTVTKTATL
FT                   QTSNNQHFSLYVLEGWTLDAEEPGADVLLHGDAFARIRLLSEGETNYEQLAQEHAQAVD
FT                   ANAARQQTNGLPKPFADAVWYTAQADGVTVHVIASAQPTPMLLTVHAPSSEDVLGAVLA
FT                   MVATLQKQ"
FT   CDS_pept        581378..581695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0557"
FT                   /locus_tag="GK0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74842"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2I8"
FT                   /protein_id="BAD74842.1"
FT                   /translation="MVQTNYDVERELEALERLRMRQMDGLIVCSREVGWEAFAAYQEDG
FT                   PIVLCEHVREHDFLAVYTVALPHFQLGGKAFRLIHHWLETGNVTRKQEELPARLLVRDT
FT                   A"
FT   CDS_pept        complement(581754..582434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0558"
FT                   /locus_tag="GK0558"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GK0558"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74843"
FT                   /db_xref="GOA:Q5L2I7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2I7"
FT                   /protein_id="BAD74843.1"
FT                   /translation="MYRVLLIEDDPMVQEVNRQMIEQVDGFTVIGLARNGEEGLHLIHE
FT                   LRPDLAMIDIYMPQLDGLETLKQIRARGHEVDIIAITAASDIETVRRVLQNGAFDYIVK
FT                   PFKFERLKQALENYRTFRRSLAEKESLTQVELDALRRATEQPAGPSSELPKGLNEVTLE
FT                   KVIAYLRQHRFPVSAEEVAEGVGIARVTARRYLEYLEKTGKVVLDVQYGGVGRPVNRYH
FT                   LKAT"
FT   CDS_pept        complement(582498..584075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0559"
FT                   /locus_tag="GK0559"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0559"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74844"
FT                   /db_xref="GOA:Q5L2I6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2I6"
FT                   /protein_id="BAD74844.1"
FT                   /translation="MNRLPIRWKITILIFAIVSFSMLLSGVFIISDFFHTKEEELSQRA
FT                   LLTARTVSEMPEVRRHIVENKQSRALINPVVERVRVIHSADYIVVLDMNKVRLSHPLPA
FT                   MIGTISRGADEGPAFAEHTYTSKARGEIGTVVRAFVPIMNSDHEQIGVVIAAYRLPTFF
FT                   EAIDSLKEEAAVAVVLSLVVGGIGAWLLASHIKRQMFELEPHEIAKLLIERTEAFNAMH
FT                   EGVIAIDSDEKITIFNDRAKQMLGVKGDVIGRSIRSIIPDTHLPEILEVNKPIYNKELQ
FT                   IGNLTIWSNRIPIKVNGKTVGAIAIFQDRTEVKRLAEELTGVKAFVHALRVQNHEYMNK
FT                   LHTIAGLIQLGHIEKALEYVFQVTEEQAELTQFLSRNIKDESISGLLLSKIRRGKELGI
FT                   RVTIDRHSRLHRFPPHLDHHDFVVLLGNLIENAFDAFRGVTDREKEIYVSLEQNEEICS
FT                   LSVEDNGQGIAREHIDRIFDEGFSTKGENGRGIGLYLVKQIVEKGNGRIDVQSEEGKGT
FT                   VFTVTFDM"
FT   CDS_pept        584388..585428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0560"
FT                   /locus_tag="GK0560"
FT                   /product="C4-dicarboxylate transport system
FT                   (substrate-bindindg protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0560"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74845"
FT                   /db_xref="GOA:Q5L2I5"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2I5"
FT                   /protein_id="BAD74845.1"
FT                   /translation="MGKKWRAWTILLFVGLGLVGWAASRQLGREPLVYDDEQKGLKKQI
FT                   IIYFSHVVAENTPKGLAAQKFAELVEQKTNGRVKVEVFPNGSLYSDGEELDALLRGDVQ
FT                   MIAPSFSKVTELVPEWQVLDLPFLFRDEDDVRRVFTGKVGAELLRMLEAKGIKGLAFWS
FT                   NGFKQMMSTTRPLIAHDDFRGLRFRIMPSEVIEKQFRLLGGEPVAVSFDRVYQELEQHK
FT                   FDGQENTISNIYSKGFYKFQPYITISNHGYLGYAVMMNQSFWDSLPKDIQQKITEAMAE
FT                   ATRWNLEQSKEQNERELKQLERREDVFLYRLSEEEKRKWEQKFAPLYDEFTRQFGSGLL
FT                   NEIRGS"
FT   CDS_pept        585409..586851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0561"
FT                   /locus_tag="GK0561"
FT                   /product="C4-dicarboxylate transport system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0561"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74846"
FT                   /db_xref="GOA:Q5L2I4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2I4"
FT                   /protein_id="BAD74846.1"
FT                   /translation="MKLEDRNRLPRAEAFLFLNSKKGQDQKDQNDHYHHNILISTIFLY
FT                   DNVESVANISKGVGEMRRKLKNLTVQVIIGIILGIIVGFLFPEFGAKLKVLADGFIKLI
FT                   KMVIAPIIFFTVVIGIGNMGDLKKVGRIGGKALIYFEIVTTFALAIGIVVVNLVKPGVG
FT                   FHTDAVKGGDISQYTKQAEETSHGFVDFILSIIPDNVVAAMASGQLLPVLFFAVLFGLA
FT                   AAALGEKAKPVISLFERLAEIFFGVVNMVMKVSPIAAFGAMAYTIGTFGLGSLVSLGKL
FT                   MGSVYITMALFIFVVLGGIAKFYGFNIFKFLAYIKEELLLVLGTSSSESALPRLMERLE
FT                   KYGCSKSVVGLVVPTGYSFNLDGTSIYLSMAAIFIAQAYGIDLTIWQELTLLGVLMLTS
FT                   KGAAGVTGSGFITLAATLAAFPMIPVEGIALLLGVDRFMSEARAITNIIGNAVATVVVS
FT                   KMENEFHPNEAEVERASMSVAK"
FT   CDS_pept        587134..587961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0562"
FT                   /locus_tag="GK0562"
FT                   /product="plant-metabolite dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0562"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74847"
FT                   /db_xref="GOA:Q5L2I3"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2I3"
FT                   /protein_id="BAD74847.1"
FT                   /translation="MNGLQDCATLHNGVKMPWVGLGVYKVKEGEEVRSAVRTALEIGYR
FT                   HVDTAAFYENEEGVGRAIRESGIPREQVFVTTKVWNTDQGYETTLKAFDKSLKKLGFDY
FT                   VDLYLVHWPVKGKYKETYKALEKLYKDGYVRAIGVSNFHIHHLQDVLADCEIKPMVNQV
FT                   EYHPRLTQKELLTFCRENGIQLEAWSPLMRGEILSEPTIIDIGRKYGKTPAQVVLRWDL
FT                   QHGVVTIPKSVTPARIKENADIFDFSLTDEEMKQIDALNLNKRVGPDPDNFNF"
FT   CDS_pept        588109..588801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0563"
FT                   /locus_tag="GK0563"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0563"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74848"
FT                   /db_xref="GOA:Q5L2I2"
FT                   /db_xref="InterPro:IPR007395"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2I2"
FT                   /protein_id="BAD74848.1"
FT                   /translation="MLFHPMDIFIFIAFLISLWAQWKVSSNFNAWSEVPASSGLTGAEV
FT                   ARMILDRHGLHHVPVEVVPGRLSDHYDPISRTVRLSEPVFYGRSIASISVAAHEVGHAV
FT                   QHQQGYAALVLRHRMFPIVNFASGVAPLLLLVGFVLHQFSLIGLGILFFSLAVAFQIIT
FT                   LPVEFNASARAKRFMLAEGLIAPNEARGVNKVLGAAALTYVAATLIAVFELLKYVLIFT
FT                   QGNNNEES"
FT   CDS_pept        588913..590253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0564"
FT                   /locus_tag="GK0564"
FT                   /product="hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:GK0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74849"
FT                   /db_xref="GOA:Q5L2I1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2I1"
FT                   /protein_id="BAD74849.1"
FT                   /translation="MDIASLLLVAFLIACTAFFVASEFAIVKVRSSRIDQLVNEGNRRA
FT                   VAAKKVISNLDGYLSANQLGITLTSLGLGWLGEPTVARMLLPLFERLHLSESVSHFLAF
FT                   IISFSLITFLHVVVGELAPKTFAIHKAEAITLFTAQPLIWFYKIMYPFIWTLNNSARLV
FT                   TRLFGLRPVAEHEIAHSEEELRLILSESYKSGEINQSEYRYVNNIFRFDDRIAKEIMVP
FT                   RKEIVALDINKSVKENLDIIREEKYTRYPVIDGDKDHVLGLINVKEVFTDFIANPSNEK
FT                   QMKDYIRPIIQVIESIAIHDLLVKMQKERIHMAILVDEYGGTSGLVTVEDILEEIVGEI
FT                   QDEFDIDETPLIQKIDDRLILDGKVLISEVNDLLGLDIDDDDVDTIGGWILTKHYDIKP
FT                   GESVEIDGYLFTVKEMDGHHVKSLEVAKKEPSKEEEAAGAEEEELRL"
FT   CDS_pept        complement(590328..591227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0565"
FT                   /locus_tag="GK0565"
FT                   /product="ribosomal large subunit pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0565"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74850"
FT                   /db_xref="GOA:Q5L2I0"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2I0"
FT                   /protein_id="BAD74850.1"
FT                   /translation="MWTRKGDWLECIIPSWWSGLTIEQLLKDVWAASKKLAHRWRMEHG
FT                   VKLNGQAVPWKTVLNERDRLQLYAYEPEPSFIVPEYRELSILWEDDHLLVLNKEAGIDI
FT                   HPSEPGQTGTLANAVAFYLQSQAILTKVRHIHRLDRDTSGAILFAKHPLAGATLDRMLA
FT                   HRAIKRTYVALVHGRLSPKSGTIFAPIGRDRHHPTRRRVSKTGAKAVTHYRVIKTFPST
FT                   SLVELSLETGRTHQIRVHLAHLGHPLVGDVLYGGKPVFHRHALHAAKLTFRHPFTNEEV
FT                   ICLAPTSDFPTDLSRIYH"
FT   CDS_pept        591339..591764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0566"
FT                   /locus_tag="GK0566"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0566"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74851"
FT                   /db_xref="InterPro:IPR020355"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2H9"
FT                   /protein_id="BAD74851.1"
FT                   /translation="MRREKVVWTLKMMYAATPEQEHYMQYLLNYFYTDVFPYYFDDEQI
FT                   RQFEEWGILSLDHEHVAYNGTMKEAFQIISALQSLITVIEHIGEHGDLEQYEWLFVRNQ
FT                   KILARHGIAFPFHAKQFTCRRLWPCSVYAPPASQWVI"
FT   CDS_pept        complement(592090..592563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0567"
FT                   /locus_tag="GK0567"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0567"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74852"
FT                   /db_xref="GOA:Q5L2H8"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2H8"
FT                   /protein_id="BAD74852.1"
FT                   /translation="MKKLLAFGGIIVVLFAAIAFITMYEQKEAASNNPYHKSELNPATI
FT                   AQLDDPNYRNIILPAELKQQLADGKTLTVYFYSPTCPHCQRTTPIVVPLAKELGIDLKL
FT                   FNLLEFEDGWDAYHIEATPTIVHYENGKEIKRIEGYHDEQTFRNWFSSLHSDK"
FT   CDS_pept        complement(592560..592997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0568"
FT                   /locus_tag="GK0568"
FT                   /product="protein-disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0568"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74853"
FT                   /db_xref="GOA:Q5L2H7"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR012187"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2H7"
FT                   /protein_id="BAD74853.1"
FT                   /translation="MEREKRAENLLLAAWATALIATLGSLYFSEVLGFIPCDLCWFQRI
FT                   FMYPQVVILGIAIVRKDAAAARYSFTLSLIGGGISLYHYGLQKIPLLQEYAISCGRIPC
FT                   TGQYINWLGFITIPFLAFTAFMIIMLLSWTVMRQQRKESER"
FT   CDS_pept        593171..593617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0569"
FT                   /locus_tag="GK0569"
FT                   /product="inosine-5-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0569"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74854"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2H6"
FT                   /protein_id="BAD74854.1"
FT                   /translation="MTNNSGNKVQDIMTKNVATISPNQTVQEAAQIMSQKNIGALPVVE
FT                   NGQVKGMITDRDITLRVSSQGKDPSTVKVAEVMTNQVVTGTPNMSVQEAANVMAQHQVR
FT                   RLPIVENNQLQGIVALGDIATNSASNEAAEQALTNISEPSQPQG"
FT   CDS_pept        593734..595491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0570"
FT                   /locus_tag="GK0570"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:GK0570"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74855"
FT                   /db_xref="GOA:Q5L2H5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2H5"
FT                   /protein_id="BAD74855.1"
FT                   /translation="MEWRQKYEQWLREPQLDPELKRLLEQRRNDERWLEDCFYKNLEFG
FT                   TGGMRGEIGPGTNRMNMYTVRKASEGLARYIQSFGDEAKQRGVVIAYDSRHKSPEFAME
FT                   AAKTLATNGIQTYVFDELRPTPELSFAVRYLRAFAGIVITASHNPPEYNGYKVYGEDGG
FT                   QLPPAVADQVIRYVNEVENELAIHVEDEETLREKGLIRIIGSEVDDAYIHAVKTISIHP
FT                   ELAREAAINIVFTPLHGTSNKPVRRALAELGYQNVFVVKEQELPDPNFSTVASPNPEEH
FT                   AAFAMAMELGKQVNADLLIATDPDADRMGVAVTNDKGNYVVLTGNQTGGLLLHYLLSQR
FT                   KAQGTLPENGVVLKTIVTSEFGRAIAQSFGLETVDTLTGFKFIGEKMKEYEQTGQYAFQ
FT                   FGYEESYGYLIGDFVRDKDAVQAAVLAAEVCAFYKKQGLSLYEALLQLFDQYGYYREGQ
FT                   RSLTLKGKEGAEAIAAILASFRQQPPVEAAGKKVTVIEDYKTKERTNTLTGEKTAIDLP
FT                   TSNVLKYILEDGSWFCLRPSGTEPKMKAYFGVKGTSLEDSEERLARLTEAVMQRVKDVL
FT                   STVSPSYAQ"
FT   CDS_pept        complement(595539..595796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0571"
FT                   /locus_tag="GK0571"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0571"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74856"
FT                   /db_xref="InterPro:IPR025431"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2H4"
FT                   /protein_id="BAD74856.1"
FT                   /translation="MNTVDYDKALYYTHRSEWDNLLILMVRTPDDILSKKIEKFLHAYN
FT                   FEHDYSVIQERLHALLRYIDHALEVSELIMGVEQYAQFYS"
FT   CDS_pept        595983..596225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0572"
FT                   /locus_tag="GK0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0572"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74857"
FT                   /db_xref="GOA:Q5L2H3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2H3"
FT                   /protein_id="BAD74857.1"
FT                   /translation="MNKRHEGQEMINMCKWMASVGLIVGVVLFLLSFIASAYNKDYFLT
FT                   IISLGIIGASMFMFGFGLFMGLLTETYHRGPRENV"
FT   CDS_pept        complement(596255..596860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0573"
FT                   /locus_tag="GK0573"
FT                   /product="alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0573"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74858"
FT                   /db_xref="GOA:Q5L2H2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2H2"
FT                   /protein_id="BAD74858.1"
FT                   /translation="MQHYLHYLIEHFGYIGIMVALMLGIVGLPIPDELLLTYAGYRVST
FT                   GAFSYPLAFLSCWLGAIIGISLSYMLGITLGLPFLHKFGPKLHLTEKRLEQTKALFSKL
FT                   GPAVLFICYFIPGVRHLAAFWAGMNAYRWRKFALFAYSGAMVWVAVFLTIGAYFESRWM
FT                   AVKQYIHAYRPFLFPVFLVALGFAIFYWYIQQKRKTPG"
FT   CDS_pept        597020..597817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0574"
FT                   /locus_tag="GK0574"
FT                   /product="stage V sporulation protein R (involved in spore
FT                   cortex synthesis)"
FT                   /note="similar to N-terminal region of stage V sporulation
FT                   protein R (spoVR 468 aa) of Bacillus subtilis"
FT                   /db_xref="EnsemblGenomes-Gn:GK0574"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74859"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2H1"
FT                   /protein_id="BAD74859.1"
FT                   /translation="MRQDELKELERAIAEITEIAEGFGLDFYPMRYEICPADILYTFGA
FT                   YGMPTRFSHWSFGKQFYKMKLHYDLGLSKIYELVINSDPCYAFLLDTNTLIQNKLIVAH
FT                   VLAHSDFFKNNVRFSNTKRDMVESMAATAERIKHYEHQYGKLEVEKFLDAVLAIQEHID
FT                   PSLLRPKLSWTWEDTEVYEEEEPPKTSTPYDDLWSLDERDKLKTPPRKKRRKFPPQPEK
FT                   DVLLFIEEYSRELEDWQRDILTMMREEMLYFWPQLETKIMNEG"
FT   CDS_pept        598127..599998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0575"
FT                   /locus_tag="GK0575"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0575"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74860"
FT                   /db_xref="GOA:Q5L2H0"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2H0"
FT                   /protein_id="BAD74860.1"
FT                   /translation="MDAKDLLRIIDDGENAELECKAAKGGLPKDVWETYSAFANTNGGI
FT                   ILLGVEQKGQEFFPVDVDAKKLVKDFWDGINNPQRISKNILVDRNVEIVEVDGKEIVKI
FT                   YVPRASREDKPIYIGHNPFTGTYRRNYEGDYKCTKEEVQRMIADQSPIPQDSKVLPNYG
FT                   LNDLNMESVRSYRNRFSSLKPDHPWNGLELKEFLYKIGALGRLRETNEEGLTLAGLLMF
FT                   GEERSITEYLPQYFLEYREKSSDVPGERWTDRIISSDGTWSGNLYDFYFKVIRRLTDDL
FT                   NIPFQMEGLFRKDDTRVHAALREALVNTLAHADYYGQRGIVIEKEKMLFRFSNPGVLRI
FT                   PLQQALKGGISDPRNPTIFKMFMLIGLGERAGSGIENIHLAWKEQHWTAPELIEEFQPD
FT                   RTILTLRTTSLLPQESVDFLKAVLGKHYKFLTNDEVLILVTAHQENYVTNTRLQSLTDK
FT                   KSDEISKLLSGLVEKGYLEPNGQGRGTKYTLTEMFHQKSIGNSRYNRISSGPNVNNSGP
FT                   NAANSGPNENEQTKDHEKVLLDISELARKKKRLNPSEMDEIILNLCAIKPLTLKELSQL
FT                   LNRQMDPLRKKYISRLLKEGKLEPLYPEQINHPKQAYMTRSLFTNQH"
FT   CDS_pept        600788..601369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0576"
FT                   /locus_tag="GK0576"
FT                   /product="transposase of IS654-like element"
FT                   /db_xref="EnsemblGenomes-Gn:GK0576"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74861"
FT                   /db_xref="GOA:Q5L2G9"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2G9"
FT                   /protein_id="BAD74861.1"
FT                   /translation="MSKRSIPNVDWANQLESVIRQFVKEKLELIMREEIKHFLEIEQAR
FT                   TPNRRNGCYLRCVRKKDQFEMAEDLKLIYRSPNKEIALEMFQQFQSKWSHKYPREVQSW
FT                   ANELDVLLTFMDYPSSIRSVIYTTNAIERTIKEIRKRLKPMNSLSSLEAAEKVVYLTIQ
FT                   DFNEKWAGRKLRGFAEAQEALERMFEERYN"
FT   CDS_pept        601687..602160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0577"
FT                   /locus_tag="GK0577"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0577"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74862"
FT                   /db_xref="InterPro:IPR025673"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2G8"
FT                   /protein_id="BAD74862.1"
FT                   /translation="MKYKGMIVLLLLTLIISACSSNKEQSHQEHSSNGDLQEKTASADV
FT                   LPTFLKGQSEEVRLVYQAAGKSIELLQWIPCYCGCAESAGHKSSMNCFVKKINKDGSVV
FT                   WDDHGTRCGVCLQIAAESIKMKQEGKSIKEIRHYIDEKYKEGYAKPTKTPMPL"
FT   CDS_pept        602297..603019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0578"
FT                   /locus_tag="GK0578"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0578"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74863"
FT                   /db_xref="GOA:Q5L2G7"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2G7"
FT                   /protein_id="BAD74863.1"
FT                   /translation="MNSLWLLGFSASAIGMLSGGVIAWLFKGWQKGTPTIFSVCSGMIF
FT                   GLVTMEILPESIEIGGWFIAIVGLIFGYFIYKHLEKVSHHVIIITNDAKKDLFVHSGLF
FT                   LTFSIALHNFPTGIALGANTHDSLTKPMMTAIMLHNIPEGIAVFTPLLMAGFGILSIIL
FT                   GATIASAPIGVGAFIGSNYGMGVPWLVAMIIALAMGVMLSVTGKEIFGTALRASTKIYC
FT                   VIMAIIGFILVSFYLFFP"
FT   CDS_pept        complement(603157..604296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0579"
FT                   /locus_tag="GK0579"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0579"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74864"
FT                   /db_xref="GOA:Q5L2G6"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2G6"
FT                   /protein_id="BAD74864.1"
FT                   /translation="MDVIYPRCAGLDVHAETIVACALWEEDGHIQKDIQTFSTFSKGLG
FT                   DLLEWLEEHGVTHVAMESTGVYWKPVFAFLEGYVDLTLANPQRIKNVPGRKTDVSDAEW
FT                   IAKLLRHGLVEKSFVPPADIRELRDFTRLRKKWVGQLTSEKNRIQKVLESSNVKLGSVL
FT                   SDLFGVSGKDILARLLEKGYVDKDELDQCLRGRLKKEKKQAVYDSLLGTLTEHELRLLR
FT                   LLWKHVEELERLIEEVDQHIDRLLEPYREEVNLLMTMPGVKKQTAAVIIAEMGTDMSVF
FT                   ETPERAASWTGLSPGNHESAGKRKSTRTTKGNPHLRSALCEAAWSAARSKTHPLSRKFW
FT                   SLAARCGKKKALIAIARRMLVIIFCMISRKEPFRQPQLI"
FT   CDS_pept        604869..605177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0580"
FT                   /locus_tag="GK0580"
FT                   /product="transcriptional regulator (ArsR family)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0580"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74865"
FT                   /db_xref="GOA:Q5L2G5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2G5"
FT                   /protein_id="BAD74865.1"
FT                   /translation="MKMEDHSFLKSETIENVSRIFKVLADPTRIKILYLLSQEECNVNH
FT                   IAEVLEMSQSAVSHQLSMLRNLRLVKYRREGKTLFYSCDDEHVISLLKQAIDHSEHH"
FT   CDS_pept        605192..606139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0581"
FT                   /locus_tag="GK0581"
FT                   /product="cation efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GK0581"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74866"
FT                   /db_xref="GOA:Q5L2G4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2G4"
FT                   /protein_id="BAD74866.1"
FT                   /translation="MHHHHHHHSHDHHGHHHHHGHHHDHSREGNKKGLTIALLITAGIM
FT                   LLEFFGGLITNSLALLSDSGHMLSDASSLVLSLVAIWFATKPASPNKTYGFYRFEILAA
FT                   LFNGVTLFVIAGFIIWEAIERFYNPPTVASGSMMLIASIGLFANLLSAWALMKKGDVKN
FT                   NVNLRSAYLHVIGDALGSVGAIIAGLVMWLFSWYVADPIISILVALLILKGAWGVIKHT
FT                   VHILMEGTPITIDQNEVKKALESIEGVINVHDLHIWTITSGLDSLSCHILIEDHQDSQK
FT                   VLQEAIHFIEDHFKIQHATIQIETSQIHHGEMKV"
FT   CDS_pept        606165..607211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0582"
FT                   /locus_tag="GK0582"
FT                   /product="potassium transporter (Trk family)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0582"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74867"
FT                   /db_xref="GOA:Q5L2G3"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2G3"
FT                   /protein_id="BAD74867.1"
FT                   /translation="MQHIVDVLVIGASQAGLAMGYYLKQNNILFAIVGKENRIGDVWRN
FT                   RYDSLVLFTPRWFSSLPGMALKGDPNGYPTKDEIADYLEDYAQKFELPIHLNTEVISLQ
FT                   KEDEIFKVTTNNGNYVAEKVVVATGPFQKPYIPPFAESLSDKVYQVHTSRYLNPSQLQE
FT                   GSVLVVGAGNSGAQIAVELSEDREVYLSVGHKMKFFPLEIMGKSIFWWFKKLGLLNVHI
FT                   NSSLGQFISKQSDPIFGKELKHLIQEGKIKIKPRTESILGDVISFADNSQIQVQNVIWA
FT                   TGFYSDYSWIQIPNVLDHRGKPIHQRGVTSVKGLYFLGLPWQYRRGSALIGGVGADAEY
FT                   LINDILNH"
FT   CDS_pept        607537..607893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0583"
FT                   /locus_tag="GK0583"
FT                   /product="hypothetical protein"
FT                   /note="similar to N-terminal region of manganese transport
FT                   proteins (lin1463 442 aa) of Listeria innocua (GK0583
FT                   divided by frame shift is possibly continued to 608,888
FT                   bp)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0583"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74868"
FT                   /db_xref="GOA:Q5L2G2"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2G2"
FT                   /protein_id="BAD74868.1"
FT                   /translation="MSENIKKLPLVVEEGWRKKRTQPTLPEVYRSLRIPKTGSWMKKFL
FT                   AFAGPGYLVAVGYMDPGNWATDIAGGSQFGYTLLSVILLSNLMAILLQALAGKLGIVTG
FT                   RDLAKLVATITASL"
FT   CDS_pept        609112..609480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0584"
FT                   /locus_tag="GK0584"
FT                   /product="cadmium efflux system accessory protein
FT                   (cadmium-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0584"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74869"
FT                   /db_xref="GOA:Q5L2G1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2G1"
FT                   /protein_id="BAD74869.1"
FT                   /translation="MSKKDTCEIYCYDEEKVNRIQGELQKEDISSVVLLFKALADENRA
FT                   KIAYSLCQDEELCVCDIANIIGASVATTSHHLRTLYKQGIVKYRKEGKLAFYSLDDDHI
FT                   KQLIMIALAHDKEVKVRV"
FT   CDS_pept        609473..611611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0585"
FT                   /locus_tag="GK0585"
FT                   /product="cadmium-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0585"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74870"
FT                   /db_xref="GOA:Q5L2G0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2G0"
FT                   /protein_id="BAD74870.1"
FT                   /translation="MSEQQAKLSKSEAKTYRVQGFTCANCAAKFENNVKSLPGVQDAKV
FT                   NFGASKITVWGTTTIEELEKAGAFENLKVREDKEKAVKREPFWKQKENIKVYISAVLLV
FT                   ISWFLGKQYGEEHIFATIGYAAAILIGGYSLFIKGFKNLVRLNFDMNTLMTVAILGAAA
FT                   IGEWGEGATVVILFAISEALERYSMDKARQSIESLMDIAPKEALIRRGNEEMMVPVDDI
FT                   QVGDIMIVKPGQKLAMDGIVIKGTSTLNQAAITGESVPVTKTVGDEVFAGTLNEEGLLE
FT                   VKVTKRVEDTTLSKIIHLVEEAQAERAPSQAFVDRFAKYYTPAIIIFALLLAVIPPLFM
FT                   GADWSEWIYRGLAVLVVGCPCALVISTPVSIVTAIGNAAKNGVLIKGGIYLEEAGNLKV
FT                   IAFDKTGTLTKGIPSVTDVVTYNGNENELMTITAAIEKGSQHPLASAIIRKAEEDGLNF
FT                   NDVSVEEFQSITGKGVKAKVNNAMYYVGSPGLFEELLPNGIQSEIKEQITTLQIQGKTV
FT                   MALGTEKEILALIAVADEIRESSKEVIRKLHQVGIEKTVMLTGDNQRTAEAIGKQVGVS
FT                   DIKADLLPEDKLNFIKELRDKYRSVAMVGDGVNDAPALAASTVGVAMGGAGTDTALETA
FT                   DIALMSDDLSKLPYTIKLSRKALAIIKQNITFSLGIKVLALLLIVPGWLTLWLAIFADM
FT                   GATLIVTLNSMRLLNVKE"
FT   CDS_pept        611902..612774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0586"
FT                   /locus_tag="GK0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0586"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74871"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2F9"
FT                   /protein_id="BAD74871.1"
FT                   /translation="MEVYNVHQALKILQEYYITDSIQMVTRWIREGKIKAERSANRKEG
FT                   WRIYHDDLFEFIEEQRPGLPEVMGVYEWYVENSFSMLANDHREKHNKLDSEEVKGDSTH
FT                   SEELMKQLMEEKNQLENQLINMQDELNLVYEQITELTVKVQKLEEENAFLIGLYEQMDE
FT                   MYQELEKKNQQESSNETPKTMERKLKKEMSIEDFKMIFEKVIKGYKSETINYIQQENKL
FT                   INEIYTLFFNEDGELKNEVIDDGEYICPLTKKKYKKNLRSMLKNAIRTKLEQILNSVDE
FT                   TVLANDSSR"
FT   CDS_pept        613195..613542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0587"
FT                   /locus_tag="GK0587"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GK0587"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74872"
FT                   /db_xref="GOA:Q5L2F8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2F8"
FT                   /protein_id="BAD74872.1"
FT                   /translation="MQKTVVEIEKASHVLKLLGDKTRLTIMAILKQRECCVCELLEVFD
FT                   MSQPAISQHLRKLKDAGLVKEDKRGQWIYYSLNSQNELYDFIQDILQHIPDQTENIRKI
FT                   EETNPTLRCGC"
FT   CDS_pept        613582..614643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0588"
FT                   /locus_tag="GK0588"
FT                   /product="arsenic oxyanion-translocation pump"
FT                   /db_xref="EnsemblGenomes-Gn:GK0588"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74873"
FT                   /db_xref="GOA:Q5L2F7"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2F7"
FT                   /protein_id="BAD74873.1"
FT                   /translation="MNNTGKKRLSFLDRYLTLWIFLAMAAGIGLGFVFPGFVDGMNSLQ
FT                   VGTTSIPIAIGLILMMYPPLAKVRYEEIGRVFKDVKVLVLSLVQNWIIGPILMFLLAII
FT                   FLPDKPEYMVGLIMIGLARCIAMVIVWNDLAKGDREYAAGLVAFNSVFQMLFYSVYAYV
FT                   FVTIIPEWLGLEGAVVNITMMEVAKSVFIYLGIPFLGGMLTRFLLVKAKGRQWYEKVFI
FT                   PKVSPITLISLLFTIIVMFSLKGDVIVSLPLDVVRVAIPLLIYFVLMFFVSFFLGRKFG
FT                   ARYPVTTTLAFTAGSNNFELAIAVAVGVFGIHSGAAFAAVIGPLVEVPVMIALVNVALW
FT                   FQRKYFKTESVSY"
FT   CDS_pept        614664..615086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0589"
FT                   /locus_tag="GK0589"
FT                   /product="arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0589"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74874"
FT                   /db_xref="GOA:Q5L2F6"
FT                   /db_xref="InterPro:IPR014064"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2F6"
FT                   /protein_id="BAD74874.1"
FT                   /translation="MKNKKIIYFLCTGNSCRSQMAEGWAKKYLGDEWEVYSAGIEAHGL
FT                   NPNAVKVMKEVGIDISNQTSDIIDPEILNKADLVVTLCGHAADHCPVTPPNVKRVHWGF
FT                   DDPAKAEGTEEEKLAVFRRVRDEIGARIKKFAETGE"
FT   CDS_pept        615235..615681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0590"
FT                   /locus_tag="GK0590"
FT                   /product="transcriptional regulator (marR family)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0590"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74875"
FT                   /db_xref="GOA:Q5L2F5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2F5"
FT                   /protein_id="BAD74875.1"
FT                   /translation="MENIRELFQVMTRRFGLLNKNCCSIDDVDISLVQSHILYEIDKRE
FT                   HPSMQQVAEALGMDITTFSRQIQNLVKKGLVKKTPLPEDRRVYTLSLTTEGKFIATTID
FT                   REINRYLEEVFSHMTEFEKETVIRSIKLLNECMAKSSVCCKPLF"
FT   CDS_pept        615873..616415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0591"
FT                   /locus_tag="GK0591"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0591"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74876"
FT                   /db_xref="GOA:Q5L2F4"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2F4"
FT                   /protein_id="BAD74876.1"
FT                   /translation="MQSLLTKRHPLFGALVAVAFAFCSCSTIPVVVSLLNQKVRFGIVM
FT                   IFLFDSPVLDPIILTLMAATLGVKKGEVEIGKKRNMREALQETFHLIKTVYPYLLLGAG
FT                   IEAIIHGAVLTEWISTYMGGDKWWLVPLAAIIGIPLYIRLFTMIPISQMLIAKGMALGP
FT                   VMAPMVSSAGASLPEIT"
FT   CDS_pept        616525..617319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0592"
FT                   /locus_tag="GK0592"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0592"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74877"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2F3"
FT                   /protein_id="BAD74877.1"
FT                   /translation="MNHVNNDQIRQNVRSRYKQIALQEVNSRSCCSDSSGCCGTPNEVS
FT                   AKLGYSDEELSAVPEGANLGLGCGNPLAIAELNPGDVVLDLGCGAGFDCFLAARQVGET
FT                   GRVIGVDMTPEMISKARNNAAKGGFTNTEFRLGEIEYLPVADGSVDVIISNCVINLSPD
FT                   KPQVFKEAYRVLKPGGRLVISDVVATAELPSEIKNNMDVLYSGCVSGAASIGELESMLQ
FT                   QSGFTQITIEPKDESKEFIKDWVPGANIEDYIVSAIIKAMKP"
FT   CDS_pept        617447..617938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0593"
FT                   /locus_tag="GK0593"
FT                   /product="phosphinothricin N-acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:GK0593"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74878"
FT                   /db_xref="GOA:Q5L2F2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2F2"
FT                   /protein_id="BAD74878.1"
FT                   /translation="MNIRSFRKEDWMQVKEIYEQGIATGQATFETTAPSFEKWESTIAA
FT                   NLCLVAENEEGIQGWCKISKVSDRCVYEGVGEVSVYVRDVSRGKGVGKKLLQAMIKESE
FT                   AKGFWTLTAGIFPENIPSLRLHQSVGFREVGIRQRIGKLNGVWRDVVLLERRSPVVGID
FT                   "
FT   CDS_pept        complement(618168..619829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0594"
FT                   /locus_tag="GK0594"
FT                   /product="single strand DNAspecific exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:GK0594"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74879"
FT                   /db_xref="GOA:Q5L2F1"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2F1"
FT                   /protein_id="BAD74879.1"
FT                   /translation="MDWVPFDTSLEKHPNKALITYMARQFDIEPVLMHHLFIHGIDNCE
FT                   KVSRFIFPTIDDFHDPFLMNDMKKAIIRIIKALTQKEKIFIYGDYDVDGMTATAILYKA
FT                   LKKFKADVHYRLPLRSEGYGLSPKAMEKVPEDTTLIITVDNGSSAHPAMEVAKRRGMDV
FT                   IVTDHHEVLGPHPDCYAFINPKRHDNTYPFPHLAGAGVALKVVQALFMAGKIPWDKHVY
FT                   EFIEFATLGTIADLMPLKGENRIICKLGLQKMNYTPTPVLKKLFEMLRIKYVDSSTISF
FT                   QIGPIFNSSGRIGDPNQAVDILVNPLCAKADLYSLITLNKKRQQMTKEQFQRIEEQIIQ
FT                   NQWYKQNVIVVCDDFHSGIIGLIAAKIANKFKKPAIVISLTGAGSARSVNATDFSMINV
FT                   IKKCSHFLTKYGGHRAAAGFSIKPDFDHIHAFREAIQLAALDEPPLTPKLKYISTIPLH
FT                   QFPMHIFDDLGVLEPFGMSFPKPLFYCSPLVIKQFQVFGKNNEHLKLITNDKKAIAFFK
FT                   GAMANKLQQQSLAECLYTPSCPIKKDFLIHDLRFIQ"
FT   CDS_pept        complement(620226..621680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0595"
FT                   /locus_tag="GK0595"
FT                   /product="cassette chromosome recombinase B"
FT                   /db_xref="EnsemblGenomes-Gn:GK0595"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74880"
FT                   /db_xref="GOA:Q5L2F0"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2F0"
FT                   /protein_id="BAD74880.1"
FT                   /translation="MKDTFQERSIALYCRVSTDEQAREGISLDEQQERLKAYCRAMGWS
FT                   EEPLLFIDDGYSAKNLDRPELNRLLKEVKKGTISKILVTKLDRLSRRLLDLLKLIDMFQ
FT                   EHNVSFISISESFDTNTPSGRLTLQVLGAVAEFERERIRERVFENMLHAARQGKWLTQS
FT                   PYGYRLQNKELVIYEPEAQIVRNVYDWYLNKGLGYYAIAKKLNEEGIPSRQKKEWSIRA
FT                   IKLMLTNPVYKGTLFWNRMDSSKSKRVKKDDADWVVLEDACPAIIDQATWEQVQKRVNK
FT                   KQMAPRAQTSPHLLGGLLKCGRCGSGMSIGWSGSAKNRYRVYRCSANKNKGTCTSKQYR
FT                   ADDVESWFKHGLLKLADSINSQMIPHLIQKAAENEESTIEQKIRTAKNRYKRKVEAYTA
FT                   GLIELEDLNEEKKRMEQIIAEVQKTENASSVDVKKLEAMVKEKMNNVIDAIDVLPVPEA
FT                   KSLIKTIVEKVILLDEKDIEIVLNIQ"
FT   CDS_pept        621812..622054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0596"
FT                   /locus_tag="GK0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0596"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74881"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2E9"
FT                   /protein_id="BAD74881.1"
FT                   /translation="MEDVKVRFSVNSSLGKFSFDDIHDLHSHPVAQMIQEKMVAWEQKF
FT                   KGSAIHHLLHKEIGQEQAKQIQVAFQQKESQPIDG"
FT   CDS_pept        complement(622142..622489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0597"
FT                   /locus_tag="GK0597"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GK0597"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74882"
FT                   /db_xref="GOA:Q5L2E8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2E8"
FT                   /protein_id="BAD74882.1"
FT                   /translation="MLQHIGERIRVLRKQKGISLNAFAERLNVSPAYLSNLETGKTDTI
FT                   QLSLLEKLQEELSLLPVETTHSSDSEFDIRIQHVMKQLKELEQKHPEVADYLLSTLERG
FT                   VHLFLNENSTR"
FT   CDS_pept        622654..622818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0598"
FT                   /locus_tag="GK0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0598"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74883"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2E7"
FT                   /protein_id="BAD74883.1"
FT                   /translation="MKRKIPKVTCQVVSIQYVHDPEAAEKWFDLYTDIILKQIQNRQET
FT                   KRDSEVLDD"
FT   CDS_pept        622815..624326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0599"
FT                   /locus_tag="GK0599"
FT                   /product="integrase (resolvase family)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0599"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74884"
FT                   /db_xref="GOA:Q5L2E6"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2E6"
FT                   /protein_id="BAD74884.1"
FT                   /translation="MKTVAYYRNSISKEKQKLSIEMQMQHVHEVAAKNRLLIDDEFMDR
FT                   ETSARKKKMEERKGMAQLIEEIKKGRVKNLIVYSRCRLARNVQQYMSLYDLLRQHKVNV
FT                   IFAADFEFPMMYTAEAELIERIVAAMNQEDAEKLVQKLQDSKVTVAREGKHAGGRIPFG
FT                   YRSPREDLEEDKEESDWILVEEEVKTIQNVYDLFLQKDFSSLTKFVEIVNELGLRFKDN
FT                   KEWNYSNMQNVLTNPIYKGKRISHIKGEEIEKDVPHLKIVDETVWENVQKKMSKVVKRR
FT                   KKSKENQNENHVFLLKELVYCDECNQVMHGKPHQLKGKTFLVYKCKKHSKVRASKDWLE
FT                   NTVIEHANEFFNQIIHTQFAEVIEKIYKGETKGYIEAIKQIDRELKQLEESMVQRVEHA
FT                   LAKEEELQLNKSMLQMLKKYEQSLFVKSELESRIFEMNEKFKTIHDWKQESSLKMIDPD
FT                   MEDDQKIELLQDIISRVRVSKEKIEIIFRHPLFTGLEGREEIGLI"
FT   CDS_pept        624313..625833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0600"
FT                   /locus_tag="GK0600"
FT                   /product="cassette chromosome recombinase B"
FT                   /db_xref="EnsemblGenomes-Gn:GK0600"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74885"
FT                   /db_xref="GOA:Q5L2E5"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2E5"
FT                   /protein_id="BAD74885.1"
FT                   /translation="MDLSKILTPGMKGVFYGRHSTHKQTMETQRRSAYDLAEKYQCTIV
FT                   EEILDEGVSSRKKDREGYKRLIAAAYEKKFDFVIIYSHSRIARIPEEHDLIRATMHILD
FT                   IPIIESETESLYDFGDTIFRAIKDGIAKYELDKIRINTKNAIETLAKNGRWTGGRAPFG
FT                   YQYTSKKEGGTEKFDIVEAEIELVKKVFELYKNHHGFSSIARQLPENSYRGKAWTKDRV
FT                   KNIITNPFYAGYIAIRRKHEKKHNALKDRSEWIMKKSPLIPAVLTIEEWEYCWNLYKTK
FT                   NERKIPPKHFKTSFLLTGLLKCQNCNGGLIGKDQRTTSNQGKVYGKKVYLCKSCNYKID
FT                   ADDAHQTVLKVFRSYQGVDTEKLISAVQEKVETEISNIKKSIEDLKVSWQTEKRKLQLC
FT                   DIEIEKAFKRKEEKEPHIKILIITKDRILNKVHQIERWIEEKEAKIKFLEEVQKNENLI
FT                   RDHLKQFQAPVSSCNEDMRALFLYLFEEIMVNKKGHLQCKLRFNLDDK"
FT   CDS_pept        626592..627224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0601"
FT                   /locus_tag="GK0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0601"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74886"
FT                   /db_xref="GOA:Q5L2E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2E4"
FT                   /protein_id="BAD74886.1"
FT                   /translation="MLIPFWFRLLFLFMSYFPLFLVLFIKFFNYEFLVYCIKYWRFIDI
FT                   LFLLEIKTLNGVMGLISTLLLVISLLSILFILFELRTTEKKRIGQKKYTIKKIQPRDRD
FT                   ILVYLVTYVLPLISLDMDNFRDIIVLFVLILLIFWLSMYSDLLYVNPVMAALKLRIYAI
FT                   ETDLGEALLISKNDKFEECLGKKIICYRFIRDKETVLIDGSRGQQNE"
FT   CDS_pept        627217..628182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0602"
FT                   /locus_tag="GK0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0602"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74887"
FT                   /db_xref="InterPro:IPR032359"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2E3"
FT                   /protein_id="BAD74887.1"
FT                   /translation="MNDELIYVKEKINEMEHNNDYVYQLFIVGSVLREGTQSVYDDCDP
FT                   KEIPIDQSVQDWLLGTTKALLEDVTENYQVLNIREVDEESETIKRYIEINNLNQLYLWT
FT                   QRINNEQVENDARTLINRDDFKPKVLLAKLEIDDEMKVYFLKIINESVFLKKRKILEVV
FT                   DRGDYQISQERDKKLFLDDQWDGIIIGNNVLLYNENKILSLFRYYERFRQAADEIVEQI
FT                   MEKGIVSDDSNFLQFVQSQISLQKKLAKAADYGLERIKRERIEELINTGMINLQLDEQG
FT                   RIVCTTKEEARLVIDVILDNFVSSLITDDKYRAINKMRIQ"
FT   CDS_pept        628278..628868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0603"
FT                   /locus_tag="GK0603"
FT                   /product="stage V sporulation protein R"
FT                   /db_xref="EnsemblGenomes-Gn:GK0603"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74888"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2E2"
FT                   /protein_id="BAD74888.1"
FT                   /translation="MDLTSDEAIEFAKLNANVVQPSRTGINPYYLGLKIFEDIEERWNN
FT                   PTEEMKKYGVKPGSGRAKIFEVRELESDISFLRNYLTKELVMREDMYLFQKQGKEYKIV
FT                   DKNWEHIRDQLVSMRVNGGFPYITVNDGDYMRNGELYLKHWYEGIELDLKYLEKVLPYI
FT                   YQLWGRPVHMETVVEEKPMLFTYDGKTVHRKYL"
FT   CDS_pept        629154..630500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0604"
FT                   /locus_tag="GK0604"
FT                   /product="cytochrome bd-type ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:GK0604"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74889"
FT                   /db_xref="GOA:Q5L2E1"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2E1"
FT                   /protein_id="BAD74889.1"
FT                   /translation="MNGYDPVLLSRILTGLTLTVHIIYATIGVGIPLMIAIAQWVGIRK
FT                   NDMHYILLARRWTRGFVITVAVGVVTGTAIGLQLSLLWPNFMQLAGQVISLPLFMETFA
FT                   FFFEAIFLGIYLYTWDRFENQKKHLLLLIPVAIGSSASAMFITMVNAFMNTPQGFEFKN
FT                   GELVNIDPIAAMFNPAMPTKVAHVLATSYMTSAFVLASIAAWHLWKGNRHIYHRKALHL
FT                   MMKTAFIFSVASALIGDLSGKFLAEYQPEKLAAAEWHFETSSHAPLILFGALQEDGEVK
FT                   YALEIPYALSILAHNHPAAVVTGLNEVPEDERPPLYIHYLFDVMVTIGVFLMVVAAAYW
FT                   LGSIFRWKWTAKKWFFGLLVAGGPLAMAAIEAGWYLAEVGRQPWILRGYMKTAEGATSS
FT                   AHVDTMLVLFCLLYMVLVIASATVLIRMFRRNPVERELAERANNGEVAP"
FT   CDS_pept        630497..631525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0605"
FT                   /locus_tag="GK0605"
FT                   /product="cytochrome bd-type ubiquinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:GK0605"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74890"
FT                   /db_xref="GOA:Q5L2E0"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2E0"
FT                   /protein_id="BAD74890.1"
FT                   /translation="MTLEVIGISVLWLFLFGYIIVASIDFGAGFFSAYSHWANKQHILH
FT                   RIIQRYLSPVWEVTNVFLVFFFVGIVGFFPKTAYYYGSILLVPASISIILLAIRGSYYA
FT                   FHTYGGTERNWYLIAYGLTGLFIPASLSIVLTISEGGFVEAGASGVALDYGKLFASPLS
FT                   WSIVLLSVTSVLYISAVFLTYYADEAKDERARALLRRYALLWSGPTMLSALLIIYQLRY
FT                   HNPEHYANLWNVAWMLVISFLFFVITVWLLWRQRRFGWAFIALLFQYAFAFYAYGISHY
FT                   PYLLYPYLTIYDGFTNETMAMALIVAFIAGLLLLIPSLYLLMRLFLFNKAYVKGKWEGG
FT                   KG"
FT   CDS_pept        631525..631626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0606"
FT                   /locus_tag="GK0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0606"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74891"
FT                   /db_xref="GOA:Q5L2D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2D9"
FT                   /protein_id="BAD74891.1"
FT                   /translation="MQTFLIMYAPMIIVALSIIAAFWAGLKDVHVNE"
FT   CDS_pept        631715..632005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0607"
FT                   /locus_tag="GK0607"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0607"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74892"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2D8"
FT                   /protein_id="BAD74892.1"
FT                   /translation="MKEILERVKEQLEQSFDEPRSTSLDGAIHELERLKASAGDKRQMI
FT                   EDVIRAVTHARNARMELAEAGDESATNAFAEAYRALDQAIESYSGVDNDPV"
FT   CDS_pept        632275..632595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0608"
FT                   /locus_tag="GK0608"
FT                   /product="chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0608"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74893"
FT                   /db_xref="GOA:Q5L2D7"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2D7"
FT                   /protein_id="BAD74893.1"
FT                   /translation="MAWVYLIVAGLFEVVWAIALKYTNGFARFWPSVVTIAGMAASFYF
FT                   LSLAIKTLPIGTAYAVWTGIGALGAALVGMLFLNEPVNAPRVAFLLCILVGVIGLKFTA
FT                   GQ"
FT   CDS_pept        632928..633200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0609"
FT                   /locus_tag="GK0609"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0609"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74894"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016941"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2D6"
FT                   /protein_id="BAD74894.1"
FT                   /translation="MRKWWKRLRFIVHVRRFLPFLFEFFVSHEVPMRKKLFSVGLLLLY
FT                   IALPLDLIPDWLALFGLIDDLAVFLFILQQVIKMAPVSLKEKYNL"
FT   CDS_pept        633215..633907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0610"
FT                   /locus_tag="GK0610"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0610"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74895"
FT                   /db_xref="GOA:Q5L2D5"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2D5"
FT                   /protein_id="BAD74895.1"
FT                   /translation="MDLLSVEFWTALLSIVIIDLLLAGDNAIVIGLAARNLPKYQQKKA
FT                   VVWGTVGAVVIRALATIFVVWLLKIPGLLLVGGVLLVWIAYKLLVEGKGHDDVEAGGNL
FT                   WEAIRTIIIADALMGLDNVLAVAGAAHGNFLLVVLGLLISVPIMVWGSTLILKWIERFP
FT                   IIITIGAGVLAWTAAKMIVDEPLLKAYFANPVVKYGFELLVVAAVIAVGTMKKRKSAKE
FT                   PQPKAANE"
FT   CDS_pept        complement(633947..634378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0611"
FT                   /locus_tag="GK0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0611"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74896"
FT                   /db_xref="GOA:Q5L2D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2D4"
FT                   /protein_id="BAD74896.1"
FT                   /translation="MLWSIALPGFGQLLNKKYIKGILFIALEFVINTQSHFNEAIRLSF
FT                   LGRTDEAARIVDIGWLMFYPCLYFFAMWDAFKDAGGGQTPYSFLPFVVSAYFVTVGLMY
FT                   SSHVTIGGVFFGPIWLPILSVIPGLSIGWLLQFLLLKWK"
FT   CDS_pept        634701..636776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0612"
FT                   /locus_tag="GK0612"
FT                   /product="carbon starvation protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0612"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74897"
FT                   /db_xref="GOA:Q5L2D3"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2D3"
FT                   /protein_id="BAD74897.1"
FT                   /translation="MKGLKSILLWGLISVLGAAAFAILALSRGESVNAMWLIVAAVCTY
FT                   AVAYRFYSRFIARKVFGLDDNRKTPAEVFNDGKDYVPTNKWVLFGHHFAAIAGAGPLVG
FT                   PILAAQMGYLPGTLWIVIGVVLGGAVQDFVILFASMRRNGKSLGEMIKEEMGPVTGFIA
FT                   ALGILGIMIILLAVLALVVVKALVGSPWGMFTIAATIPIAILMGIYMRFIRPGRVAEAS
FT                   LGGFVLLILSIVVGQYVAEHPTLSAMFTLKGETIAILMIIYGFVASALPVWLLLAPRDY
FT                   LSTFLKIGTIVGLALGIFVVMPDLQMPAVTKFIDGTGPVFAGNLFPFLFITIACGAVSG
FT                   FHALVSSGTTPKMIELESHARPIGYGAMLMESFVAVMAMVAACVLTPGAYFAINSPAAV
FT                   IGTDVAQAAKVVSSWGFTVTPDMLAQLAKDVGEQTVLSRTGGAPTLAIGMAHILSSVIG
FT                   GKALMAFWYHFAILFEALFILTTIDAGTRVGRFMIQDIMGTFYKPLGKTDSLASNLIAT
FT                   TLCVLAWGYFLYQGVVDPLGGINTLWPLFGIANQMLAGIALLFATTVLFKMGKKAYVWV
FT                   TLVPTTWLLVVTLTAGYQKLFHENVKIGFLSHAKMFQDSLSQGKILAPATNEAQMRQII
FT                   MNDYIDATLCAIFMLVVIAMLISALNIWIKVLQNKHVPLKEAPYVPRDGEGAKHYA"
FT   CDS_pept        636769..636972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0613"
FT                   /locus_tag="GK0613"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0613"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74898"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2D2"
FT                   /protein_id="BAD74898.1"
FT                   /translation="MPKWLQNVLAYRRQFLDLLVGVPSYEKYVEHMKTHHPGEPIKSRK
FT                   EFFCEAQEARYNAKGGKVSRCC"
FT   CDS_pept        637124..638050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0614"
FT                   /locus_tag="GK0614"
FT                   /product="thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0614"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74899"
FT                   /db_xref="GOA:Q5L2D1"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2D1"
FT                   /protein_id="BAD74899.1"
FT                   /translation="MRILFVGAGAVGGYFGGRLLEKGVDVTFLVRERRKQELEKYGLVI
FT                   HSVHGDVGLAPKLLVAGESAEPFDLVVFSSKAYHLDGAIADAKPYVGEATMILPLLNGM
FT                   AHMDALWKAFGRENVLGGLCFIETTLNERGEIIQTSPAHEMRFGEWPNGRSERTEVLAS
FT                   LFAGANACFRLSEQIAADMWNKYLFIATMSGVTTLFRAPIGPIRSGEYGSVIIDRLFRE
FT                   IKTIIQAHGAPLTDEMAERQRTQLEQIAPTMKSSMQRDMEKGQLIEADHLQGYLLALAK
FT                   RHGIHAPMLEVVYHNLKIYEASRATGE"
FT   CDS_pept        638190..639857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0615"
FT                   /locus_tag="GK0615"
FT                   /product="exo-alpha-1,4-glucosidase"
FT                   /EC_number="3.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:GK0615"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74900"
FT                   /db_xref="GOA:Q5L2D0"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2D0"
FT                   /protein_id="BAD74900.1"
FT                   /translation="MKKTWWKEGVAYQIYPRSFMDANGDGIGDLRGIIEKLDYLVELGV
FT                   DIVWICPIYRSPNADNGYDISDYYAIMDEFGTMDDFDELLAQAHRRGLKIILDLVINHT
FT                   SDEHPWFIESRSSRDNPKRDWYIWRDGKDGREPNNWESIFGGSAWQYDERTGQYYLHLF
FT                   DVKQPDLNWENSEVRQALYDMINWWLDKGIDGFRIDAISHIKKKPGLPDLPNPKGLKYV
FT                   PSFAAHMNQPGIMEYLRELKEQTFARYDIMTVGEANGVTVDEAEQWVGEENGVFHMIFQ
FT                   FEHLGLWKRKADGSIDVRRLKRTLTKWQKGLENRGWNALFLENHDLPRSVSTWGNDGEY
FT                   WAESAKALGALYFFMQGTPFIYQGQEIGMTNVQFSDIRDYRDVAALRLYELERANGRTH
FT                   EEVMKIIWQTGRDNSRTPMQWSGAPNAGFTTGTPWIKVNENYRTINVEAERRDPNSVWS
FT                   FYRQMIQLRKANELFVYGTYDLLLENNPSIYAYTRTLGRDRALIIVNVSDRPSLYRYDG
FT                   FRLQSSDLALSNYPVRPHKNATRFKLKPYEARVYIWKE"
FT   CDS_pept        639913..640449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0616"
FT                   /locus_tag="GK0616"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0616"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74901"
FT                   /db_xref="GOA:Q5L2C9"
FT                   /db_xref="InterPro:IPR023774"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2C9"
FT                   /protein_id="BAD74901.1"
FT                   /translation="MATVDPIRYPIGTFQAPQQFEAGEVQEWIAAIRGLPSDLRTAVSG
FT                   LNDEQLNTPYREGGWTVAQVVHHLADASMNAFLRTKWGVTEDGPTVKPFAESEWAKTAD
FT                   ACLLPIEPSLLLLDGLHARWAALLESMTEADFHRTVRPEGAAGEMPLYVLTALYAWHGK
FT                   HHTAQVASLRKRKGW"
FT   CDS_pept        640667..641872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0617"
FT                   /locus_tag="GK0617"
FT                   /product="antibiotic resistance protein (antibiotic efflux
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0617"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74902"
FT                   /db_xref="GOA:Q5L2C8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2C8"
FT                   /protein_id="BAD74902.1"
FT                   /translation="MGAEQQPLIAEQKEKIWTKDFVLICLANFFVFLGFQMTLPTLPLF
FT                   VEHLGGNDQLIGVVVGVFTFSALIVRPFAGHALETKGRRFVFLLGLLIFVISVGSYSLI
FT                   SSIFLLFLMRVVQGIGWGFSTTASGTVATDIIPASRRGEGMGYYGLSGNIALAFGPSLG
FT                   LVLAAMIPFSHLFAICAALGVASVLFAAAITYKKAEAVHGKGANRWDLYEKSALTPSLL
FT                   LFFLTVTFGGIASFLPLYTAQKQIGGLQLYFLLYALALMVTRTFAGQLYDRKGHRAVFL
FT                   PGAGLILLAMLLLAWLPGEWALLLAAVLYGFGFGMVQPGLQAWSVERAPAHRKGMANAT
FT                   FFSFFDLGVGVGAIVFGQISHWFGYPSIYLAASGSVFLSMLVYLSVLHKEQSLRPRERK
FT                   NA"
FT   CDS_pept        643476..644159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0618"
FT                   /locus_tag="GK0618"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GK0618"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74903"
FT                   /db_xref="GOA:Q5L2C7"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR026285"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2C7"
FT                   /protein_id="BAD74903.1"
FT                   /translation="MSFAKQLRQAADPIWQASFRHPFVQELGQGTLAREKFRYYVMQDA
FT                   YYLRHFARVQAIGAAKSPDLATTARLAHHAQSTCEAELSLHETFAELLGITEEERAAFI
FT                   PAPTAYAYTSHMYRAAYEGHLGDVIAAILPCYWLYYEIGERLKTCRPNDPIYEKWIGTY
FT                   SSDWFRSLVEEQIARLDDIADEVTEEDRHRMKRHFLISSEYEYEFWEMAYRLEQWPSAE
FT                   LAASR"
FT   CDS_pept        644183..644773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0619"
FT                   /locus_tag="GK0619"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0619"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74904"
FT                   /db_xref="GOA:Q5L2C6"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2C6"
FT                   /protein_id="BAD74904.1"
FT                   /translation="MEVKTKGLRLVDILTTIVIAIVFGVIYKLWGPLYSAVGAVGFHLD
FT                   QFIYGMWFIASSLAYLLIRKPGVALLAEIAASSGELIMGSQWGLEVLIYGVVQGLLAEL
FT                   VFAAFRYRRFDTFVVSLGAVGATIGSLIMDFYKGYIEALAPWNMALFLLARFIGAILIS
FT                   GVLAVSLAKALEKTGVTQMWRPASKDDYDALNR"
FT   CDS_pept        644788..646239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0620"
FT                   /locus_tag="GK0620"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0620"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74905"
FT                   /db_xref="GOA:Q5L2C5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2C5"
FT                   /protein_id="BAD74905.1"
FT                   /translation="MKQAIAIDRLRLKFPGSDGLLFRDLSLSIAEGEKVLLLGPSGCGK
FT                   STLLQVMAGIIPRSIDVPMKAERLKRPERWGYVFQDPDAQFCMPYADEEIAFALENRSV
FT                   PRHEMPVRIRALLNQVGLEIAPHTDIHTLSGGMKQRLALASVLALEPDVLFLDEPTALL
FT                   DEEGTKAVWQTVKQVGRGKTVIIVEHKIDHVLDFVDRIVLFGRDGRIIADGEAKAVFSD
FT                   YKDVIAAEGIWYPGVWDDYDRTARRRNRHRGEELLRLARFRGFRGREAKIYVPEATVHA
FT                   GEWIAVTGKNGAGKSTLLHALMQLIRTDGEYMLLGADIKRQHPLYRHIAFVFQNPEWQF
FT                   VAHSVREELAYSLRLEGRPKEEIEGIVDRLLREFDLVEQQDQHPYQLSVGQKRRLSVAA
FT                   SIVAGQRLFLLDEPTFGQDAKNTFALLEMLEAYREQGAAIMMVTHDEQIVRRFATRQWV
FT                   IEDGALVRDERLDIREPVLAEGGAG"
FT   CDS_pept        646239..647021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0621"
FT                   /locus_tag="GK0621"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0621"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74906"
FT                   /db_xref="GOA:Q5L2C4"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2C4"
FT                   /protein_id="BAD74906.1"
FT                   /translation="MKWEVRCRETWLHETNPSLKLIVLVVLFFAVLFIHNPNVLINVSL
FT                   ALFVLFCFGTGYPANVLFWLFLPFFLVFVSTASSMMMFGEGTTTWVRWGLIHVTAESFW
FT                   RGVHIGFRALALGLLGLIFSLTTRPVPLFYSLMQQLRLKPKYAYSFLAAVRLLPIMLEE
FT                   FQAIRYALTVRGVPNKGVLSKVKRYAIPLLSQSIRRAQRIAVAMEAKQFSGSGRRTFYY
FT                   EIGFGKYDIWLVALFAALMFAAYYVGVHYPYISISDVR"
FT   CDS_pept        647038..647643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0622"
FT                   /locus_tag="GK0622"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:GK0622"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74907"
FT                   /db_xref="GOA:Q5L2C3"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2C3"
FT                   /protein_id="BAD74907.1"
FT                   /translation="MGVLHFVSTGRQTVDEFAAICAHTHPYADLIHIREKGKTAREVAA
FT                   FVAALLRVGVPLQKIIVNDRVDVAAVYGVKGVQLAYHSLPVRAVRRSFPDLTVGCSVHG
FT                   SEEAKQAEQDGAHFCLYGHIFPTDSKPGLPPRGLDSLAEIAAAVSIPVIAIGGIHAGNA
FT                   RRVLEAGAAGVAVLSAVFFAADPVAEAKRLADIVKGRG"
FT   CDS_pept        647647..648780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0623"
FT                   /locus_tag="GK0623"
FT                   /product="glycine oxidase"
FT                   /EC_number="1.5.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:GK0623"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74908"
FT                   /db_xref="GOA:Q5L2C2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PDB:4YSH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2C2"
FT                   /protein_id="BAD74908.1"
FT                   /translation="MTHRYDVAIVGGGVIGAAIGFELAKRRHRVAIFEKGTMGSGASSA
FT                   AAGMLGAQSEFSTSSPLVPLALQSRALMPALAEELRERTGIDIGLVEKGLIKLATTEEE
FT                   ADDLYRHYTFWRGIGEPVQWLTKGEALEMEPRLAAEALAGAMYIPGDGQVSAPDLAAAL
FT                   AYAAASAGACLYEYTEVFDIRSDSSGHVLDTTGGTFAAEAVVIASGAWAARLGARVGLS
FT                   LSVYPVKGECVMVRAPVPLLQTTVFAKNGCYIVPKSGNRLLIGATSTPGTFDRRVSAGG
FT                   VMNLLHRAAHLVPDIEQAEWVASWSGIRPQTEDGLPYLGEHPERRGLFVAAGHYRNGIL
FT                   LSPLTGLLVADLVERKETAFDLAPFSLTRHIGKVGVE"
FT   CDS_pept        648777..648980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0624"
FT                   /locus_tag="GK0624"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0624"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74909"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2C1"
FT                   /protein_id="BAD74909.1"
FT                   /translation="MTLVINGETVAVPDEVKTVGDLLAHFRLENKLCIVEVNVRIIQKH
FT                   EYGTTVLCDGDRVEIVHFVGGG"
FT   CDS_pept        648977..649750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0625"
FT                   /locus_tag="GK0625"
FT                   /product="thiamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0625"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74910"
FT                   /db_xref="GOA:Q5L2C0"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2C0"
FT                   /protein_id="BAD74910.1"
FT                   /translation="MMMLKIGPYEFSSRLLLGTGKYPSLDVQKEAVEASGAEILTFAVR
FT                   RMNIFSPEQPNFLEQLDLSKYKLLPNTAGAKTAEEAVRIARLAKASGLCDMIKVEVIGC
FT                   DKTLLPDPIETLKAAEMLLEEGFIVLPYTSDDVVLAKRLEELGCHAIMPGASPIGSGQG
FT                   IINPLNLSFIIEQANVPVIVDAGIGGPADAALAMELGADGVLLNTAVSGAADPVKMAKA
FT                   MKLAVEAGRLGYEAGRIPKKRYASASSPTEGMSVV"
FT   CDS_pept        649747..650772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0626"
FT                   /locus_tag="GK0626"
FT                   /product="thiamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0626"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74911"
FT                   /db_xref="GOA:Q5L2B9"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2B9"
FT                   /protein_id="BAD74911.1"
FT                   /translation="MNERYSRQQLFAPIGEEGQKKIRGKHVVLVGAGALGTGNAEALVR
FT                   AGIGKLTIIDRDYVEWSNLQRQQLYSEADAKERLPKAIAAKRRLEQINSEVEIEAIVGD
FT                   AGPEELETIALKQRPDLWIDATDNFDTRLVINDVAYKYNIPWIYGACVGSYGLSCAFIP
FT                   NRTPCLYCLLETVPQGGLTCDTAGIISPAVQMVVSYQMAEALKILVEDWSALRGKLVSF
FT                   DLWTNEYASIRIDGVKKDGCPTCGRHPSYPFLSYEQRTKTAVLCGRDSVQIRPPAPRQY
FT                   DLNELAELFRRQGLQAEANPYLVSVSLGDKRLVVFRDGRALVHGTKDVQEAKAIYYRYL
FT                   G"
FT   CDS_pept        650824..651000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0627"
FT                   /locus_tag="GK0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0627"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74912"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2B8"
FT                   /protein_id="BAD74912.1"
FT                   /translation="MFIKLSKRHPSPPCFSRRQYGTMKEGKKREGKTNGRVVGDIQHCL
FT                   IACSCVFDWFLLA"
FT   CDS_pept        651255..652526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0628"
FT                   /locus_tag="GK0628"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0628"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74913"
FT                   /db_xref="GOA:Q5L2B7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2B7"
FT                   /protein_id="BAD74913.1"
FT                   /translation="MEEWPLRLFGWFFLSLLANALFASAEAAFSSASKARLRHYAEEHL
FT                   HNKRLQAVIGQLDRVLLALAVANRLTSVVTVVLFTDIAVSLLGEQMGLFATLAVMTVLF
FT                   VVFGEILPKSMAKEHAEQLAIRYAGLAYGLMKLMTPVTASLQALKDRIAKRFANGVAVP
FT                   AVTEEDIKVMVELSEEEGVIDNKEKELIQRSLDFDEILVGEIFTPRADMVAVEVNQPIE
FT                   EIRDVFLEEKYSRIPVYEGDIDNVIGILSESDFFSELVQKREVRIRDLLRQPLFVVESM
FT                   KVSDLLPELQKSKVHMAIVVDEFGGTAGLITLEDILEQIVGEIWDEHDEAVKTVRQIDE
FT                   HSFEFSAELPLDEFCEVMNIDVPRSESHTLGGWIFEMFERIPAVGETLQYGSLTFTVRQ
FT                   VDNRRIRKVLVSLSQPLAEQAGGA"
FT   CDS_pept        complement(652611..652823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0629"
FT                   /locus_tag="GK0629"
FT                   /product="small acid-soluble spore protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0629"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74914"
FT                   /db_xref="GOA:Q5L2B6"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2B6"
FT                   /protein_id="BAD74914.1"
FT                   /translation="MARNNNNNQLLVAGAQQAIDQMKYEIAQEFGVNLGADTTSRANGS
FT                   VGGEITKRLVAMAQQQLGGQFGNIQ"
FT   CDS_pept        653113..653355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0630"
FT                   /locus_tag="GK0630"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0630"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2B5"
FT                   /protein_id="BAD74915.1"
FT                   /translation="MNVCPLCNGLRRVTVYCSYCRQPMEDHGKVTDYFDDYSPYMDADV
FT                   MKLVDGYLRTYTNHECVHLFYCPTCHEEEVRFIKE"
FT   CDS_pept        complement(653438..654550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0631"
FT                   /locus_tag="GK0631"
FT                   /product="sugar ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0631"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74916"
FT                   /db_xref="GOA:Q5L2B4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2B4"
FT                   /protein_id="BAD74916.1"
FT                   /translation="MAELILDHIYKIYDNNVVAVKDFNLHIQDKEFIVFVGPSGCGKST
FT                   TLRMIAGLEEISKGDLYIDGKRMNDVPPKDRDIAMVFQNYALYPHMSVYDNMAFGLKLR
FT                   KFPKAEIDKRVREAARILGLEQYLDRKPKALSGGQRQRVALGRAIVRDAKVFLMDEPLS
FT                   NLDAKLRVQMRSEIAKLHQRLETTTIYVTHDQTEAMTMATRLVVMKDGVIQQVGTPREV
FT                   YEKPENIFVGGFIGSPAMNFLRGTLQDGKFVVGQTSFGIPEGKMKVLREQGYVGKEVIL
FT                   GIRPEDIHDEPLFLEASPATKVTALVEVAELLGAESMIYFSIDNQELVARIDARTEIKP
FT                   GHRIDLALDMNKAHFFDVETERRIRAADEK"
FT   CDS_pept        complement(654679..655569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0632"
FT                   /locus_tag="GK0632"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0632"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74917"
FT                   /db_xref="GOA:Q5L2B3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2B3"
FT                   /protein_id="BAD74917.1"
FT                   /translation="MLKELESLYEGDIVINGQPEHPEDYEWFYTADGDEIGIAKHRLTE
FT                   QERRLLALFFTPAERRREPESEEERAWKRWMATGDPAALARLAAPYCRFIHFTASRPIA
FT                   NKEEFADAVRGLFSSPVAIVWEQDRRGLIVEAKQKRTTEPPSLADMAEALAADFYTAIH
FT                   LLIGPIRSVDERLYESFLLEKECFSAARRFWPKRTVYEWEDVIPLPLFEEGAVSEKARR
FT                   TLSFLDGFDEEEVRAMETFLQCNLNVSMAAKKLYMHRNSLQYRIDKWTEQTGVDIKRFK
FT                   GAAAVYLAILHRRRS"
FT   CDS_pept        complement(655809..655997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0633"
FT                   /locus_tag="GK0633"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0633"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74918"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2B2"
FT                   /protein_id="BAD74918.1"
FT                   /translation="MERNEAERRDSLYEGRDEYYMDIDRMINEGMAGGAVYGHGDDVNI
FT                   EEARDLVKEEPPYEAGQ"
FT   CDS_pept        656113..656514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0634"
FT                   /locus_tag="GK0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0634"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74919"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2B1"
FT                   /protein_id="BAD74919.1"
FT                   /translation="MIMLIKKLLETTAAAEEKARQLAEMETDEAWAVYLAEAERQRKLW
FT                   QYVHYLVAGANADGRAEREQSKAGAPRCDLLQAMAAAEWEKAMLCQNVCQSLNGAAKQA
FT                   VDAVFRQALRYSGQFLAMAYDERARQTAD"
FT   CDS_pept        complement(656474..657640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0635"
FT                   /locus_tag="GK0635"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0635"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74920"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2B0"
FT                   /protein_id="BAD74920.1"
FT                   /translation="MLTIGYRPDTGEWVCNSPGGPYRFGSGWVAPAAVLPDLVFPVREQ
FT                   DGRVGPLVGVLISASSLSALLAGKKPWLETVIRSIHKAGGISVVSAAAGIGEKTVSGYL
FT                   FVPTLHRFIEAAAPLPDVVYNRVKSREEEESEPFQTAAAQLSAHGVPLVNRSFFRKSDV
FT                   YDALRSDRRLWPHLLPTAPVQTATDLRAWLRQYSCIYLKRDDGARGMGLFRLTALSETE
FT                   AICEYPGGQKRFCSLDALASLIQSGRYIAQALAETDEWNGRRYDLRVLAHWHNGRHTIT
FT                   GIGVRSADVESVTTHVFHGGTILPYKEVKERIDEAALERLIALSGARLGERFGFVGEFS
FT                   ADIGVGSEQQLYIYEINAKPMVFDEPEIEARRLERLNQLFAELAHRTP"
FT   CDS_pept        complement(657634..658983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0636"
FT                   /locus_tag="GK0636"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0636"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74921"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2A9"
FT                   /protein_id="BAD74921.1"
FT                   /translation="MTYTLIIDEQQTNTVILPATLQASRQTSAAFGSLVTPCRVISSPR
FT                   LVDRVIVAHDVARCLSIPFAADVHVFLTDEAVHFGPLVGILTAGFTKSLHRPVGSRSFF
FT                   FAKLLAQEKQVGGFAFLFGAPHIDWENGMTNGYFYTERGWERHTVPLPNVVYNRLPNRR
FT                   VEKEETFQTMTKTLQTTYGIPIFNGCFFNKWDIYRRLAAHPKAQPYLPATSAHVTQHTI
FT                   EQFLARYREAYIKPADGSLGRGIYHLAKKNAYECRFRDESGEIQTVLFPTAMAVWHHLL
FT                   AHAPLHRYVIQQAVPLLAVNGRPADFRVHVNKNEHGIWQVSAIAAKIAGKQSITTHMNS
FT                   GGIVKTLEEIFPDAAEREIMLARLSDAALTLSRCLDEASETLIGEIGFDLGVDQQGRIW
FT                   MFEANSKPGRSIFKHPKLKDADERTARLPLAYAVHLSKTAITEPEALWPC"
FT   CDS_pept        complement(658961..660046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0637"
FT                   /locus_tag="GK0637"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0637"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74922"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2A8"
FT                   /protein_id="BAD74922.1"
FT                   /translation="MLSLGFVTLDEQQDHTYCTEVAKCARRYGISVCRFSPLDIDPQTE
FT                   NVRGFLFQEETNEWTNAVFAIPPFLYDRCFYGNDERSKKAKPIMNWLKQRPDLTFLGYG
FT                   LPGKWDVYEALSSHPLLSAYVPPTVRLERADDVLALLRREQAAIAKPVHGSGGRGICIF
FT                   QKKGKALSVQDSHGQEQAVIARRSELEQLLASWSRRGEYVLQPLLQLSTPEGEPFDLRI
FT                   LLQKDENGRWVERVRAVRVGRPGAWVANVRAGADIRPFSEWLDRLSSSKRLFVLDGVET
FT                   IIRTLPVYMDHTFGPLFEIGLDLGATDNGAVWILDVNSKPGRKVAHLLPPEQQNELYEA
FT                   PLRYCLFLARGGKANDLHVDH"
FT   CDS_pept        complement(660053..661129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0638"
FT                   /locus_tag="GK0638"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0638"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74923"
FT                   /db_xref="GOA:Q5L2A7"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2A7"
FT                   /protein_id="BAD74923.1"
FT                   /translation="MSKQRTMAVLTEINETSERAAFGSIHHFCEELAAYARKRGLFFYV
FT                   SSPALYLEGVGYQWTESGWGKRDVPPADVVYNRLHSRKLERSPLFAELLARLAEENGMM
FT                   FNHRFLHKWEVHCHFERHEYLHPHLPKTALWSGQHTLEAFLDAFPSVFLKPIYGSQGRG
FT                   IFCLQHSDDGICLRHSTSASTAVYRSMDALASALRQQIRTPMIIQQGLELRTLDGRPVD
FT                   FRLLCHRARHNDWRVTSAVARVAPPDQFVANLARGGELMAVNDVLRKWYTRADAFQQKQ
FT                   LLKEIALESAAVLASEAEGLYGEFGVDLAIDIHGQPWIIEVNTKPSKQTDMAASYQSVR
FT                   PSAKAIIDYSLTLMEEKE"
FT   CDS_pept        661256..662389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0639"
FT                   /locus_tag="GK0639"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0639"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74924"
FT                   /db_xref="GOA:Q5L2A6"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="InterPro:IPR016991"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2A6"
FT                   /protein_id="BAD74924.1"
FT                   /translation="METFVYLLFMVAVGALIGGVTNFIAIVMLFRPYEPMYVFGKRLPF
FT                   TPGLIPKRRRELAEQLGKTVVEHLVTPEGLRRKLMDPSFTAEMAEWGREWLRKWLARKE
FT                   TPAELLERLGIRSPAERLEAMAAEQAERAYERWSETWRLRPIRDVLPAELKQTMEARVE
FT                   SLAGYLADRTLDYFRSEEGKQQISSMIERFFQERGMVGNMLQMLLGNVNFVDKVQAELG
FT                   KFLRHAGTREVLSRLLWTEWNKWLDYPLATVEEMIGRRRIDEAVRSAARRLVQSGSWLH
FT                   RPLDELIAPYEQPLFDRLIPQAAATVSCLLSDKIEAIVAQLGLADIVRDQVESFSLRRL
FT                   EAIILSIARRELKMITYLGALLGGLIGAVQGVIGLWL"
FT   CDS_pept        662461..662820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0640"
FT                   /locus_tag="GK0640"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0640"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74925"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="PDB:2OEQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L2A5"
FT                   /protein_id="BAD74925.1"
FT                   /translation="MSEPLHALAKQLEQAIRASEPFQQLKRAYEDVRRDETAYRMFANV
FT                   RDIQLQLHEKQMRGAAILPDEIEQAQKAMALAQQNEKLARLMALEQQMSMTIAEVQQIA
FT                   MKPLEELHRSFMEGR"
FT   CDS_pept        662954..663817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0641"
FT                   /locus_tag="GK0641"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0641"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74926"
FT                   /db_xref="GOA:Q5L2A4"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2A4"
FT                   /protein_id="BAD74926.1"
FT                   /translation="MYKLLALNIDGTILKNNGRLPRETKEAVDYVKKKGVYVTLITSRN
FT                   LLSARKVAKALRLDGMLIAFQGAMIARTLDDRLFDAVIPEERTFNIVQILENFNCNIRL
FT                   MHERYSLGNRKKVKKNLVVQTVLSSSDPFFYPTQFVDSLGDVLIDEPIAVPKIDVYFAT
FT                   DEERDAAAALLTKSIPSIDMIMQPNGKMEIVPQGVSKLAGLRRLAQHIGVSLKETVMIG
FT                   DGLDDLPAIEAAGLGVAMGNAPLEVKRAADWVTRSNEQLGVAYMVKEHFRKQQRIEFLQ
FT                   KLKTKQ"
FT   CDS_pept        664038..665537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0642"
FT                   /locus_tag="GK0642"
FT                   /product="Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0642"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74927"
FT                   /db_xref="GOA:Q5L2A3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023995"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2A3"
FT                   /protein_id="BAD74927.1"
FT                   /translation="MRIEIQGLPHPERFQRPLEVMTELFFEAPELSLAPLPEADMAVMF
FT                   SVKEDGCIAVSGTLLDKTSGRVEEASHECSTPADADGKTYEKQLKNAVLHVYLTLLERS
FT                   TGLIQPWGVLTGVRPVKLLHQLLRSGLSKEEAHRKLAEEYLVTNEKIELMQAIVDRQLT
FT                   VVPDLYDLAHEVSIYIGIPFCPTKCAYCTFPAYAINGRQGSVDAFLAGLHYEMEAVGRF
FT                   LRERGIRITTIYYGGGTPTSITADEMDRLYAHMYDVFPDVDRVREITVEAGRPDTITPE
FT                   KLEVLKKWRIDRISINPQSYIQETLKAIGRHHTVEETIHKFHLARQMGMNNINMDLIIG
FT                   LPGEGLAEFTHTLAETERLMPESLTIHTLSFKRASEMTKNKQKYKVASREEVQAMMKAA
FT                   QEWTKEHGYVPYYLYRQKNILGNLENVGYALPGQESIYNIMIMEEQQSIIGLGCGASSK
FT                   FVDPKTRNITRQANPKEPKVYNEHFAEYTEEKINILKEIFG"
FT   CDS_pept        complement(665575..665760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0643"
FT                   /locus_tag="GK0643"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0643"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74928"
FT                   /db_xref="InterPro:IPR025544"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2A2"
FT                   /protein_id="BAD74928.1"
FT                   /translation="MPMYTLTAFERNGEKLLDETFEAANDEEAKKIGEQKLRERGCWDK
FT                   THRCVNASGKLILFHR"
FT   CDS_pept        665910..666809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0644"
FT                   /locus_tag="GK0644"
FT                   /product="ABC transporter (ATP-binding protein) (Na+
FT                   exclusion)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0644"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74929"
FT                   /db_xref="GOA:Q5L2A1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2A1"
FT                   /protein_id="BAD74929.1"
FT                   /translation="MSLEIIEVTKRFGQATAVDHLTLTVPEGEMFGLLGANGAGKTTTF
FT                   RMILGLLLPTEGVIRWQGEPIDYSKGHLIGYLPEERGLYPKLKVQEQLLYLGRLRGMKK
FT                   TDILPEIDRWLERFHIRDYANKRVEELSKGNQQKIQFIAAVLHRPKLLILDEPFSGLDP
FT                   VNVELLKEAVLDLKRNGTTIVFSSHRMEHVEELCEHVCILRRGRAVVAGALRELKRSFG
FT                   KQILVIQGDGPFEELARFPGVLQWKRTAEGVRLQIANEETAQAILGHIAGKVAVRLFAL
FT                   EEPSLNDIFIEKVGAAYE"
FT   CDS_pept        666802..668031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0645"
FT                   /locus_tag="GK0645"
FT                   /product="ABC transporter (permease) (Na+ exclusion)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0645"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74930"
FT                   /db_xref="GOA:Q5L2A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L2A0"
FT                   /protein_id="BAD74930.1"
FT                   /translation="MNKFFLVAGHTYGTKLRAKAFLVTTAITCLLIIGVANIQPIIEFF
FT                   TGDEKTHVAVIDRTGSLYGPLEKQVSHDQIALTKITDMENEAKEAVKEGKWDGLLVLSM
FT                   DAEGLPEAVYYANTIVDNQTPEELKRALSQLKTALSAAKLGLTDEQMAELYKPVPFQKV
FT                   ALEKNAKTEEELNQARALVYVLLFAMYMFVLMYGGMIATEVATEKSSRVMEILVSSVPP
FT                   VQQLFGKIIGVALVSLTQFFVFFAVAFAALKTSGQEVWRFLGFDHLPASIFVYALVFFL
FT                   LGYLLYAVLFAVLGSLVSRVEDVQPAITPVMMLVVAAFMIAMFGLNAPESAFVTGASFV
FT                   PFFAPMLMFLRIGLVSVPGWEVALCLVLLAATIALLIYFGAKVYRGGVLMYGRMNIFKD
FT                   IKRAIQLTKK"
FT   CDS_pept        668150..669127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0646"
FT                   /locus_tag="GK0646"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0646"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74931"
FT                   /db_xref="GOA:Q5L299"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020873"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L299"
FT                   /protein_id="BAD74931.1"
FT                   /translation="MAKGIIHYEVGEQVDLFLLIKSATKGIASNGKPFLTLILQDKSGD
FT                   IEAKLWDVSPDDEERYVPECIVKVAGDIHNYRGKLQLRIRSIRPAHPGDAVRIDDFLEK
FT                   APLGREEMKAKVMEYIFAMENPNIQRITRYLLKKYEKAFFEYPAATKNHHEFISGLAYH
FT                   VVSMLELAKALIHLYPSLNKDLLYAGVILHDLGKVIELSGPVSAAYTLEGNLLGHISIM
FT                   VSEISKAAEQLGIQGEEVVILQHLVLAHHGKAEWGSPKPPLVKEAEVLHYIDNLDAKIT
FT                   MIDRALEKVKPGEFTERVFALDNRSFYKPAFLSVSKPKNPGSKE"
FT   CDS_pept        669145..669279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0647"
FT                   /locus_tag="GK0647"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0647"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74932"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L298"
FT                   /protein_id="BAD74932.1"
FT                   /translation="MIMIEPIIEIVPTTQYEQAKEELNELRRQWKKAKKKTKKKRNEA"
FT   CDS_pept        669392..669580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0648"
FT                   /locus_tag="GK0648"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0648"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74933"
FT                   /db_xref="GOA:Q5L297"
FT                   /db_xref="InterPro:IPR025428"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L297"
FT                   /protein_id="BAD74933.1"
FT                   /translation="MLSLPWWVYLVVAGIIFSGYMTVKTAAREREIDEAFIEKEGEIYM
FT                   ERIRKERERRKQAKSLQ"
FT   CDS_pept        669710..670792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0649"
FT                   /locus_tag="GK0649"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:GK0649"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74934"
FT                   /db_xref="GOA:Q5L296"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L296"
FT                   /protein_id="BAD74934.1"
FT                   /translation="MKRAYNFNAGPSALPLPVLERAQKELLNFQNTGMSVMELSHRSKE
FT                   YEAVHHAAKERLKRLLNVPDGYDILFLQGGASLQFSMVPMNLLTEGKIGCYVLTGAWSE
FT                   KALKEAQKIGLTTVVASSKEANYTYIPPLDDVQWPKNAAYVHITSNNTIFGTQWKEFPN
FT                   TPVDLVADMSSDILSRPFDVSQFALIYAGAQKNLGPSGVTVVILRNDLLERIPDGLPTM
FT                   LDYRTHQKSNSLYNTPPTFAIYMLSLVLEWVEEQGGVAAMEERNQQKAAVLYEAIDESG
FT                   GFYKPHAEKGSRSLMNVTFTLPNEELTKTFLAEAKERGFVGLGGHRSVGGCRASIYNAV
FT                   PLEACEALASFMNEFRRRFA"
FT   CDS_pept        670888..671412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0650"
FT                   /locus_tag="GK0650"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0650"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74935"
FT                   /db_xref="GOA:Q5L295"
FT                   /db_xref="InterPro:IPR031360"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L295"
FT                   /protein_id="BAD74935.1"
FT                   /translation="MNVRALVSMALLVGIGAVLHAVIPGLFFGMKPDMMLAMMFLAILL
FT                   FPNVKAVGLVGVVTGLISAMTTTFPGGQLPNMIDKIITAFVVFALATLMKAYSQTVIGA
FT                   SVLAAVGTVISGGVFLAAALLLVGLPGGATFSALFVTIVLPTAALNAVAMAIIYPIASS
FT                   IFRRMNVTAHV"
FT   CDS_pept        complement(671506..671691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0651"
FT                   /locus_tag="GK0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0651"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74936"
FT                   /db_xref="GOA:Q5L294"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L294"
FT                   /protein_id="BAD74936.1"
FT                   /translation="MYIQWLLIAVGFLFFCLFINAFFALWKARAYPPKALLKERTLRYI
FT                   GIAFICLLTAWLLSYV"
FT   CDS_pept        671849..672454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0652"
FT                   /locus_tag="GK0652"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:GK0652"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74937"
FT                   /db_xref="GOA:Q5L293"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR023488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L293"
FT                   /protein_id="BAD74937.1"
FT                   /translation="MKATEQHYSIKEAMLFSQRIAQLSKALWKSIEKDWQRWIKPFDLN
FT                   INEHHILWIAYHFKGASISEIAKFGVMHVSTAFNFSKKLEEKGLLSFSKKQDDKRNTYI
FT                   ELTEKGEEVLMKLMETYDPTKNAVFNGALPLRELYGKFPEILEMMCIVRNIYGDDFMEI
FT                   FERAFENIKEDFIEQDGKLVKRKPKTEEHEKELASQAN"
FT   CDS_pept        complement(672447..672788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0653"
FT                   /locus_tag="GK0653"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0653"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74938"
FT                   /db_xref="InterPro:IPR015058"
FT                   /db_xref="InterPro:IPR035945"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L292"
FT                   /protein_id="BAD74938.1"
FT                   /translation="MESLEKRVAKLEFHQSLLMEMIDETKKPFYSLIIRADLTKEEVDA
FT                   FLAFCQELADQYEQQKAEGLTIFTPLLVQFAGMLHPNLPLEQTVDALLAQQMFVPLMTE
FT                   LKTLIRTIS"
FT   CDS_pept        672979..673158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0654"
FT                   /locus_tag="GK0654"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0654"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74939"
FT                   /db_xref="GOA:Q5L291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L291"
FT                   /protein_id="BAD74939.1"
FT                   /translation="MVLYFILLAVTVLFFINQLTHSLCAQRDIPEEQQPAVFRTINVLI
FT                   TILLISSYFEVLFT"
FT   CDS_pept        complement(673300..673389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0655"
FT                   /locus_tag="GK0655"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0655"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74940"
FT                   /db_xref="GOA:Q5L290"
FT                   /db_xref="InterPro:IPR010070"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L290"
FT                   /protein_id="BAD74940.1"
FT                   /translation="MSAPYSGGFALIVVLFILLIIVGCACVIY"
FT   CDS_pept        673645..674490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0656"
FT                   /locus_tag="GK0656"
FT                   /product="post-translocation molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:GK0656"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74941"
FT                   /db_xref="GOA:Q5L289"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR023059"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L289"
FT                   /protein_id="BAD74941.1"
FT                   /translation="MKKWMMAAAVVSLMALSACSNDGSEAIVETKNGNITKDEFYNEMK
FT                   ERVGKSVLRDLIDEKVLSKKYKVTDEEIDREIERIKEAYGTQYDLAVQQNGEKVIREMV
FT                   KLDLLRTKAAVEDIKVTEKELKEYYDNYKPKIRASHILVKDEKTAKEVKAKLDKGEDFS
FT                   KLAKEYSQDPGSASNGGDLGWFGPGKMVKEFEEAAYKLKVGEVSDPVKTDYGYHIIKVT
FT                   DKEKKKSFNEMKDEIAFEVKRNKLDPATMQSKVDKLVKDAGVEIKDKDLQDVIEQQGKQ
FT                   "
FT   CDS_pept        complement(674568..674999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0657"
FT                   /locus_tag="GK0657"
FT                   /product="Hit-like protein (cell-cycle regulation histidine
FT                   triad)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0657"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74942"
FT                   /db_xref="GOA:Q5L288"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L288"
FT                   /protein_id="BAD74942.1"
FT                   /translation="MTTVSDCIFCKIINGELPAAKVYEDDHVLAFLDISQVTKGHTLVI
FT                   PKVHTENIFTLTSEAAGQLFRAVPTIANALRRAFSPVGLNLLNNNGEQAGQTVFHYHLH
FT                   LIPRYGKGDGFGAVWKSHASDYTPADLQAIAAAIREQLG"
FT   CDS_pept        675456..676193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0658"
FT                   /locus_tag="GK0658"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0658"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74943"
FT                   /db_xref="GOA:Q5L287"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L287"
FT                   /protein_id="BAD74943.1"
FT                   /translation="MTLLEVKDLSGGYTAQNVLEDVTFVVDRGEMVALIGLNGAGKSTT
FT                   IKHIIGLMEPRRGAISINGYRLADGPETYRRQFAYIPETPVLYEELTLEEHLRLAAMAY
FT                   GLSEAEYERRLPPLLREFRLERRLSSFPAHFSKGMKQKVMIVCAFLLEPPLYIIDEPFL
FT                   GLDPLAIHALLERMNEQKAKGAGILLSTHILATAERYCDSFVILHNGRVKAKGTLDDIR
FT                   RQFGLRGASLDELYVELTKDDAP"
FT   CDS_pept        676190..677404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0659"
FT                   /locus_tag="GK0659"
FT                   /product="ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0659"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74944"
FT                   /db_xref="GOA:Q5L286"
FT                   /db_xref="InterPro:IPR010288"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L286"
FT                   /protein_id="BAD74944.1"
FT                   /translation="MIDARRLWKQRFQLEWRKRIRYLRYMFNDHLLVGLIIVLGGIAVM
FT                   YERWAASLPDSFPYPAIAAVVFGWAAAAGSVRTLFREADTVFLLPAEERLGPYIQRAFF
FT                   VSWLWQAYGLSLLLLLAGPLHARFSPVSWPLFLFGLFCFKGWSLWASWQGSYIADPSFH
FT                   RFGAFTRFILAAVFVYLVLVAAPWPFFVVLVGLMAVLSICLSRLTRGKTWKWERIIAEE
FT                   QRAATAFYRLANLFTDVPEWREAAKRRRWLDSLLALIPYDKRHVFFHLYARTFLRAGGY
FT                   AGLYVRLTAIGGFMLAVIDHQYGRAAIAFLFLYATAVQLAALPSHHRYSLWPRLYPLPQ
FT                   AQPDAAAVRLLSILLIGQNTVFHLVLLAVSPRLLWLATWLGGNIWGLWMAGRYVRLQRG
FT                   QKAGR"
FT   CDS_pept        677554..678954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0660"
FT                   /locus_tag="GK0660"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0660"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74945"
FT                   /db_xref="GOA:Q5L285"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L285"
FT                   /protein_id="BAD74945.1"
FT                   /translation="MGVELVALHWIYLLFIVLIIGFMVARKDTSLICIAGIFLLAAVAT
FT                   HSLSAAVSGVFNSFIYAITELLPTILVISIIVAMSKVLSATGINDVMVSPFVRFIRTPA
FT                   WAYWTIGILMMIISWFFWPSPAVALMGAVLLPAAVRVGLPALGVAMAMNLFGHGIALSG
FT                   DFIIQGAPKLTADAAGLSVGDVIAASVPLVFVMGAVTTVTAFYLLRRDMKRGRLASGEA
FT                   EMAATVDSTLEKTSHLLTGQTKKWLALLIPILFALDVIAMFYLRLQGGEATALVGGTAI
FT                   FILILISVLAHRQESFAEVTNYFIEGFQFGFKVFGPVIPIAAFFYLGDAGFVKIIGDYL
FT                   PQASQGIVNDLGVALAHAVPLNNEVGAVTLTIVGAITGLDGSGFSGISLAGSIAHLFSV
FT                   AIGGGTATLTALGQIAAIWVGGGTLVPWALIPAAAICGVDPFELARRNLIPVAVGLVVT
FT                   TVVAMFLI"
FT   CDS_pept        679153..680196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0661"
FT                   /locus_tag="GK0661"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:GK0661"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74946"
FT                   /db_xref="GOA:Q5L284"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L284"
FT                   /protein_id="BAD74946.1"
FT                   /translation="MEMARQINDTFLRACRGEQTSYVPVWYMRQAGRSQPEYRALKEKY
FT                   SLFEITHQPELCAYVTRLPVEQYGVDAAILYKDIMTPLPAIGVNVEIQGGIGPVIANPI
FT                   RSLQDVERLGEIDPEHDVPYVFETIRLLVNEQLDVPLIGFAGAPFTLASYMIEGGPSKN
FT                   YHKTKAFMYAEPKAWFALMDKLAEMTIRYVRAQIRAGASAVQIFDSWVGAVSADDYRTF
FT                   IKPAMARIFAALREEGAPLIMFGVGASHLVHEWNDLPLDVIGLDWRLSIREARRQGIAK
FT                   AIQGNLDPAVLLAPWDVIEERVKRILDEGMERPGYIFNLGHGIFPDVQPATLKRLTAFI
FT                   HEYTSTN"
FT   CDS_pept        680213..681163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0662"
FT                   /locus_tag="GK0662"
FT                   /product="ferrochelatase (protoheme ferro-lyase)"
FT                   /EC_number="4.99.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:GK0662"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74947"
FT                   /db_xref="GOA:Q5L283"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L283"
FT                   /protein_id="BAD74947.1"
FT                   /translation="MVKKTAGLLVMAYGTPYREDDIERYYTHIRHGRKPPQEQIEDLKA
FT                   RYRAIGGLSPLAKITEEQAKRLEERLNEVQDEVEFRMYLGLKHIEPFIEDAVERMHDDG
FT                   IKEAVGIVLAPHYSTFSIRSYNERAKAAAKKLGGPTIYTIDQWYDEPKFLQYWAEQVRA
FT                   IFAAMPERERERAVLIVSAHSLPEKIIQAGDPYPTQLEDTAKRIADQAGVAHYAVGWQS
FT                   AGQTPEPWLGPDVQDLTRQLYEERGYTSFVYAPVGFVADHLEVLYDNDIECKQVTEEIG
FT                   ARYYRPEMPNTNPLFIDALASVVLKRWAEEGDRHE"
FT   CDS_pept        681156..682595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0663"
FT                   /locus_tag="GK0663"
FT                   /product="protoporphyrinogen IX /coproporphyrinogen III
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0663"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74948"
FT                   /db_xref="GOA:Q5L282"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L282"
FT                   /protein_id="BAD74948.1"
FT                   /translation="MNEGQRTVVIIGGGITGLTAAYYLQKAIREQRLPLACKLVEATHR
FT                   LGGKVQTVVRDGFVIERGPDSFLARKTSAFRLVKEVGLEHEIVHNATGTSYILVNGKLY
FT                   PIPGGAVMGIPTRIAPFLTTGLFSPAGKLRAALDFVLPPVKVDGDMPLGRFFRRRLGDE
FT                   VVDNLIEPLLSGIYAGDIDEMSLMATFPQFFQLEQKYGSLVRGARRTTPKEQKERKGAF
FT                   QTLKTGLQSLVDEVEKRLEPGSVIKGVRVERIVRTDSAYRLQLSTGEVWGADGIIVTTP
FT                   HHVVPDMFADYPFFAPFRSVPLTSVATVALAFPEEAIRQDIDGTGFVVSRRSDYTMTAC
FT                   TWTHKKWPHTAPPGKALLRCYVGRPGDEEIVDQPDDEIVRVVLDDLNKVMNIAGQPEFA
FT                   VISRWKRAMPQYTVGHRERLAHIKRQMGDALPGVFLAGSSYEGLGLPDCIDQGEKAVRD
FT                   VLLYLQQAPVQQTSDLYSSVR"
FT   CDS_pept        682914..683486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0664"
FT                   /locus_tag="GK0664"
FT                   /product="transcriptional regulator (TetR/AcrR family)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0664"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74949"
FT                   /db_xref="GOA:Q5L281"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L281"
FT                   /protein_id="BAD74949.1"
FT                   /translation="MASDRKRQIIEAAAQSFAAFGYKATTMEQIAKLANVGKGTIYTFF
FT                   KSKEELLDEIVSGLIMEIKAEAELAMDSSLPFSENVHRALYRILEFRQRHQLTAKLLQE
FT                   VRNIGTAAVQEVLAKLDRAMVEFIRQKIDAAVEKGEIRPCNSEITAFLMLKTYIALIVD
FT                   WEKDHEPLTKEQIAELFTLYFLQGLSR"
FT   CDS_pept        683501..683977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0665"
FT                   /locus_tag="GK0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0665"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74950"
FT                   /db_xref="GOA:Q5L280"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L280"
FT                   /protein_id="BAD74950.1"
FT                   /translation="MLEIDHTDNLVICTKEGAPYAAKRDAGHRAPPEFAWHLFTWIISI
FT                   TFMMIVQFLVTVFDNPGRFLAILLLIAQLVGSAGTYPIELVPGALQSLHPWLPMTHAIR
FT                   GLRAVISSGDFLVMWKEAAILLATAAVFALATLVYFLLRYRRRYAVWTETAAQT"
FT   CDS_pept        complement(684509..684646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0666"
FT                   /locus_tag="GK0666"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0666"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74951"
FT                   /db_xref="InterPro:IPR025432"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L279"
FT                   /protein_id="BAD74951.1"
FT                   /translation="MLMKVLEFFRNLPPKKCLHCGKEIDEQHECYGNTCSDCLGAAYRQ
FT                   "
FT   CDS_pept        684798..685532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0667"
FT                   /locus_tag="GK0667"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0667"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74952"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L278"
FT                   /protein_id="BAD74952.1"
FT                   /translation="MKVTVIGYWGGFPAANEATSAYLFEHDGFCLLVDCGSGALAKLQN
FT                   YTAVENLDAVIISHYHYDHIADIGPLQYARLIHKNLGADLPVLPIYGHVEDEAAFSRLT
FT                   HSGITEGIAYDPNGTLAVGPFSITFMKTVHPVPCYAMRITAGGKTVVYTADSSYIPEFL
FT                   PFAKGADLLICECNFYAGQNAAPAGHMTSEEAAAIAEGARVGELWLTHLPHVGRHEQLV
FT                   EEAGRTFRGVIRLAHTGLIWAQ"
FT   CDS_pept        685668..687212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0668"
FT                   /locus_tag="GK0668"
FT                   /product="long-chain fatty-acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0668"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74953"
FT                   /db_xref="GOA:Q5L277"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L277"
FT                   /protein_id="BAD74953.1"
FT                   /translation="MNVTTRLAQIAKQLPDKEAYVFMKERCTYQQLDEAISRFADGLAR
FT                   LGVRRGDHIALLLGNSPQFVIGLYGALRLGATVIPINPIYTPEEISYILHNGDVKAVIG
FT                   LDLLAPLFVEAKKRLPLLEHAIVCETPEGKEKGVSLSEGMKSFAEVLADGSQDFTGPEL
FT                   GDDDVAVILYTSGTTGKPKGAMLTHKNIYSNAQDTADYLGINENDRVIAALPMFHVFCL
FT                   TVALNAPLMNGGTVLIMPKFSPAKLFQLAREEKATIFAGVPTMYNFLYQYEGGSADDLR
FT                   TLRLCISGGASMPVALLENFEKKFNVIISEGYGLSEASPVTCFNPLDRPRKPGSIGTNI
FT                   KNVENKVVNEYGEEVPVGEVGELVVRGPNVMKGYYKMPEETSAALRDGWLHTGDLARMD
FT                   EDGYFYIVDRKKEMIIVGGYNVYPREVEEVLYSHPDVVEAAVIGVPDPDYGEAVRAYVV
FT                   AKNPELTEAELIAYCRERLAKYKVPSAIDFLDELPKNATGKILRRALKERLASSHA"
FT   CDS_pept        687340..688347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0669"
FT                   /locus_tag="GK0669"
FT                   /product="ABC transporter (substrate-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0669"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74954"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L276"
FT                   /protein_id="BAD74954.1"
FT                   /translation="MGQSIRRFAAVCAAGFLLLGGCGGAKETGSSQGSGGKSGKEKTYK
FT                   IGVTQIVEHPSLDAARKGFQQALKDKGLSVEYDVQIAQGDQSNNQTIANNFVSDGVDLI
FT                   FANSTPSAQAALNATKDIPIVFTSVTDPVGAQLVQSMEKPGGNVTGTTDTHPEAIPKTV
FT                   QFIDKYIKGNRVGMVYNAGEQNSVAQIEQVKKAMQGTDLQIVPASVSTSAEVKQATESL
FT                   VGKVDCLYIITDNTVVSALESVIQVANEHDIPLFVGELDSVKRGGFAAYGFDYYDIGYE
FT                   AGEMAAQILQDGKKPADLPVQYPQKLKLVINKKAAQEMGIKLNPEWDSIAEYIE"
FT   CDS_pept        688477..689469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0670"
FT                   /locus_tag="GK0670"
FT                   /product="ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0670"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74955"
FT                   /db_xref="GOA:Q5L275"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L275"
FT                   /protein_id="BAD74955.1"
FT                   /translation="MFSSVEAGLIYAVMALGVYLSFRILDFPDLTVDGSFVTGASVAAV
FT                   LIVNGANPFAASAAALLAGFAAGVLTGLLHTKGKINPLLSGILMMIALYSVNLRIMGKS
FT                   NVPLLQQETVITKITAAWRQAGLDAALNRLVSFTGFAPRTWAVLVSMAIVALMVKGLLD
FT                   WLLKTEVGIALRATGDNKPMVASFSANTDWLIVFGLGLSNALVALSGALVAQYGGFSDV
FT                   GMGIGMIVIGLASVIIGEALFGARSVARATWAVIGGAIVYRLILALALRVEFLETGDVK
FT                   LITALIVMLALVVPNTLAAQKERQRKKRRVRQLERGETVAGAETNYKSV"
FT   CDS_pept        689435..690232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0671"
FT                   /locus_tag="GK0671"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0671"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74956"
FT                   /db_xref="GOA:Q5L274"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L274"
FT                   /protein_id="BAD74956.1"
FT                   /translation="MLELKRITKVFNEGTADEKIALRGIDLTLAPGDFVTVIGSNGAGK
FT                   STLMNIISGRLSPDTGEVWINGCDVTALKEHARARYIGRVFQDPMAGTAPHMTIEENLA
FT                   LAYNRTKRRTLSLGVTKQKREWFRETLRTLHLGLEDRLAAKVGLLSGGERQALSLLMAT
FT                   FTKPDVLLLDEHTAALDPARAELVTELTKQIVEQHRLTTLMVTHNMEQAIRLGNRLIMM
FT                   DGGQIIFAAEGKEKEELTVERLLEAFQRIRGSQFASDRAVLSS"
FT   CDS_pept        complement(690289..691152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0672"
FT                   /locus_tag="GK0672"
FT                   /product="D-alanine aminotransferase"
FT                   /EC_number="2.6.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:GK0672"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74957"
FT                   /db_xref="GOA:Q5L273"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005784"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L273"
FT                   /protein_id="BAD74957.1"
FT                   /translation="MSVKPYVLTDRGIFRYEQVTYPMEERGLQFGDGVYEVVRLYNGIY
FT                   VWLREHLDRLYRSAAAIRLSVPFGCEELIEQLEELRRLNDVQEDAILYLQMTRGSFPRN
FT                   HAFPAENRPNLYAYIQPMARKTEEMTHGVRTILTKDVRWEYCYIKSLNLLPNVLAKQEA
FT                   VERGAFEAILHRDGVVTEGSSSNIFLVKNETVYTHPATARILNGIVRTKVKQFCAELGI
FT                   PFVEEAFSTNDLAEADELFLTSTTSAIIPIIQVDETVIRSGAPGAVTKALQAAYRQATQ
FT                   RETQNI"
FT   CDS_pept        691340..692056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0673"
FT                   /locus_tag="GK0673"
FT                   /product="branched-chain amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GK0673"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74958"
FT                   /db_xref="GOA:Q5L272"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L272"
FT                   /protein_id="BAD74958.1"
FT                   /translation="METTWAAGKMAPFRQGVQAGVAIAIGYMPIALAFGLLAKTTGLTF
FT                   AETVLMSIVVFAGASQYIALSLLTAGTGVFEIVLTTFILNIRHFLMSASLNEKAEPDTL
FT                   WKKALYAFGITDETFSVAAMKEGTINASYMFGLIAMAYGSWVVNSGIGYAAGAGLPESL
FT                   QESMSIALYAMFIGLLVPALKKQRKIVWLAGLSALFNSIGTFALHLSKGWSIVLATLLS
FT                   AIIVQWLTKEGGNGGE"
FT   CDS_pept        692049..692354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0674"
FT                   /locus_tag="GK0674"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0674"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74959"
FT                   /db_xref="GOA:Q5L271"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L271"
FT                   /protein_id="BAD74959.1"
FT                   /translation="MNSTIVWMIIGMGVVTYLPRLLPFVLLGGVELPSFWQGVLKNVPY
FT                   AVLGALIIPDVFFIQDDFWFGVIGFAAAVITAWLGANVMIVVLAAVAALSLYSLFV"
FT   CDS_pept        complement(692418..693008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0675"
FT                   /locus_tag="GK0675"
FT                   /product="manganese oxidation"
FT                   /db_xref="EnsemblGenomes-Gn:GK0675"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74960"
FT                   /db_xref="GOA:Q5L270"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L270"
FT                   /protein_id="BAD74960.1"
FT                   /translation="MKKWYTLAASLVIIGISVGILYFAVYQPSTMRLPNDVTMETAWGK
FT                   SYEFGDLPPKVRLVEFIYTNCPDVCPNTTAQMAKLRDRLKQAGVFGSKVEFITITIDPA
FT                   RDTNEKLQTYANAFGVMSDGQGWVFLRGSEADTKKVADAFHFQYRDPGNGMIVHTTLAY
FT                   LLGRNGRVVKQIGMGTSRFHVDEVYEAIMEELS"
FT   CDS_pept        693200..694486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0676"
FT                   /locus_tag="GK0676"
FT                   /product="isocitrate lyase"
FT                   /EC_number="4.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:GK0676"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74961"
FT                   /db_xref="GOA:Q5L269"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L269"
FT                   /protein_id="BAD74961.1"
FT                   /translation="MASFAERVRQLEESWKNEERWKGIVRPYSAEDVIKLRGSLDIEYT
FT                   LARRGAEKLWKLLHTEDYVAALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLAGQMY
FT                   PDQSLYPSNSVPHVVKRINQALQRADQIQYLEGSGDVDYFVPIVADAEAGFGGQLNVFE
FT                   LMKAMIEAGAAGVHFEDQLSSEKKCGHLGGKVLLPTQTAIRNLIAARLAADVMGVPTVL
FT                   IARTDANAADLITSDIDPRDQAFITGERTPEGFYRTRAGLDQAIARGLAYAPYADLIWC
FT                   ETSEPNLDEARRFAEAIHEKFPGKLLAYNCSPSFNWKKKLDDETIAKFQQELGKMGYKF
FT                   QFVTLAGFHALNYSMFELARGYKERGMAAYAELQQAEFAAEKYGYTATRHQREVGTGYF
FT                   DEVAQVISGGQSSTVALKGSTEEEQFTAI"
FT   CDS_pept        694616..694810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0677"
FT                   /locus_tag="GK0677"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0677"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74962"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L268"
FT                   /protein_id="BAD74962.1"
FT                   /translation="MEKNQGDLPELMPAEFRVSTDLHVEQWSMNEETYAGDSVGEHTAL
FT                   EQANEYLASKEIGQTFENS"
FT   CDS_pept        694907..695464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comK"
FT                   /locus_tag="GK0678"
FT                   /product="competence transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:GK0678"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74963"
FT                   /db_xref="GOA:Q5L267"
FT                   /db_xref="InterPro:IPR010461"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L267"
FT                   /protein_id="BAD74963.1"
FT                   /translation="MIKGGDERMKVNEFIVLEQFIVSRYTMAVLPYFLNSDVYAKVIEE
FT                   DGEYIIKQTPIDIIKHSCDYYGSSFQGRKEGTKAVIGITHKAPIAIEPSNEIYVFPTAS
FT                   PRDSRCVWLSHMHVYRYEPAKYERTIVYFRNGKSISLDVSCKSFINQLYRTAQLRTKLS
FT                   ERMEARERKLQYIFRMQQEKQS"
FT   CDS_pept        695670..696191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0679"
FT                   /locus_tag="GK0679"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0679"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74964"
FT                   /db_xref="GOA:Q5L266"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L266"
FT                   /protein_id="BAD74964.1"
FT                   /translation="MLESFFPILPMFVFVMANAAAFGLWKGFLISWLGASLGSLIVFWL
FT                   TRKVGQKRFFHFVRRHPKVRQFMHWIERHGFGPLFLLYCFPFTPSALVNIVAGLSRISR
FT                   QQFVLAVLLGKMIMVFTISFIGYDLKALIRQPLRTAMIAAVVLLLWYAGKRVEARFSLT
FT                   EEQGGEEGGE"
FT   CDS_pept        696188..696736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0680"
FT                   /locus_tag="GK0680"
FT                   /product="signal peptidase I (SPase I)"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:GK0680"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74965"
FT                   /db_xref="GOA:Q5L265"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L265"
FT                   /protein_id="BAD74965.1"
FT                   /translation="MTKQKEKRGRRWPWFVAVCVVATLRLFVFSNYVVEGKSMMPTLES
FT                   GNLLIVNKLSYDIGPIRRFDIIVFHANKKEDYVKRVIGLPGDRIAYKNDILYVNGKKVD
FT                   EPYLRPYKQKLLDGRLTGDFTLEEVTGKTRVPPGCIFVLGDNRLSSWDSRHFGFVKINQ
FT                   IVGKVDFRYWPFKQFAFQF"
FT   CDS_pept        696991..700494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0681"
FT                   /locus_tag="GK0681"
FT                   /product="ATP-dependent deoxyribonuclease subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:GK0681"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74966"
FT                   /db_xref="GOA:Q5L264"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014140"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L264"
FT                   /protein_id="BAD74966.1"
FT                   /translation="MSLRFLLGRSGSGKTAVCLEEIRRQLQEDPKGRAIVYLVPEQMTF
FT                   QCEYALIHTEGVGGMIRAQVFSFTRLAWRVLQETGGMTRYHIHDVGVQMMIRKIIEQRK
FT                   QELKLFGRAADKHGFIEQLNEMITECKRYCLTPGELRRHAKAFEDGPDQPGRRLLADKL
FT                   SDVALVYEELERSLIGHYLDSEDYLRLLAEHIPRSSYLRDADIYIDGFHHFAPQEYMII
FT                   EQLLRHCRRVTVCLTIDRPYDDGMPDELHLFYLPAQTYRQLRELALSNDIAIEEPIVLS
FT                   ANRRHEDRALVHLEAQFHRRPLLPYGAKTDAVHLYEASNRRAEIEAVAREIIRLVRDEG
FT                   ARYRDIALIIRQTEAYRDLVKTVFFDFGIPYFMDEKEPMHHHPLIELVRAALETVVTRW
FT                   RYEAVFRAVKTDLLFPTDGDLHMWREAADKLENYVLAYGIKGDKWTNNERWAYRRYQAL
FT                   DGLNVPQTDEERQFEDMLNEWREALAAPLRRLERRLRRAEDGRGFCMALYLFLEELQIP
FT                   KKLEKMSAQAEADGRLVEARQHEQAWNAVVDLLDQYVEMLGTESLPLAEFVKIIEAGLD
FT                   RLEFSLVPPAMDQVIVAQLDRSRLIDIKYAFVIGANDGVIPAKVKEDGLMAEVEREQLR
FT                   ELGVALAPGGREQLFYDPFFVYLALVCPSRRLYVTYPLADGEGKALMPSPLIKQLTELF
FT                   PHAPVHLCGNDPFDAPAEKAEAFVTAPRATQTYLISQLRAWKRNYGIDPLWWDVYNTFI
FT                   GHRDWKEQVRHAVSALFYTNGATPLKKQWSQRLYGKKIQASVSRMEQFQKCPYAHFASH
FT                   GLRLKERNVFRLEAPDVGQLFHAAIKQIADRLREQHLDWRELSRPDCERLSAEAVERIA
FT                   PLIQQQVLSSSHRYEYMKRKLKHVVARTTHVLSEHARASGFVPIGLELSFGPNGDLPPL
FT                   RFRLPDGTVMELVGRIDRVDKAESSQGVLLRIIDYKSSAKTLDLTEVYYGLALQMLTYL
FT                   DIVLTYAEQLVGQPALPAGVLYFHIHNPIVQAKQWVDDEVEMAKKLLEPFRMRGLLLAD
FT                   VEAIRLMDGRTEDGQWSLIVPAQLTKSGSIHSRSSVASPSDFAALRQHVRRLFIDIGGQ
FT                   IADGVVSIAPYKLKDKTACEFCVFKPVCQFDEALSGNEYRKLAPQTKEAVIEKLAEGKE
FT                   G"
FT   CDS_pept        700495..704223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0682"
FT                   /locus_tag="GK0682"
FT                   /product="ATP-dependent deoxyribonuclease subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:GK0682"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74967"
FT                   /db_xref="GOA:Q5L263"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L263"
FT                   /protein_id="BAD74967.1"
FT                   /translation="MNATIRPKPAGSRWTDEQWKAIAAGGRDILVAAAAGSGKTAVLVE
FT                   RIIQKVTAEEGAVDIDRLLVVTFTNAAAAEMKARIGEALERELAKRPHSLHLRRQLSLL
FT                   PRAAISTLHSFCLDVIRKYYYLLDLDPSFRIADETEIELLKEDVLEELLEEEYGKPDNE
FT                   RFFAVVDAYTGDRSDAELQEMIVALYEFSRSHPEPDEWLAGLTSMYDVDERTDIKTLPA
FT                   ARYIAQHAAMELAAARRLIRRALELAEEPGGPRPYAERLREDRDMITDLETRLSGPWAE
FT                   LHRALKALSFGRLPACRGKDYDERLIDEAKSLRDQAKKKVEALRDNVFSLDPSVWLRHM
FT                   REMKPIVETIANLVRRFAVMFQAAKREKGIVDFSDLEHYCLHILRRRDPETGEWQPSPA
FT                   ALEYQAQFDEVLVDEYQDTNLVQEAILQLVKKGSERTGNLFMVGDVKQSIYRFRLAEPM
FT                   LFLDKYKRFTADGEEGGMKIDLASNFRSRREVLDGTNFLFAQLMGETVGEMVYDEAAQL
FT                   KYGADYPEGEDAAPEVMIINRQRAAEEDEEEAAEWEAAELEARLMAKKIKEIVSAPFYV
FT                   YDRSSGQPRRAMYRDIVILVRSMTNAPQMIEQLQAQGIPAAADLSSGYFQATEISIMLS
FT                   LLKVIDNPHQDIPLAAVLRSPLFRFDENELAMIRLADPKGTFYEALCSFRQKPAETKEE
FT                   ANAQRKAAAFLERLEGWRTMARRRSLADLIWQLYRDTQFYDFVGALPGGRQRQANLRAL
FT                   YDRARQYESTSFRGLFRFLRFIERLQERGDDLGAARPLGEQEDVVRIMTIHSSKGLEFP
FT                   IVFLAGLARPFHTRDLHHPYLLDKELGFAARFVHPRLRISYPTLPLLAIQTKKRLELLA
FT                   EEMRILYVALTRAKEKLYLLASVNDAAKEIEKWKSAASERGWLLPDDVRASARSYLDWI
FT                   GRALIRHRDGGALAGTKAPEEVASHPSVWRVAIVPAADLRGAEAAREEMDGGVLLALEQ
FT                   GRPVPVEGGWQKEVKRRLLWRYSYEKETAVRAKQSVSELKEQRALFGEQADEWRPRQGT
FT                   APVFSRPRFMQEKTLTPAEKGTALHVVMRHLDLQAPLDESWIRSQIVRLVEKELLSAEQ
FT                   AEAVDPAAIAAFFTADLGRRLCAAREVHREVPFSLGLKAAELYGGEGTESGRRVLVQGV
FT                   IDCVFADECGYVMIDYKTDEVVHRFAGQKEEAARFLLGRYGTQMRLYRRAIEQIWRAPV
FT                   AECYLYSFDGGFVVAVE"
FT   CDS_pept        704244..705422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0683"
FT                   /locus_tag="GK0683"
FT                   /product="DNA repair exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:GK0683"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74968"
FT                   /db_xref="GOA:Q5L262"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L262"
FT                   /protein_id="BAD74968.1"
FT                   /translation="MRILHTADWHFGRTLEGRSRMAEQEAFVDELVEIVKKEQIDIILV
FT                   AGDVFDSVNPPAAAEQLFYESLARLSDKGRRPVAVISGNHDHPDRISAARTLMCAHNIF
FT                   LFGRPQAAVCRIDVPSCGETMMLAPLAYPSESRLAELLSSDCKETTMRDRYDDRIRALL
FT                   AAMAASFTAETVNIAMSHLYVAGGRTSDSERPIEVGGAYTVAAESLPKAAQYVALGHLH
FT                   RPQDVKQAKTAARYSGSPLAYSFSEAGQAKSVTVVDVHPGGAAKVAEIPLVAGKPLIRW
FT                   KATEGLAQVYRWCEEGRDRSSWIDLEIHVTESLTMEEIDRLRKLHPGFVHIRPVLPNRV
FT                   EEMMEMSREPLSLEEMFHRFYERQTGGQTPDEELVRLFLELAAEEEKEGEGE"
FT   CDS_pept        705419..708763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0684"
FT                   /locus_tag="GK0684"
FT                   /product="DNA exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:GK0684"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74969"
FT                   /db_xref="GOA:Q5L261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L261"
FT                   /protein_id="BAD74969.1"
FT                   /translation="MKPISLTIAGLHSFREKQTIDFTALCEGGVFGIFGPTGSGKSTIL
FT                   DAMTLALFGSVERAANRTQAIINHAEQELFVSFTFELENAAGAKRYTVERSLKKVDEWR
FT                   TRSAVCRLIEHRSEPVVLADKLSEVDKAIEQLLGLTMEDFTRAVVLPQGKFAEFLSLKG
FT                   SERRQMLQRLFHLERYGDQLNKKLKDRLAAARQEWEKIEAEKAGLGDASKAALEQAEAD
FT                   VRELAGLFAKRKKELEEVEADVERTKQRWAWQQEKEAVEQELAALRQHESAIRELEAKK
FT                   ERAEQAERIWPYWEQCEQACRLRAEAFRRYEGLARRLEEAQLSYEEAARRYERARQEKA
FT                   QREPELLVQMERLRQAAQLEQQMEVLGQELAALREERKRLIAQEKAAARRFEEASVWYE
FT                   RGAKRQRELKEELKQHEEALDGKDEAERAYRQKQHIEQAASAIARVDAQLQQKEAVWRR
FT                   AKEEKLERERRSAAVGSRLQELFRRVERTYRFVCWRQQDAEKQLYTLQKTMEAERQRAE
FT                   EARTAQLASALAERLRPGEPCPVCGSREHPHPAAAPHDVQLERLSELEAERQRYEQDWQ
FT                   MIISFKAQLEQLAELAAGHEAPPVFAESRSVEEVVDLTVEVRALAQDVIELKEAAYRVL
FT                   AQWNEAESARREAEKACQWIAADIEALQVEKQRLEEERRQLEQQWRQMYPFHSLETIDA
FT                   VYEQLCELENVRRDVQKRLEDSVLFLEEKQRAKEEAAKERSRLETERVRLDSLISAKQQ
FT                   QWNEYERQRGEKAGEGPAAVQLQKAEDEWRQLQNGEQQAYEAWQRAQREYQMLESETKA
FT                   AKQAWEEGVRREEEALARWRGALLDTMFADAEQVKQAKAEKAQRDEWDEAIRRYWRQIE
FT                   QAEHRLAQLAAAIGGAAVSAEQWETMQRVYAELKGQVEAMTQQLGAAQAKVEELRKKHS
FT                   RFVELEEKQAELSRRIERYKQLQALLRGNSFVEFMAEEQLEQVTAMASERLQRLTRHRY
FT                   SLELDSQGGFLIRDDANGGVRRPVSTLSGGETFLTSLSLALALSAQIQLRGEYPLRFFF
FT                   LDEGFGTLDAELLETVISALEKLHTERLAVGVISHVQEIRHRLPRRLIVEPAEPSGRGT
FT                   RVWLEMM"
FT   CDS_pept        complement(708996..709217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0685"
FT                   /locus_tag="GK0685"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0685"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74970"
FT                   /db_xref="InterPro:IPR019618"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L260"
FT                   /protein_id="BAD74970.1"
FT                   /translation="MPSFVGPIKINNVSSGAVVQMGDCLYIAPKVATKTQAGSGGFNTG
FT                   DFVMTNNAISFTNAFDPDVSDQNVAANN"
FT   CDS_pept        complement(709217..709615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerPE"
FT                   /locus_tag="GK0686"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0686"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74971"
FT                   /db_xref="InterPro:IPR024496"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L259"
FT                   /protein_id="BAD74971.1"
FT                   /translation="MKRTSVVQTFHAETLIISSVLQIGDSERISARTRAFAVQRQYELF
FT                   FGPEGEQIFPVFAKPIPRWTSPPPVAARQTLHESPVISVQSVRVLAISSSAIVHIGSTS
FT                   TAEAEARIKHIRQLAGSESSAPTRGRDL"
FT   CDS_pept        complement(709612..709791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerPD"
FT                   /locus_tag="GK0687"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0687"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74972"
FT                   /db_xref="InterPro:IPR017257"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L258"
FT                   /protein_id="BAD74972.1"
FT                   /translation="MINRHLHVGDIRLVAVASASLFLIGDADAIHLSSAFDTPPESLII
FT                   GPFVPLVPARGDTP"
FT   CDS_pept        complement(709806..710402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerPC"
FT                   /locus_tag="GK0688"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0688"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74973"
FT                   /db_xref="InterPro:IPR019673"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L257"
FT                   /protein_id="BAD74973.1"
FT                   /translation="MSIYEYFVKLHRYLLWQTKKIRALERRLHALEARLREMEAQPRTS
FT                   IERIEYKFDQLKVETLEGTLNIGIAPSGAGGTIEDFAVEPVKTVIPKPEPVLMRPIQEK
FT                   VAAYLNGEASETLKRLEQQYGRRLDDTYRQFILQDIARQTDERIRFYLQEKANHGYVPS
FT                   GDRDEAVENEIFQKVKADIEQSLDAFLKHLPSKEG"
FT   CDS_pept        complement(710486..710698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerPB"
FT                   /locus_tag="GK0689"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0689"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74974"
FT                   /db_xref="InterPro:IPR024255"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L256"
FT                   /protein_id="BAD74974.1"
FT                   /translation="MHVYISQSICIHQLRIGSVTNSSVLQIGSAGSIQALSTLANTGGF
FT                   TGSAPQATVPPGASAPLVPLHSATR"
FT   CDS_pept        complement(710714..710935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerPA"
FT                   /locus_tag="GK0690"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0690"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74975"
FT                   /db_xref="InterPro:IPR019618"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L255"
FT                   /protein_id="BAD74975.1"
FT                   /translation="MPAFVGVVKLNSIGSSGVFHIGDVFAISPQSVTKTFAGAGSFNTG
FT                   DGLHIYNYYSNTNTNDADVADENVVGNV"
FT   CDS_pept        complement(711006..711230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0691"
FT                   /locus_tag="GK0691"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0691"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74976"
FT                   /db_xref="InterPro:IPR019618"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L254"
FT                   /protein_id="BAD74976.1"
FT                   /translation="MPSFISGPIKITHVSGDGTVNFGDVLQITPKSTLKSNTGSGGGNN
FT                   GDFLQTNTFVSFTNTGDPDVFDSNNAANN"
FT   CDS_pept        711381..711605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0692"
FT                   /locus_tag="GK0692"
FT                   /product="spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0692"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74977"
FT                   /db_xref="InterPro:IPR019618"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L253"
FT                   /protein_id="BAD74977.1"
FT                   /translation="MPAIVIGGIKVTNVSGNGTVNMGDVLQIAPKSTTKSNSGAGGGNT
FT                   GDFLQTNTFCSVTNTVDPDVLDAGVKGNN"
FT   CDS_pept        711817..713412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0693"
FT                   /locus_tag="GK0693"
FT                   /product="AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:GK0693"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74978"
FT                   /db_xref="GOA:Q5L252"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L252"
FT                   /protein_id="BAD74978.1"
FT                   /translation="MNAPLVLHHFFDRAVALYGDKTAMICSGRTVTYRELGERVSRLAN
FT                   GLRGLGVRKGDRVAYLAPNTLEMLEGFYGVFEVGGVMVPLNTRLKPDDYVFILNHSETK
FT                   VLFVDQELYGLIAPVKNKLETVEEIIVHHKTEAAIDETAYEEWLAAQSSAPVPRPMIDE
FT                   NDICSLLYTSGTTGNPKGVMLTHRNNYLHALVTMHHLRVSDRDTYLHVLPMFHVNGWGA
FT                   PFYYTANGATQIGLRKVDPKVIFDLVKEHQVTVMHMAPTVLNMLLQYYEQYQPDVPEGV
FT                   RVVIAGSAPPPAFVARVEEKLGWEFIQVYGMTESSPLSTISLIRPQLDGLPVEQKQRLK
FT                   AKAGYPMIGCEVKVVDENGEEVPKNGRAIGEVIVRSHGVMKGYWKNEEATAATIRDGWL
FT                   YTGDMATVDEYGHIDIVDRKKDIIISGGENISSIEVEGALYEHPAVLEAAVIAVPHEKW
FT                   GETPHAFVVVRPGHTVSEEELIAFSREKLAHFKAITGVTFVDELPKTASGKIQKVHLRR
FT                   QYWDAIGKSGRYVN"
FT   CDS_pept        713550..714716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0694"
FT                   /locus_tag="GK0694"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0694"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74979"
FT                   /db_xref="GOA:Q5L251"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L251"
FT                   /protein_id="BAD74979.1"
FT                   /translation="MIRSTERIAAADVLRGFALLGILLVNMRYFSSPALYDDGVKGSDF
FT                   DRVFVAVVDVLFEASAYPLFAFLFGFGAVMMFRRLQSRGERPIPILLRRFFLLLGIGMA
FT                   HAFGLWFGDILIPYALAGFIMLFFFAAPPHWWRTAAVAVFFLFHGLMALLLTLNVLAGE
FT                   METAGGHETAAAAAVRHYRNGTFRDVFWQRWNDWMYINGDGGLLLTVLTVLPFCLLGGY
FT                   AADQRWLEADRHSPAKLRRLMRWALCFGLALKTIPYWAAANDLTMYIQDSFGGAALAVF
FT                   YAAAAVFICGKPSWQRAWRWWQDVGKMSLTHYLAQSLVCTSLFYGYGLGWYGRTSAWQE
FT                   MLIAFALYATQVWISRFWFARFHYGPVEWMWRWGTYGTRPPFRRRPGQ"
FT   CDS_pept        complement(714727..714897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0695"
FT                   /locus_tag="GK0695"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0695"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74980"
FT                   /db_xref="GOA:Q5L250"
FT                   /db_xref="InterPro:IPR018540"
FT                   /db_xref="InterPro:IPR037208"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L250"
FT                   /protein_id="BAD74980.1"
FT                   /translation="MVLLQIEEKRQQMIELALTYGFTAKETIECSQELDQLINQYLQQT
FT                   RIFESPSPSVQ"
FT   CDS_pept        715211..716113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0696"
FT                   /locus_tag="GK0696"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0696"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74981"
FT                   /db_xref="GOA:Q5L249"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L249"
FT                   /protein_id="BAD74981.1"
FT                   /translation="MKLITALFDGETFVGAVPQGDDRAVHLRRAERTMDGTETMPTTML
FT                   EAIAQGEAFFTRAQEVVDWALRHPAPEYVYRLSDVRLLAPIPRPAKNIFCIGKNYVDHA
FT                   LELGGADVPEHLIVFTKAPTTVIGHEETILRHADVTDEMDYEGELAVVIGKQGRAIRRE
FT                   DALDYVFGYTIINDVTARDLQERHQQYFLGKSLDTFCPMGPWIVPSKFVPNPNDLRIET
FT                   RVNGEVRQQANTKQLIFSIESIIETISKGITLEPGDIIATGTPAGVGKGMNPPRFLQTG
FT                   DVIEVTVEGIGMLRNKVGE"
FT   CDS_pept        716258..716611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0697"
FT                   /locus_tag="GK0697"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0697"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74982"
FT                   /db_xref="GOA:Q5L248"
FT                   /db_xref="InterPro:IPR010899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L248"
FT                   /protein_id="BAD74982.1"
FT                   /translation="MTHAHITSWLITIVLFFLAVSMERQGAGKAKIVQMVLRLFYILTI
FT                   VTGLLLLHSIASISALYWLKALAGLWVIGAMEMVLAAEKKGKSAAARWTQWVIALAVTL
FT                   FLGLLLPLGFDLF"
FT   CDS_pept        716736..719579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0698"
FT                   /locus_tag="GK0698"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0698"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74983"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L247"
FT                   /protein_id="BAD74983.1"
FT                   /translation="MRWFCCRRAEELDHLLREHSSSLDEPLFVQIAGNDEAAVRHAAAA
FT                   LARRWPHAHMVGMAGPLPMAGEANLAVGVASMTSSTVSSLALPADEFDRPDGLAALIAE
FT                   AVVRHDTTLLLLFTNHRSALPPLLRHLPLANERMVIIGCALPEGSVLFSPDGRLERGGI
FT                   AVSFSGTALRGHCAAPFLWEPIGLAFSITKSRDQQIDELNGQKASSYLERYLGKEFIER
FT                   LPFSGMEFPFLIERNGRDVCLPIVAVNQDGSVAVRGHVHNGEKVRFAYIHAASLYWSAR
FT                   DVAMQTAKQPAEGMLLYYSAALSGYTRPLFDGVAAVFGQAALFPAVEVLVKDAYTAVRP
FT                   AAFAAISLAETAASAESGLLSPWSSPPEGMMTLAQLMSTSSRDMERLHVRLQMSEQRYK
FT                   SLFEHNTDIVYSTDLHGRLTSVNPAFEQVLGYKKEEILYTNSLKYIHPNDIPRVTRYFY
FT                   RALRGNIQTYNLEIPTKSGERLLFQMKNIPIIVDGKKVGIYGIGRNITEQKKAEEKISY
FT                   LAYYDIDTNLPNRTKWMELFSEQLDKAKQKRRKMAVALIDLDRFKWINDSVGHYAGDDI
FT                   LRQLVERIRRVLPPSAELGRFHGDKFCLLFPLKTEVQAATEAALRIVREVARPIVYDGK
FT                   EFFVTASVGLAMFPDDGEDEHALLRHADMAVNMAKKGGGNRVERYCAQMNEEAMHRLEM
FT                   GGHLRRAIEENELFLCYQPIVDVHTGAVKATEALIRWRHPKLGLVRPDEFIPLAEETGL
FT                   IHEIGRWVLKTACRQTKQWQEITGNNRLSIFVNVSPVQFQHERFVDNVKQALKQSRLSP
FT                   SCLHLELTEHSMLRYLSSTMRTMDELRKLGVGIAVDDFGSGYSSFHYLKRLPATILKID
FT                   RAFIEQLHANASDEAIVKAMITMGHGLGLETIAEGVETPEQLNRLRDLQCTYAQGYVFC
FT                   PPLLAEEVMQYVTEKQK"
FT   CDS_pept        complement(719733..720281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0699"
FT                   /locus_tag="GK0699"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0699"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74984"
FT                   /db_xref="InterPro:IPR024488"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L246"
FT                   /protein_id="BAD74984.1"
FT                   /translation="MNIEERLQCIVEQPRAYVYGTVEFVNDEWIFFDEEEEEASLVEEI
FT                   AEQGIEWFHCGHWLSGQWQDQGAVATDLGVFPLENGDRIRFRKRLTYAYQQWLAALPDS
FT                   TFFQFVQWLNSLGFSLYDCLYCYNGLLFAKSSGVNFIIYDNTEQIGSIHHYYERGRASS
FT                   DRFEITLNSGERAICAQIG"
FT   CDS_pept        720525..722372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0700"
FT                   /locus_tag="GK0700"
FT                   /product="asparagine synthetase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /db_xref="EnsemblGenomes-Gn:GK0700"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74985"
FT                   /db_xref="GOA:Q5L245"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L245"
FT                   /protein_id="BAD74985.1"
FT                   /translation="MCGITGWVHFGRNLRRERTVIDSMTETLAKRGPDDTNTWLDTHVA
FT                   FGHKRLVVVDPAGGKQPMVRQKNGHRYTIVYNGELYNTEDIRKELLRQGYRFDGHSDTE
FT                   VLLAAYMEWKEKCVDWLNGIFAFAVWDGERELLFMARDRLGVKPLFYREDGGGLLFGSE
FT                   VKAILAHPDVKAEVNYEGLAEVFGLGPSRTPGHGVFDGIRELRPAHALTFSRSGLRIWR
FT                   YWNVESDVHRDSFEETVEKLRFLLTDAVTRQLVSDVPVCTFLSGGVDSSAITGIAANAF
FT                   AADGKGPLHTYSIDYEGNDQYFKANDFQPNTDAPFIEQVSNKFQTVHHRCVITQEELFR
FT                   HLHEAVIVRDVPGMADVDSSLLWFCKQIRERFVVSLSGECADEIFGGYPWFHRPDDLSR
FT                   KGFPWMRSVDARMGLLKDEWRQKLRLDDYVQMRYEQTLAEVPRLEGESAEEAKRRELFY
FT                   LNMIWFMTTLLDRKDRMSMGASLEVRVPFADHRIVEYVWNIPWDMKMYGGREKGLLRKA
FT                   LEGLLPEEVLYRKKSPYPKTHHPLYTKLVKQWLEQLLHDRSSVLHEFFDREKLLALIET
FT                   EGKSFQVPWFGQLMTGPQLLAYLGQVHVWFDHYGIRIKE"
FT   CDS_pept        complement(722413..723765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0701"
FT                   /locus_tag="GK0701"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:GK0701"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74986"
FT                   /db_xref="GOA:Q5L244"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L244"
FT                   /protein_id="BAD74986.1"
FT                   /translation="MRQEAKTWSLFSLTWPIFIETLLYMVMGNADTLMLSQYSDHAVAA
FT                   VGVANQIIALTIVLFNFVALATAVLVAQYLGARREQEAVDVSLVSLVANLLFGLLLSAI
FT                   LAAFSEPILRMMDLPAELLDEGTHYLAIVGGFLFIQALMMTVGAILKSYGFTRDTMYVA
FT                   VGMNVLHVISNAALIFGLFGLPALGIQGAAISTAASRGMAFLALLALLHKRTNIPLAPR
FT                   AFRRLPFHYLRSLLKIGVPAAGEHLSYNTAQMVITYFITWLGAEALTVRVYTQNIMMFV
FT                   FLFGIAVSQGTQILVGHFVGAGRYEEAYARCLKSLYSAIAISVLLAAAAYWFAEPLLSL
FT                   FTDDRSMIVLGRKLLLLTIILEPGRSFNLVIISSLRAAGDVQFPVYMGILSMWGVGVTI
FT                   AYVFGITLGFGLVGIWLSFIADEWLRGLLMLWRWRSGVWMKKTMVPQAKMA"
FT   CDS_pept        723890..724750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0702"
FT                   /locus_tag="GK0702"
FT                   /product="transcriptional regulator (AraC/XylS family)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0702"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74987"
FT                   /db_xref="GOA:Q5L243"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L243"
FT                   /protein_id="BAD74987.1"
FT                   /translation="MHYVTFSLPPLPVFIKGAESVFPKGKRHFRRTFTVFDLLYVKQGC
FT                   LYMTENGREFAIGSGQYLLLIPGREHYGHRPCEEKTELVWLHFLLPDYTVAPDCPASRQ
FT                   TVMEKEATYTEPIQYRLSIRQYGELKQRERAEQLLAQLVEPNVERDMDRPLRQLLLFVE
FT                   FLWHLQKQELSVPSAAEQVSAAAVAYIERHFNEPITLEMLAKGLRFHPDYITRCMQKTM
FT                   GMGFSRYLTYYRLSKAKQWLAETNETVEAVAKRVGIDDGAYFSRVFKKMEGMTPTEYRR
FT                   MARRT"
FT   CDS_pept        complement(724811..726577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0703"
FT                   /locus_tag="GK0703"
FT                   /product="alpha-cyclodextrinase"
FT                   /db_xref="EnsemblGenomes-Gn:GK0703"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74988"
FT                   /db_xref="GOA:Q5L242"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L242"
FT                   /protein_id="BAD74988.1"
FT                   /translation="MRKEAIHHRSTDHFAYAYDSETLHLRLQTKKHDVDHVELLFGDPY
FT                   EWHDGAWQFQTMPMRKTGSDGLFDYWLAEVKPPYRRLRYGFVLRAGGEKLVYTEKGFYH
FT                   EAPSDDTAYYFCFPFLHRVDLFQAPGWVKDTVWYQIFPERFANGNPAISPKGARPWGSE
FT                   DPTPTSFFGGDLQGIIDHLDYLADLGITGIYLTPIFRAPSNHKYDTADYFEIDPHFGDK
FT                   ETLKTLVKRCHEKGIRVMLDAVFNHCGYEFGPFQDVLKNGAASRYKDWFHIREFPLQTE
FT                   PRPNYDTFAFVPQMPKLNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANEIDHQFWRE
FT                   FRQAVKALKPDVYILGEIWHDAMPWLRGDQFDAVMNYPLADAALRFFAKEEISARQFAD
FT                   IMIRLLHSYPKQVNEAAFNLLGSHDTPRLLTVCGGDVRKVKLLFLFQLTFTGSPCIYYG
FT                   DEIGMTGGNDPECRKCMVWDPEHQNRELLAHVKRLIALRKQHRALRRGDVSFLSADDNP
FT                   NHLVYEKIDGAETVLVIINRSNDAADIPLPLDLRGKWLVDLLTGERFAAEAETLCASLP
FT                   PYGFVLYKVESW"
FT   CDS_pept        726823..728097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0704"
FT                   /locus_tag="GK0704"
FT                   /product="maltose/maltodextrin transport system
FT                   (subsrate-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0704"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74989"
FT                   /db_xref="GOA:Q5L241"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L241"
FT                   /protein_id="BAD74989.1"
FT                   /translation="MRKALSFFLMAVLLIGVLGACGPKRDVQQPKGNDQKTAEQDKKPE
FT                   KLVVWVNDDEKQKQALKDIFQKYTEKTGIKIEMVGVNMLDQTKKLALDGPAGKGPDVFY
FT                   QPHDRIGDIVLQGLADPVDLGDAKGEYSPTAINAVTYDGKTYGVPMVVETYGVFYNKNL
FT                   VSEAPKTMEDLMKIAKEKTNAAKDQYGFLMEAANFYFVYPFFAGYGGYVFKNENGKYDI
FT                   SDIGLANDGAVKGAELVQSWFKNGYIPKEINGDIMNGLFTKGNVAVAITGPWNIAQYKE
FT                   ALGDKLATAPLPVLDNGEHPKSFVGVKTWMLSAYSQNKEWAVDFMKFVTNEENSLHYYE
FT                   VAGEMPANEKALTNEKITNDPLIAGFAEQIQYGEPMPNVPEMSQVWEPMGNALQFIAKG
FT                   ENPKAVLSEAVKTIQDKIAASGAGK"
FT   CDS_pept        728167..729447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0705"
FT                   /locus_tag="GK0705"
FT                   /product="maltose/maltodextrin transport system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0705"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74990"
FT                   /db_xref="GOA:Q5L240"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L240"
FT                   /protein_id="BAD74990.1"
FT                   /translation="MPEANVRHRPAVAMALSLLFAGLGQLYNRRYVKGILFIIIEASFL
FT                   LTFYNFLNIGLWGLVTLGEIPMLDHSIFLLIQGLVSVIIIAFAAALHIANIIDARNDAR
FT                   RRQRGEPFPSLWESCRNAWDKGFPYIFVTPGLVMLLFIVVLPLLFMVSLAFTDYNLYHS
FT                   PPRHLLNWVGFENFKNLVSIPIWKSTFFSVLAWTIVWTVVATTMQIALGLFLALLVNDP
FT                   RIKFKRFIRTVLILPWAVPSFVTILVFAAMFNDKFGAINREVLSLFGVSVPWMTDPFWT
FT                   KVALILIQTWLGFPFVFALFTGVLQSISRDWYEAADIDGATRWQKFKSITLPHVLYATA
FT                   PLLIMQYAGNFNNFNIIYLFNHGGPAVRGQNAGGTDILISWVYDLTFTTNNYNMAAAIS
FT                   LIIGLIVSGFAIYQFRRTRSFKEEGNI"
FT   CDS_pept        729447..730289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0706"
FT                   /locus_tag="GK0706"
FT                   /product="maltose/maltodextrin transport system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0706"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74991"
FT                   /db_xref="GOA:Q5L239"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L239"
FT                   /protein_id="BAD74991.1"
FT                   /translation="MNRKWKSRVEVALIYLFIAFMFIVIAYPLLWTISMSLNPGTSLYS
FT                   ASLIPEKWSFEHYKWLFTSPNSDYLLWYKNSLFVATVNAVLSVLFTALIAYAFSRYQFV
FT                   GRKTGLYLFLVLQMFPSLMAMVAIYILLNMLNLLDSLWGLILIYVGGQIPFNAWLVKGY
FT                   FDTIPRELDEAARIDGAGHFGVFFRIMLPLAKPILAVVALFNFMAPFTDFLLPSIVLRD
FT                   PDKFTLAVGLFNFISDRFANNFTRFAAGSILIAAPIAVVFLFLQRYLISGLTAGGTKG"
FT   CDS_pept        730355..731896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0707"
FT                   /locus_tag="GK0707"
FT                   /product="alpha-amylase"
FT                   /EC_number="3.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:GK0707"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74992"
FT                   /db_xref="GOA:Q5L238"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013777"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L238"
FT                   /protein_id="BAD74992.1"
FT                   /translation="MEMGNRLFMLLVLPFLLFYAWPVQAAEKEERTWQDEAIYFIMVDR
FT                   FNNMDPTNDQNVNVNDPKGYFGGDLKGVTAKLDYIKEMGFTAIWLTPIFKNMPGGYHGY
FT                   WIEDFYQVDPHFGTLGDLKTLVKEAHKRDMKVILDFVANHVGYNHPWLHDPTKKDWFHP
FT                   KKEIFDWNDQTQLENGWVYGLPDLAQENPEVKTYLIDAAKWWIKETDIDGYRLDTVRHV
FT                   PKSFWQEFAKEVKSVKQDFFLLGEVWSDDPRYIAEYGQYGIDGFVDYPLYGAVKQSLAR
FT                   RDASLRPLYDVWEYNKTFYDRPYLLGTFLDNHDTVRFTKLSIDNRNNPISRIKLAMTYL
FT                   FTAPGIPIMYYGTEIAMNGGEDPDNRRLMDFRADPEIIDYLKKIGPLRQQLPSLRRGDF
FT                   TLLYEKDGMAVWKRQYEDETTVIAINNTGETQHVHLTNDQLPKNKELRGFLLDDLVRGD
FT                   GDGYDLVLDRETAEVYKLREKTGINVPFIAAIVSVYVLFLLFLYLVKKRAKRMPE"
FT   CDS_pept        731915..732934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0708"
FT                   /locus_tag="GK0708"
FT                   /product="transcriptional regulator involved in carbon
FT                   catabolite control"
FT                   /db_xref="EnsemblGenomes-Gn:GK0708"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74993"
FT                   /db_xref="GOA:Q5L237"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L237"
FT                   /protein_id="BAD74993.1"
FT                   /translation="MTVTIKDVAKRANVAPSTVSRVIADSPRISEKTKQRVREAMKELG
FT                   YHPNFIARSLASQMTQVIGIVMPSSADQALQNPFFPEVIRGISKAAHEKRYALQMSTGE
FT                   KESDIYERVVEMLQGRRVDGVILLYSRQNDKLMKYLLKHGFPFVVIGKPHQKAEQVTHV
FT                   DNDNVQAGKDAANWLIARGHERIAFVGGNPQYLVTVDRQTGYAAALQEAGLPYRPEYVV
FT                   HAEFLQEGGQEAMKELLSLPEPPTGLVVADDLMALGILKTLDEMGLGVPEDVSIVSFNN
FT                   TLLAEMSRPPLTSVDIGIFQLGYEAAKSLIEKITNPNEPIKRIIIPHRLVERGSCARR"
FT   CDS_pept        733058..734989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0709"
FT                   /locus_tag="GK0709"
FT                   /product="acetoin operon expression regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0709"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74994"
FT                   /db_xref="GOA:Q5L236"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L236"
FT                   /protein_id="BAD74994.1"
FT                   /translation="MIVTREQVKSMWEKFVFHNELDPDLPPMIRDSWLRSKKAMVDPFR
FT                   PYGWIKEIDNEKYRSLIDWSLPLMEGLYSIVKGSGFLVILCNENGQLLLSIGDCEPLAR
FT                   AEEIGFIAGADWSEQVMGTNAIGTSIVIDRPIQVFAEEHYTKICQSWTCSAAPIHDPDG
FT                   RIIGVLNMSGPYEKVHSHTLGMVVSAVKAIEYQLKLHENAEKNVMMQRFLEATTNNMKE
FT                   GILIIDRDGKIVKANNQLKKLFHIPQLQLEEKKLDDLFNDPSICSNHPLHLQNQELHLS
FT                   VKPSNAVHHVLVDKIPIYEKKERIGSMIIVKEIEKVRQFVNHLSGNQAKITFADMIGQH
FT                   PCFIEKMNEARLAAATDSNVLILGESGTGKEMVAQAIHNESKRRNKPFIAINCGGIPRD
FT                   LLGSELFGYVDGAFTGAKKGGSAGKFELANGGTLFLDEIGEMSLEMQVLLLRVIQEKEV
FT                   MRIGGHKVIPVDVRIIAATNKDLRREVQKGSFREDLFFRLNVMPIVLPPLRERKEDIPL
FT                   LVRHFIERLAHKRDKPFPEIRSDFLEALMQYDWPGNIRELQNMIERVLNQCTKPVLTAA
FT                   DLPEEIFRPLRLPQVRENVDISRNEIKKQSIIEALKQCNGNISKAARYLGISRSTFYRQ
FT                   MDKWNIRY"
FT   CDS_pept        735190..736176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0710"
FT                   /locus_tag="GK0710"
FT                   /product="thiamine pyrophosphate-dependent dehydrogenases,
FT                   E1 component alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GK0710"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74995"
FT                   /db_xref="GOA:Q5L235"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L235"
FT                   /protein_id="BAD74995.1"
FT                   /translation="MAISKDHLLWMYETMYKIRCYEDKMAEAYAEGKSPVFNIGAGPVP
FT                   GEMHLATGQEPAAAGMCVHLKKEDTVTAPHRPHHHAIAKGVDLNRMTAEIFGKATGLGK
FT                   GKGGHMHLFDPDVKFSCGGIVGAGIPHALGAALAAKKRGTDWVAVAFIGEGAANQGAFH
FT                   ESLNMAALWKLPFIVVIENNQYGISVPKTASTAVPSNDVRAAAYGIKGYYVKDNDPIDM
FT                   YNVSKEAVERARTGQGPSIIEIETYRYLGHFQGDPEVYRDKNEVTLLRQKDPIIRLRNY
FT                   LLNECGVTEETIAQLENKATFEVDQAYAFARESDYPKPEEALEDVFV"
FT   CDS_pept        736204..737223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0711"
FT                   /locus_tag="GK0711"
FT                   /product="thiamine pyrophosphate-dependent dehydrogenases,
FT                   E1 component beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GK0711"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74996"
FT                   /db_xref="GOA:Q5L234"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L234"
FT                   /protein_id="BAD74996.1"
FT                   /translation="MQQTKQRLLTGNKALAEAIRLEMERDPNVFVMGEDVGVYGGIFGA
FT                   TEGLFQKFGPERVIDTPISETAFIGAAIGAAAEGMRPIVELMFVDFFGVCMDQIYNHMA
FT                   KIPYMSGGRVKLPMVLMTAVGGGYSDAAQHSQTLYATFAHLPGMKVVAPSTPYDLKGMM
FT                   ISAIRDDNPVVFMFHKTLQGLGWMDQLDASIGHVPEEAYTVPLGKANIVREGTDITIVG
FT                   IQMTVHQALEAAKRLEQQGIQAEVIDLRSLVPLDKETIIQSVKKTHRLLVVDEDYLSYG
FT                   MTAEIAAIAAEHCLYDLEAPVKRIAVPDVPIPYSRPLEQFVLPNADKIFREAIQLVNE"
FT   CDS_pept        737253..738563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0712"
FT                   /locus_tag="GK0712"
FT                   /product="pyruvate dehydrogenase E2 (dihydrolipoamide
FT                   acetyltransferase)"
FT                   /EC_number="2.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:GK0712"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74997"
FT                   /db_xref="GOA:Q5L233"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L233"
FT                   /protein_id="BAD74997.1"
FT                   /translation="MVVEVTLPKLSDSHDESFITFWHVSEGDAVEKGATLVEVQTEKAV
FT                   SEIHAPESGTVKEIKKKRGDTAKVGEVLAVIAVETFAPDGGDPQTEIKITPRVKKLAKE
FT                   LGVDWSTVTPTGANGKITEDDIRRAASAGKQRTPQKTFVAAPSVRKFAREQNVSLEEIT
FT                   PSGKNGRILKSDIEAALSVRQQKATDEAAASVEIVKKQESREKVRRVPLTGIRKAIAQA
FT                   MVRSTRTIPQVTHFGEADATRLVQHRRRIQPLAEQQGVKLTYLAYVVKALAAVLKKYPM
FT                   LNASLDEEREEIVIHEFIHIGFAVDTDRGLLVPVIRDADQKSLFQIAKEIEELTAKARA
FT                   GTIQAVEMSGGTCTVSNIGSANGSWFTPIIHYPQSCLLGIGKVEKKPVVVDDSIEIASV
FT                   MPLSLTYDHRLIDGMMAQHALNECQTYLSEPDWLLVM"
FT   CDS_pept        complement(738736..739599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0713"
FT                   /locus_tag="GK0713"
FT                   /product="oxidoreductase (short-chain
FT                   dehydrogenase:reductase family)"
FT                   /db_xref="EnsemblGenomes-Gn:GK0713"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74998"
FT                   /db_xref="GOA:Q5L232"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L232"
FT                   /protein_id="BAD74998.1"
FT                   /translation="MVTKQQTTLPPQHQTRQPGLQTEMNPQPVTIKDTYKGSGKLKNKT
FT                   AIISGGDSGIGRAVAVHFAKEGADVAIIYLNEHEDAEETKRLVEQEGRRCLAMAGDIGD
FT                   EAFCKEAVKQTIKAFGKLDIVVNNAAEQHPQPNFLNITAAQLEKTFRTNVFGYFFLTKA
FT                   ALPHLKNGSTIINTTSVTAYEGNEQLIDYSATKGAIVAFTRSLAKALVGQGIRVNGVAP
FT                   GPIWTPLIPSTFQSEQVAAFGANTPMKRPGQPSEVAPCYVFLASDESSYMTGQMLHVNG
FT                   GKFISD"
FT   CDS_pept        739657..739833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0714"
FT                   /locus_tag="GK0714"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0714"
FT                   /db_xref="EnsemblGenomes-Tr:BAD74999"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L231"
FT                   /protein_id="BAD74999.1"
FT                   /translation="MCQVDIYDEKYGESRGGLSFLAVHLAQDRKFRGNDGPQHLVSELK
FT                   HDVFPKYEGGDDE"
FT   CDS_pept        739830..739985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0715"
FT                   /locus_tag="GK0715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0715"
FT                   /db_xref="EnsemblGenomes-Tr:BAD75000"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L230"
FT                   /protein_id="BAD75000.1"
FT                   /translation="MIKKEDQLISLFGSMPPKGDRSPMDWKSIRRQAKEEWLKKLENRE
FT                   QIKTKK"
FT   CDS_pept        complement(740061..743471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0716"
FT                   /locus_tag="GK0716"
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:GK0716"
FT                   /db_xref="EnsemblGenomes-Tr:BAD75001"
FT                   /db_xref="GOA:Q5L229"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L229"
FT                   /protein_id="BAD75001.1"
FT                   /translation="MANVTLEQQLQRKILVIDGAMGTMIQSANLSAADFGGEAYEGCNE
FT                   YLTLTAPHVIRRIHEAYLEAGADIIETNTFGATRIVLDEYGLGHLALELNIEAAKLAKQ
FT                   TAESFSTPDWPRFVAGSMGPTTKTLSVTGGATFEELVAAYEEQARGLLLGGVDLLLLET
FT                   CQDTLNVKAGFLGISKAFEAVGRRVPLMISGTIEPMGTTLAGQAIDAFFISVRHMKPIA
FT                   VGLNCATGPEFMTDHLRTLASLADTAVSCYPNAGLPDEEGHYHETPNMLAEKIRRFAEK
FT                   GWINIVGGCCGTTPDHIRAIAEAVRDLPPRAIPSSFDVHAVSGIEALIYDETMRPLFVG
FT                   ERTNVIGSRKFKRLIAEGKYEEAAEIARAQVKNGAHVIDICLADPDRDELHDMEQFVRE
FT                   VVKKVKVPLVIDSTDERVIERALTYSQGKAIINSINLEDGEERFAKVVPLLHQYGAAVV
FT                   VGTIDEQGMAVTAERKLEIALRSYDLLVNRYGVPERDIIFDPLVFPVGTGDEQYIGAAK
FT                   ETIEGIRLIKERLPHCLTMLGISNVSFGLPPAGREVLNSVFLYHCTQAGLDYAIVNTEK
FT                   LERFASIPEEEVRMAEALLFDTNDETLNAFIEFYRSKITAAKPAQTNLSLEERLARYVI
FT                   EGSKDGLIPDLEKALETYSDPLSIINGPLMAGMDEVGRLFNNNQLIVAEVLQSAEVMKA
FT                   AVAFLEPYMEKKEGSTKGKVILATVKGDVHDIGKNLVDIILSNNGYEVIDLGIKVAPQQ
FT                   LIEAVREHQPDIIGLSGLLVKSAQQMVVTAQDLRQAGISTPILVGGAALTRKFTENKIA
FT                   PEYDGVVLYAKDAMDGLALANQIQQGEIDYKKKETAESEPTRQTMVVTAVKSNVSTDVP
FT                   VYIPADLERHVLRNVPLDHILPYVNWQMVLGHHLGLKGKVKRLLEEKDEKALALKAVID
FT                   ELVHEAKERRWIQPAGVYRFFPAQSDGNRVYIYDPTDGKTVLEMFDFPRQPRAPYLCLA
FT                   DYLKSKESGEMDYVGLFAVTAGHGVRELAQRWKEEGEFLKSHAIQALALEIAEGFAERV
FT                   HQIMRDRWGFPDDPDFTMEERFAAKYQGQRYSFGYPACPNLEDQEKLFRLLHPEDIGIR
FT                   LTDGYMMEPEASVSAIVFAHPEARYFNVL"
FT   CDS_pept        complement(743464..745311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0717"
FT                   /locus_tag="GK0717"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0717"
FT                   /db_xref="EnsemblGenomes-Tr:BAD75002"
FT                   /db_xref="GOA:Q5L228"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L228"
FT                   /protein_id="BAD75002.1"
FT                   /translation="MGLLDELKERILIADGAMGTLLYSHGIDRCFEELNLSNPDEIVHI
FT                   HEAYIAAGADVIQTNTYGANYVKLARYGLEDEVPAINRAAVRLARQAANGRAYVLGTIG
FT                   GLRTLNKSVVTLEEVKRTFREQLFVLLAEGVDGVLLETYYDLEELETVLAIARKETDLP
FT                   IIAHVSLHEVGVLQDGTPLADALARLEALGADVVGLNCRLGPYHMLRSLEEVPLPKQAF
FT                   LSAYPNASLPDYRDGRLVYETNAEYFEETAKAFRDQGVRLIGGCCGTTPKHIEAMAKAL
FT                   ADRTPVTEKTVKRRTASVSVQADRPAPTPLPELARTRRSVIVELDPPKKLGIDKFLAGA
FT                   KALHDAGIDALTLADNSLATPRISNAAVATIIKEQLGIRPLVHITCRDRNLIGLQSHLM
FT                   GLHTLGITDVLAITGDPSKIGDFPGATSVYDLSSFDLIRLIRQFNEGLSYSGKPLGQKT
FT                   NFSIGAAFNPNVRHLDKAVERMEKKIQCGAHYFLTQPIYSEEKIVEVHEATKHLDTPIY
FT                   IGIMPLVSARNADFLHHEVPGITLSDEIRARMAACGNDPVQAAKEGIAIAKSLIDAAFD
FT                   LFNGIYLITPFLRYDMTVELVRYIHEKEAAAKERKVVHG"
FT   CDS_pept        complement(745599..745982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0718"
FT                   /locus_tag="GK0718"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0718"
FT                   /db_xref="EnsemblGenomes-Tr:BAD75003"
FT                   /db_xref="GOA:Q5L227"
FT                   /db_xref="InterPro:IPR031493"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L227"
FT                   /protein_id="BAD75003.1"
FT                   /translation="MKSIKPGRGPSMQGLFGSIAAVLFGIFWMVMAFSITADSPFPAAR
FT                   FFPFFGLVVIAIGVFQAFYHYKNATGKQRMSLLDIVDSEEEPDPLNVRFGSHKQPNKHC
FT                   PHCGGHVQHNFQFCPQCGKELLR"
FT   CDS_pept        746516..746746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0719"
FT                   /locus_tag="GK0719"
FT                   /product="circularin A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:GK0719"
FT                   /db_xref="EnsemblGenomes-Tr:BAD75004"
FT                   /db_xref="InterPro:IPR009086"
FT                   /db_xref="InterPro:IPR020038"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L226"
FT                   /protein_id="BAD75004.1"
FT                   /translation="MSLLALVAGTLGVSQSIATTVVSIVLTGSTLISIILGITAILSGG
FT                   VDAILEIGWSAFVATVKKIVAERGKAAAIAW"
FT   CDS_pept        746814..748433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0720"
FT                   /locus_tag="GK0720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0720"
FT                   /db_xref="EnsemblGenomes-Tr:BAD75005"
FT                   /db_xref="GOA:Q5L225"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L225"
FT                   /protein_id="BAD75005.1"
FT                   /translation="MKLVWLLYQQRQRSSLAPLQKKSPFSPKMTMFLVEAAKWLVSGIL
FT                   VVIICTRSFIMFRPSAIMAFLFFMSVSPLIGVLLESKEALQRQYHYHYVRLSGVRDDEV
FT                   WRRLLKIHYAVSLLRLLPIWLPPSIGLMVMFGITGASLVWFGHTMLLLLYVTSHIVRGS
FT                   TFRAMGAFSAFFFRMASFAIGYVVLAAIVPLLQLSRQAVRMYGLSLSYLVYMDGYVAHW
FT                   QQLFYECMTSWGEGWSFSSTALSFIGAGFALLALICFSFTRASHSDKAAYMLYSWHQRV
FT                   IESLKIRSTNNAILYKDLCLLTRQARELTKPPWSLFLPGEWFLVAGANLALLPIVHNGL
FT                   IILFLFMFEMYMVMTGTLRAITDVFRDIFQFESEMERLTVFRLLSPPPLVPLIEAKWTL
FT                   LERLGVYPCMTAVGLLLLEYIGLLGMSGGLWAAMGAVVMMPAYSLVVKRILRTDYEVFC
FT                   LVLASGEQAALTSPRDYAGYMVIAAGNHSFHRLLIYITVFSSLLSAFFMLLKGWSWACY
FT                   SVLFVLMLYLVLWNSSQYARRT"
FT   CDS_pept        748447..748956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="GK0721"
FT                   /locus_tag="GK0721"
FT                   /product="hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:GK0721"
FT                   /db_xref="EnsemblGenomes-Tr:BAD75006"
FT                   /db_xref="GOA:Q5L224"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L224"
FT                   /protein_id="BAD75006.1"
FT                   /translation="MIRR