(data stored in ACNUC1104 zone)

EMBL: BA000045

ID   BA000045; SV 2; circular; genomic DNA; STD; PRO; 4659019 BP.
XX
AC   BA000045; AP006568-AP006583;
XX
PR   Project:PRJNA9606;
XX
DT   31-OCT-2004 (Rel. 81, Created)
DT   10-OCT-2016 (Rel. 130, Last updated, Version 9)
XX
DE   Gloeobacter violaceus PCC 7421 DNA, complete genome.
XX
KW   .
XX
OS   Gloeobacter violaceus PCC 7421
OC   Bacteria; Cyanobacteria; Gloeobacteria; Gloeobacterales; Gloeobacteraceae;
OC   Gloeobacter.
XX
RN   [1]
RP   1-4659019
RA   Sato S., Kaneko T.;
RT   ;
RL   Submitted (15-AUG-2003) to the INSDC.
RL   Contact:Shusei Sato Kazusa DNA Research Institute, Department of Plant
RL   Genome Research; 2-6-7 Kazusa-kamatari, Kisarazu, Chiba 292-0812, Japan URL
RL      :http://www.kazusa.or.jp/rhizobase/
XX
RN   [2]
RX   DOI; 10.1093/dnares/10.4.137.
RX   PUBMED; 14621292.
RA   Nakamura Y., Kaneko T., Sato S., Mimuro M., Miyashita H., Tsuchiya T.,
RA   Sasamoto S., Watanabe A., Kawashima K., Kishida Y., Kiyokawa C., Kohara M.,
RA   Matsumoto M., Matsuno A., Nakazaki N., Shimpo S., Takeuchi C., Yamada M.,
RA   Tabata S.;
RT   "Complete genome structure of Gloeobacter violaceus PCC 7421, a
RT   cyanobacterium that lacks thylakoids";
RL   DNA Res. 10(4):137-145(2003).
XX
RN   [3]
RX   DOI; 10.1093/dnares/10.4.181.
RX   PUBMED; 14621296.
RA   Nakamura Y., Kaneko T., Sato S., Mimuro M., Miyashita H., Tsuchiya T.,
RA   Sasamoto S., Watanabe A., Kawashima K., Kishida Y., Kiyokawa C., Kohara M.,
RA   Matsumoto M., Matsuno A., Nakazaki N., Shimpo S., Takeuchi C., Yamada M.,
RA   Tabata S.;
RT   "Complete genome structure of Gloeobacter violaceus PCC 7421, a
RT   cyanobacterium that lacks thylakoids (supplement)";
RL   DNA Res. 10(4):181-201(2003).
XX
DR   MD5; b7b436c087587afe756c12e755bec259.
DR   BioSample; SAMD00061120.
DR   EnsemblGenomes-Gn; EBG00000034487.
DR   EnsemblGenomes-Gn; EBG00000034488.
DR   EnsemblGenomes-Gn; EBG00000034489.
DR   EnsemblGenomes-Gn; EBG00000034490.
DR   EnsemblGenomes-Gn; EBG00000034491.
DR   EnsemblGenomes-Gn; EBG00000034492.
DR   EnsemblGenomes-Gn; EBG00000034493.
DR   EnsemblGenomes-Gn; EBG00000034494.
DR   EnsemblGenomes-Gn; EBG00000034495.
DR   EnsemblGenomes-Gn; EBG00000034496.
DR   EnsemblGenomes-Gn; EBG00000034497.
DR   EnsemblGenomes-Gn; EBG00000034498.
DR   EnsemblGenomes-Gn; EBG00000034499.
DR   EnsemblGenomes-Gn; EBG00000034500.
DR   EnsemblGenomes-Gn; EBG00000034501.
DR   EnsemblGenomes-Gn; EBG00000034502.
DR   EnsemblGenomes-Gn; EBG00000034503.
DR   EnsemblGenomes-Gn; EBG00000034504.
DR   EnsemblGenomes-Gn; EBG00000034505.
DR   EnsemblGenomes-Gn; EBG00000034506.
DR   EnsemblGenomes-Gn; EBG00000034507.
DR   EnsemblGenomes-Gn; EBG00000034508.
DR   EnsemblGenomes-Gn; EBG00000034509.
DR   EnsemblGenomes-Gn; EBG00000034510.
DR   EnsemblGenomes-Gn; EBG00000034511.
DR   EnsemblGenomes-Gn; EBG00000034512.
DR   EnsemblGenomes-Gn; EBG00000034513.
DR   EnsemblGenomes-Gn; EBG00000034514.
DR   EnsemblGenomes-Gn; EBG00000034515.
DR   EnsemblGenomes-Gn; EBG00000034516.
DR   EnsemblGenomes-Gn; EBG00000034517.
DR   EnsemblGenomes-Gn; EBG00000034518.
DR   EnsemblGenomes-Gn; EBG00000034519.
DR   EnsemblGenomes-Gn; EBG00000034520.
DR   EnsemblGenomes-Gn; EBG00000034521.
DR   EnsemblGenomes-Gn; EBG00000034522.
DR   EnsemblGenomes-Gn; EBG00000034523.
DR   EnsemblGenomes-Gn; EBG00000034524.
DR   EnsemblGenomes-Gn; EBG00000034525.
DR   EnsemblGenomes-Gn; EBG00000034526.
DR   EnsemblGenomes-Gn; EBG00000034527.
DR   EnsemblGenomes-Gn; EBG00000034528.
DR   EnsemblGenomes-Gn; EBG00000034529.
DR   EnsemblGenomes-Gn; EBG00000034530.
DR   EnsemblGenomes-Gn; EBG00000034531.
DR   EnsemblGenomes-Gn; EBG00000034532.
DR   EnsemblGenomes-Gn; EBG00000034533.
DR   EnsemblGenomes-Gn; EBG00000034534.
DR   EnsemblGenomes-Gn; EBG00000034535.
DR   EnsemblGenomes-Gn; EBG00000622966.
DR   EnsemblGenomes-Gn; EBG00001183253.
DR   EnsemblGenomes-Gn; EBG00001183254.
DR   EnsemblGenomes-Gn; EBG00001183255.
DR   EnsemblGenomes-Gn; EBG00001183256.
DR   EnsemblGenomes-Gn; EBG00001183257.
DR   EnsemblGenomes-Gn; EBG00001183258.
DR   EnsemblGenomes-Gn; EBG00001183259.
DR   EnsemblGenomes-Gn; EBG00001183260.
DR   EnsemblGenomes-Gn; EBG00001183261.
DR   EnsemblGenomes-Gn; EBG00001183262.
DR   EnsemblGenomes-Gn; EBG00001183263.
DR   EnsemblGenomes-Gn; EBG00001183264.
DR   EnsemblGenomes-Gn; EBG00001183265.
DR   EnsemblGenomes-Gn; EBG00001183266.
DR   EnsemblGenomes-Gn; EBG00001183267.
DR   EnsemblGenomes-Gn; EBG00001183268.
DR   EnsemblGenomes-Gn; EBG00001183269.
DR   EnsemblGenomes-Gn; EBG00001183270.
DR   EnsemblGenomes-Gn; EBG00001183271.
DR   EnsemblGenomes-Gn; EBG00001183272.
DR   EnsemblGenomes-Gn; EBG00001183273.
DR   EnsemblGenomes-Gn; EBG00001183274.
DR   EnsemblGenomes-Gn; EBG00001183275.
DR   EnsemblGenomes-Gn; EBG00001183276.
DR   EnsemblGenomes-Gn; EBG00001183277.
DR   EnsemblGenomes-Gn; EBG00001183278.
DR   EnsemblGenomes-Gn; EBG00001183279.
DR   EnsemblGenomes-Gn; EBG00001183280.
DR   EnsemblGenomes-Gn; EBG00001183281.
DR   EnsemblGenomes-Gn; EBG00001183282.
DR   EnsemblGenomes-Gn; EBG00001183283.
DR   EnsemblGenomes-Gn; EBG00001183284.
DR   EnsemblGenomes-Gn; EBG00001183285.
DR   EnsemblGenomes-Gn; EBG00001183286.
DR   EnsemblGenomes-Gn; EBG00001183287.
DR   EnsemblGenomes-Gn; EBG00001183288.
DR   EnsemblGenomes-Gn; EBG00001183289.
DR   EnsemblGenomes-Gn; EBG00001183290.
DR   EnsemblGenomes-Gn; EBG00001183291.
DR   EnsemblGenomes-Gn; EBG00001183292.
DR   EnsemblGenomes-Gn; EBG00001183293.
DR   EnsemblGenomes-Gn; EBG00001183294.
DR   EnsemblGenomes-Gn; EBG00001183295.
DR   EnsemblGenomes-Gn; EBG00001183296.
DR   EnsemblGenomes-Gn; EBG00001183297.
DR   EnsemblGenomes-Gn; EBG00001183298.
DR   EnsemblGenomes-Gn; EBG00001183299.
DR   EnsemblGenomes-Gn; EBG00001183300.
DR   EnsemblGenomes-Gn; EBG00001183301.
DR   EnsemblGenomes-Gn; EBG00001183302.
DR   EnsemblGenomes-Gn; EBG00001183303.
DR   EnsemblGenomes-Gn; EBG00001183304.
DR   EnsemblGenomes-Gn; EBG00001183305.
DR   EnsemblGenomes-Gn; EBG00001183306.
DR   EnsemblGenomes-Gn; EBG00001183307.
DR   EnsemblGenomes-Gn; EBG00001183308.
DR   EnsemblGenomes-Gn; EBG00001183309.
DR   EnsemblGenomes-Tr; EBG00000034487-1.
DR   EnsemblGenomes-Tr; EBG00000034488-1.
DR   EnsemblGenomes-Tr; EBG00000034489-1.
DR   EnsemblGenomes-Tr; EBG00000034490-1.
DR   EnsemblGenomes-Tr; EBG00000034491-1.
DR   EnsemblGenomes-Tr; EBG00000034492-1.
DR   EnsemblGenomes-Tr; EBG00000034493-1.
DR   EnsemblGenomes-Tr; EBG00000034494-1.
DR   EnsemblGenomes-Tr; EBG00000034495-1.
DR   EnsemblGenomes-Tr; EBG00000034496-1.
DR   EnsemblGenomes-Tr; EBG00000034497-1.
DR   EnsemblGenomes-Tr; EBG00000034498-1.
DR   EnsemblGenomes-Tr; EBG00000034499-1.
DR   EnsemblGenomes-Tr; EBG00000034500-1.
DR   EnsemblGenomes-Tr; EBG00000034501-1.
DR   EnsemblGenomes-Tr; EBG00000034502-1.
DR   EnsemblGenomes-Tr; EBG00000034503-1.
DR   EnsemblGenomes-Tr; EBG00000034504-1.
DR   EnsemblGenomes-Tr; EBG00000034505-1.
DR   EnsemblGenomes-Tr; EBG00000034506-1.
DR   EnsemblGenomes-Tr; EBG00000034507-1.
DR   EnsemblGenomes-Tr; EBG00000034508-1.
DR   EnsemblGenomes-Tr; EBG00000034509-1.
DR   EnsemblGenomes-Tr; EBG00000034510-1.
DR   EnsemblGenomes-Tr; EBG00000034511-1.
DR   EnsemblGenomes-Tr; EBG00000034512-1.
DR   EnsemblGenomes-Tr; EBG00000034513-1.
DR   EnsemblGenomes-Tr; EBG00000034514-1.
DR   EnsemblGenomes-Tr; EBG00000034515-1.
DR   EnsemblGenomes-Tr; EBG00000034516-1.
DR   EnsemblGenomes-Tr; EBG00000034517-1.
DR   EnsemblGenomes-Tr; EBG00000034518-1.
DR   EnsemblGenomes-Tr; EBG00000034519-1.
DR   EnsemblGenomes-Tr; EBG00000034520-1.
DR   EnsemblGenomes-Tr; EBG00000034521-1.
DR   EnsemblGenomes-Tr; EBG00000034522-1.
DR   EnsemblGenomes-Tr; EBG00000034523-1.
DR   EnsemblGenomes-Tr; EBG00000034524-1.
DR   EnsemblGenomes-Tr; EBG00000034525-1.
DR   EnsemblGenomes-Tr; EBG00000034526-1.
DR   EnsemblGenomes-Tr; EBG00000034527-1.
DR   EnsemblGenomes-Tr; EBG00000034528-1.
DR   EnsemblGenomes-Tr; EBG00000034529-1.
DR   EnsemblGenomes-Tr; EBG00000034530-1.
DR   EnsemblGenomes-Tr; EBG00000034531-1.
DR   EnsemblGenomes-Tr; EBG00000034532-1.
DR   EnsemblGenomes-Tr; EBG00000034533-1.
DR   EnsemblGenomes-Tr; EBG00000034534-1.
DR   EnsemblGenomes-Tr; EBG00000034535-1.
DR   EnsemblGenomes-Tr; EBG00000622966-1.
DR   EnsemblGenomes-Tr; EBT00001762189.
DR   EnsemblGenomes-Tr; EBT00001762192.
DR   EnsemblGenomes-Tr; EBT00001762193.
DR   EnsemblGenomes-Tr; EBT00001762195.
DR   EnsemblGenomes-Tr; EBT00001762200.
DR   EnsemblGenomes-Tr; EBT00001762202.
DR   EnsemblGenomes-Tr; EBT00001762205.
DR   EnsemblGenomes-Tr; EBT00001762207.
DR   EnsemblGenomes-Tr; EBT00001762209.
DR   EnsemblGenomes-Tr; EBT00001762211.
DR   EnsemblGenomes-Tr; EBT00001762212.
DR   EnsemblGenomes-Tr; EBT00001762214.
DR   EnsemblGenomes-Tr; EBT00001762218.
DR   EnsemblGenomes-Tr; EBT00001762221.
DR   EnsemblGenomes-Tr; EBT00001762223.
DR   EnsemblGenomes-Tr; EBT00001762226.
DR   EnsemblGenomes-Tr; EBT00001762229.
DR   EnsemblGenomes-Tr; EBT00001762233.
DR   EnsemblGenomes-Tr; EBT00001762236.
DR   EnsemblGenomes-Tr; EBT00001762238.
DR   EnsemblGenomes-Tr; EBT00001762243.
DR   EnsemblGenomes-Tr; EBT00001762247.
DR   EnsemblGenomes-Tr; EBT00001762248.
DR   EnsemblGenomes-Tr; EBT00001762249.
DR   EnsemblGenomes-Tr; EBT00001762250.
DR   EnsemblGenomes-Tr; EBT00001762251.
DR   EnsemblGenomes-Tr; EBT00001762252.
DR   EnsemblGenomes-Tr; EBT00001762253.
DR   EnsemblGenomes-Tr; EBT00001762254.
DR   EnsemblGenomes-Tr; EBT00001762255.
DR   EnsemblGenomes-Tr; EBT00001762256.
DR   EnsemblGenomes-Tr; EBT00001762257.
DR   EnsemblGenomes-Tr; EBT00001762258.
DR   EnsemblGenomes-Tr; EBT00001762259.
DR   EnsemblGenomes-Tr; EBT00001762260.
DR   EnsemblGenomes-Tr; EBT00001762261.
DR   EnsemblGenomes-Tr; EBT00001762262.
DR   EnsemblGenomes-Tr; EBT00001762263.
DR   EnsemblGenomes-Tr; EBT00001762264.
DR   EnsemblGenomes-Tr; EBT00001762265.
DR   EnsemblGenomes-Tr; EBT00001762266.
DR   EnsemblGenomes-Tr; EBT00001762267.
DR   EnsemblGenomes-Tr; EBT00001762268.
DR   EnsemblGenomes-Tr; EBT00001762269.
DR   EnsemblGenomes-Tr; EBT00001762270.
DR   EnsemblGenomes-Tr; EBT00001762271.
DR   EnsemblGenomes-Tr; EBT00001762272.
DR   EnsemblGenomes-Tr; EBT00001762273.
DR   EnsemblGenomes-Tr; EBT00001762274.
DR   EnsemblGenomes-Tr; EBT00001762275.
DR   EnsemblGenomes-Tr; EBT00001762276.
DR   EnsemblGenomes-Tr; EBT00001762277.
DR   EnsemblGenomes-Tr; EBT00001762278.
DR   EnsemblGenomes-Tr; EBT00001762279.
DR   EnsemblGenomes-Tr; EBT00001762280.
DR   EnsemblGenomes-Tr; EBT00001762281.
DR   EnsemblGenomes-Tr; EBT00001762282.
DR   EuropePMC; PMC1446974; 16585762.
DR   EuropePMC; PMC1472365; 16672464.
DR   EuropePMC; PMC2174460; 17908306.
DR   EuropePMC; PMC2190773; 17941988.
DR   EuropePMC; PMC2242806; 18045455.
DR   EuropePMC; PMC2442094; 18534010.
DR   EuropePMC; PMC3271361; 21320320.
DR   GOA; P0C029.
DR   GOA; P61052.
DR   InterPro; IPR010284; PSII_Ycf12_core-subunit.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01116; Yfr1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01851; cyano_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; BA000045.
DR   SILVA-SSU; BA000045.
DR   StrainInfo; 106390; 0.
DR   UniProtKB/Swiss-Prot; P0C029; PSAZ_GLOVI.
DR   UniProtKB/Swiss-Prot; P61052; YCF12_GLOVI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4659019
FT                   /organism="Gloeobacter violaceus PCC 7421"
FT                   /strain="PCC 7421"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:251221"
FT   CDS_pept        52..525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0001"
FT                   /note="ORF_ID:glr0001"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87942"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87942"
FT                   /db_xref="GOA:Q7NPQ4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPQ4"
FT                   /protein_id="BAC87942.1"
FT                   /translation="MEFRPHISLNVTDLEASVRFYRAAFAAEPTKHYADYANFRLEEPA
FT                   LHLALVAQPGPVRARSGDEHFGIEMFDAGQLALWQSRAKAAGLPMRTENAVTCCYAVGD
FT                   KFWLTDPDGNDWEFWVRTDEAAAMHGEGESRPQEQTCCAPAPAALSTQQTCCG"
FT   CDS_pept        595..927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0002"
FT                   /product="ArsR family transcriptional regulatory protein"
FT                   /note="ORF_ID:glr0002"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87943"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87943"
FT                   /db_xref="GOA:Q7NPQ3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPQ3"
FT                   /protein_id="BAC87943.1"
FT                   /translation="MSLHSCAPCLPAEAPLFTPQDEEEERQFATLCKALGHPIRVRILK
FT                   ILATRATCICGDLVEMLPVSQSTVSEHLRILKQAGLVQGEVDGPRVCYCIDPATLGRFK
FT                   TLAGSL"
FT   CDS_pept        977..1792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0003"
FT                   /note="ORF_ID:glr0003"
FT                   /note="probable channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87944"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87944"
FT                   /db_xref="GOA:Q7NPQ2"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPQ2"
FT                   /protein_id="BAC87944.1"
FT                   /translation="MFPVLADKRSDEPISPQPSEAAVSRPASAPARAPSGSDTPVESTW
FT                   PRRELLAEAVGTFVLVFAGTGAVVVNAVSGGALTHLGISFVFGAVVAALIYTLGHISGA
FT                   HINPAVTLTLWALGRFPARRVVPYMLVQLAGAAAASVAVLVCFGNQAKLGATLPLAGNW
FT                   AQAFAVELLLTFILMLVICGSALDARAPRGFAGLAIGLTVGLEAGFGGPISGASMNPAR
FT                   SFGPALVAGAWEAHWVYWLAPIAGALLAGWVWHQMRDPLEETSSRLDGG"
FT   CDS_pept        1799..2215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0004"
FT                   /note="ORF_ID:glr0004"
FT                   /note="arsenate reductase ArsC homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87945"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87945"
FT                   /db_xref="GOA:Q7NPQ1"
FT                   /db_xref="InterPro:IPR014062"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPQ1"
FT                   /protein_id="BAC87945.1"
FT                   /translation="MKKVMFVCKRNSCRSQMAEGYARTLGAGVIEVVSSGLEASRVHPT
FT                   AVQVMAAAGVDIAGQISKPLSDFGSEDFDVVISLCGCGVNLPEAWLTREIFEDWRVEDP
FT                   DGQPVEVFHRVRDEIKQRVQNLVDALRTQPATRA"
FT   CDS_pept        2212..2898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0005"
FT                   /note="ORF_ID:glr0005"
FT                   /note="arsenical resistance protein ArsH homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87946"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87946"
FT                   /db_xref="GOA:Q7NPQ0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPQ0"
FT                   /protein_id="BAC87946.1"
FT                   /translation="MNGYPLVPVGLSWRDLSMSDFEHPPRILFLYGSLRERSYSRLLAE
FT                   EAGRIIADMGAEVRFYDPRTLPVYAGVEPDHPKVQELRDLSLWSEGQVWSSPEMHGQIT
FT                   GILKNQIDWIPLTLGSLRPTQGRTLAVMQVSGGSQSFNAVNTLRLLGRWMRMFTIPNQS
FT                   SVAKAYNEFHEDGTMKDSPYRDRVIDVMEELYKFTVLLRPHTAHLTDRYSERKEKAAQA
FT                   MADQKP"
FT   CDS_pept        2933..3379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0006"
FT                   /note="ORF_ID:glr0006"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87947"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87947"
FT                   /db_xref="GOA:Q7NPP9"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPP9"
FT                   /protein_id="BAC87947.1"
FT                   /translation="MEQSITENLWWVIPGKLGGVRKPTEAEIAELQASGVGGIVSVMDD
FT                   PGNLDLYERAGLPYRWLPVKGGTAPTREQITQLQDFVEEQNALGAGVAVHCTSGRRRTG
FT                   TFLAAYLIAQSHSSEEALQIVQTANPDVELREAQIEFLRNFARP"
FT   CDS_pept        3492..3824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0007"
FT                   /product="ArsR family transcriptional regulatory protein"
FT                   /note="ORF_ID:glr0007"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87948"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87948"
FT                   /db_xref="GOA:Q7NPP8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPP8"
FT                   /protein_id="BAC87948.1"
FT                   /translation="MIHSDCLSAEQFAAQFHALSEPLRLQVLEVLRAQELCVCELGEKL
FT                   GVAQSKLSFHLKTLKEAGLVRTRQEKRWVYYSVNLPGLVAVEQYLADYRRFSPLLPARS
FT                   CDDSPK"
FT   CDS_pept        4005..5027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0008"
FT                   /product="phosphate ABC transporter periplasmic
FT                   phosphate-binding protein"
FT                   /note="ORF_ID:glr0008"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87949"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87949"
FT                   /db_xref="GOA:Q7NPP7"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPP7"
FT                   /protein_id="BAC87949.1"
FT                   /translation="MLSVRAKAAAAGVAAAGLIGTFLSMPAHQAQAQSQQTIKVDGSST
FT                   VFPITEAVAEEFQKSKKGAVRVTVGVSGTGGGFKKFCRGETDISDASRPILKKEMDACK
FT                   EAAIQYVELPVAYDALTVMVNPSNTWASTMTVAELKKIWEPEAQGKVTNWNQVRSSFPN
FT                   APLKLYGPGADSGTFDYFTEAVVGKSKASRGDFTASEDDNVLVQGIANDKNALGYFGYA
FT                   YYAENKSKLKAVGVDGGKGPVLPSDKTVEDGTYNPLSRPIFIYVSNKAMARPEVKEFVE
FT                   FYLKSAPTLVKQVKYVPLPKKAYDVALSHFQKNRMGTVFGGEAEVGLKIEDLLSREAKF
FT                   "
FT   CDS_pept        5096..6052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0009"
FT                   /product="phosphate ABC transporter permease protein"
FT                   /note="ORF_ID:glr0009"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87950"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87950"
FT                   /db_xref="GOA:Q7NPP6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPP6"
FT                   /protein_id="BAC87950.1"
FT                   /translation="MALMATSDPSSLQSRGRPAGGALRYRPLRNLRERAIELVLLLAAL
FT                   SSVLTTAGIVAVLLFESFQFFAQVPLGQFLTDTQWTPLFANPRYGILPLVAGTLVTTVV
FT                   ALVVAIPLGTIAAIYLSEYAPAQLREVAKPVLELLSAVPTVVYGYFALLFVTPLLQKIY
FT                   PDLPGFNMLSAGLVIGIMIIPYVSSLSEDAMRSVPMAIREGSYAMGATRMQTALRVVVP
FT                   SAFSGIASAYVLGFSRAIGETMIVAIAAGTQPNLTLNPTEPAATITAYIVQVSLGDLPH
FT                   GTLAYQTIFAAGLMLLAMTLTFNIAGHLLRKRFREVY"
FT   CDS_pept        6052..6966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0010"
FT                   /product="phosphate ABC transporter permease protein"
FT                   /note="ORF_ID:glr0010"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87951"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87951"
FT                   /db_xref="GOA:Q7NPP5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPP5"
FT                   /protein_id="BAC87951.1"
FT                   /translation="MDAVQLREAIKSRKRADLSFAAAGLLALLVGLVTLTALMVDLAVD
FT                   GTARLRPEFFTSFPSRFAEQAGILSAWVGSCLVMLVTAAAAVPLGVASGIYLEEYAPKN
FT                   WFTEIIEVNITNLAGVPSIIFGLMALGLFVYGLGLGESILTAGLTLALLILPIVIVSTR
FT                   ESLRAVPDSIREAAYALGATRWQVVSDHILPYSTGGILTGIIIGLSRAIGETAPLITIG
FT                   ALTFIAFLPDLPLRAEFPFFSFQWLSSGFTVLPIQMFNWVSRPQEAFQLNAAAAGLVLI
FT                   VMTLGMNALAIYLRYSFRKRIKW"
FT   CDS_pept        6960..7760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0011"
FT                   /product="phosphate ABC transporter ATP binding protein"
FT                   /note="ORF_ID:glr0011"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87952"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87952"
FT                   /db_xref="GOA:Q7NPP4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NPP4"
FT                   /protein_id="BAC87952.1"
FT                   /translation="MVRNPMASAVESTLKTKAQTSNLSFYYGAIQALKNIHLTLAEHRV
FT                   TALIGPSGCGKTTYLRCFNRMHDLYPGNRYEGQILLYPDEVNIVGPEVDPIEVRMRVSM
FT                   VFQKPNPFPKSVYENVAYGLRVRGVRNRAELDEKVERALRQAALWEEVKDRLASLAFNL
FT                   SGGQQQRLCIARALASEPEIILFDEPTSALDPLATLKIEELMGKLKQSITILIVTHNMQ
FT                   QAARISDFTAFMYLGEVIESGQTNQMFDHPTNQLTEQYVAGHFG"
FT   CDS_pept        7984..8997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0012"
FT                   /product="phosphate ABC transporter periplasmic
FT                   phosphate-binding protein"
FT                   /note="ORF_ID:glr0012"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87953"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87953"
FT                   /db_xref="GOA:Q7NPP3"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPP3"
FT                   /protein_id="BAC87953.1"
FT                   /translation="MKNKPLAVAASIVALAAGATLAQGLPAQAPSVKIDGSSTVYPITR
FT                   AAVKAFEAEHKQFQGKIAVNFSGTGGGFRKFCSGETDISDASRPILQREMDECRRANVA
FT                   FMELPVAFDALTVVVHPKNTWASEITVAELKKIWERASQGKITRWSQVRPGFPDRPLRL
FT                   YGPGRDSGTYDYFAEAILGSADTDTRSDYEASEDDDVLVEGVAADPNALGYFGYAYYEA
FT                   NLNRLKTLAVDSGKGPVAPTDKNVEKGTYAPLSRPLFIYVNIVSAQKKAEVREFVDFYL
FT                   ENGAKLASLVGYVPLPAEGYHIANNHFHRGKRGTVYGGRAYLGLTIREVLLKTASF"
FT   CDS_pept        9349..10380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0013"
FT                   /product="phosphate ABC transporter periplasmic
FT                   phosphate-binding protein"
FT                   /note="ORF_ID:glr0013"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87954"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87954"
FT                   /db_xref="GOA:Q7NPP2"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPP2"
FT                   /protein_id="BAC87954.1"
FT                   /translation="MESMMKKSVVVGISVAVLAAASMVLAAQNTTARPSQVSIDGSSTV
FT                   HPITRTAVEEFLSRNPQIAKGAFAVGFSGTGGGLKKLCTGEIDIAGASRPISRQEIQSC
FT                   RNNNIAFMELPVAFDALTVVVHPKNTWASEITVAELKKIWERASQGKITRWSQVRPGWP
FT                   DRPLKLYGPGRDSGTYDYFAEAILGSANTDTRSDYVDSEDDDVLVRGVSEDPDALSYFG
FT                   YAYYEASRGRLKALAVANGLGAVAPSRQAVEKNLYQPLARPLFLYVNMVSSQTKPPVRE
FT                   FVGFYLQHAGRIVNAVGYVPLPPEGYHIANNHFWRGKRGTVYGGKAQIGLTLRQMLLKT
FT                   ASF"
FT   CDS_pept        10503..11510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0014"
FT                   /product="phosphate ABC transporter periplasmic
FT                   phosphate-binding protein"
FT                   /note="ORF_ID:glr0014"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87955"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87955"
FT                   /db_xref="GOA:Q7NPP1"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPP1"
FT                   /protein_id="BAC87955.1"
FT                   /translation="MVSVRKEAGLGLIAAALFGAIAAVGAAAQSLIQIDGSSTVFPITE
FT                   AAAEAFQKSKQGAVKVTVEVSGTGGGFKKFCRGETDISDASRPILKKEMDACKKMGIQY
FT                   IELPVAFDALTVMVHPSNTWAGDLTVAELKTIWEPAAQIKITNWNQVRSSFPNVPLKLY
FT                   GPGTDSGTFDYFTEAVVGKAKASRGDFTASEDDNVLVQGIANDKNALGYFGYAYYAENK
FT                   NKLKAVGIDGGKGPVLPSEKTVEDGSYSPLSRPIFIYVNAAAAVEKPELRQFVEFYLKN
FT                   APTLAKQVKYVPLPTTAYNVSLGHFQQNRIGTVFGGQAEVGSKIEDLLARKPQY"
FT   CDS_pept        11611..12627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0015"
FT                   /product="phosphate ABC transporter periplasmic
FT                   phosphate-binding protein"
FT                   /note="ORF_ID:glr0015"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87956"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87956"
FT                   /db_xref="GOA:Q7NPP0"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPP0"
FT                   /protein_id="BAC87956.1"
FT                   /translation="MNMSKNLLATAALAVGAVGAALAQNASDEQVKVKIDGSSTVYPIT
FT                   RAAAKAFEEQNKPYQGTIAVAFSGTGGGFKKFCAGTTDISDASRPILQKEIDACRNNNV
FT                   AFMELPVAFDALTVVVHPKNTWASEITVAELKKIWERASQGKVTRWSQVRAGFPDRPLK
FT                   LYGPGRDSGTYDYFAEAILGSANTDTRSDYVDSEDDDVLVKGVSEDPDALGYFGYAYYE
FT                   ANKDKLKALAVDGGKGPVPPTDKNVEKGTYAPLSRPLFIYVNIVSTQKKPEVREFVKYY
FT                   LDNGEKLAASVGYVPLPEEGYHIASNHFFRGKRGTVYGGRAYLGLSIREVLLKTASF"
FT   CDS_pept        12781..13944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0016"
FT                   /product="phosphate ABC transporter periplasmic
FT                   phosphate-binding protein"
FT                   /note="ORF_ID:glr0016"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87957"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87957"
FT                   /db_xref="GOA:Q7NPN9"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPN9"
FT                   /protein_id="BAC87957.1"
FT                   /translation="MGHLLIHRGPKTVMKTQNTAVRCSKCGYNNNPGTAAACLVCGKPL
FT                   RDPAGVPWRIWLGAVAGLLTVGGILFILRSSLDEGVSTSAPLAAQIDRYPSRFERIKLY
FT                   SQMAEVPNVPTGLFNYGGSTTLAPLRGPAILDALAVAHPSFRLRYVDPLDGAPGSGTGI
FT                   AMLLRGELSFSQSSRPLKDSEFVRAATRGFKLEQLPIAIDGIAVFTHPGVPLTGLSIVQ
FT                   LRDIFTGKLTNWQQVGGPNLPIVPFSRNLRDGGTVDFFNENVLRSRGFGPRVRVVRDTT
FT                   DALRSVAATPGGIGYASASEVVSQRTVRTLALSKGNGRQYVRPFTAGGTVDAEAFRNGS
FT                   YPITRRLFILVRRDDGLDEQAGAAYTNLLLSGQGQRLVEEAGFVAIR"
FT   CDS_pept        14329..14934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0017"
FT                   /note="ORF_ID:glr0017"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87958"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87958"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPN8"
FT                   /protein_id="BAC87958.1"
FT                   /translation="MRYASMFAAALAALMIAAPSHAGVLEIAIPVSDADPTNGFTYVDS
FT                   IGGVASGVALNNGPGDFNVFGNVFQSDYGLLGAGESGGSFIDYIGSFTASASSGAGPFL
FT                   DATLISSFKFVTLGVNFVSSGSSIDVIITNVTTGGTKVIGDLDPTLSKTSLTRVFDITS
FT                   AIRTLGEGQYTVTFSYKESGARRTYFGFNNVQLTIVTP"
FT   CDS_pept        complement(14939..15508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0018"
FT                   /note="ORF_ID:gll0018"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87959"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87959"
FT                   /db_xref="GOA:Q7NPN7"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR017939"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPN7"
FT                   /protein_id="BAC87959.1"
FT                   /translation="MSLYRCDPGDGESTFLYFAYGSCMCPVDLKRSLGEDVHGRVVGVA
FT                   RLSGYRLGFFHYLQRRDCGALDIVLDPRGEVEGVLYRLPWHLGGLLDGREGVAQGDYRH
FT                   EFVEVSCRGRVHREVRTYTVVDKLSEELAPNEWYSSVVLRGALTCGLSESYCWRLFERM
FT                   CWLEARRQPADAKCPPHRRQGGRIAV"
FT   CDS_pept        complement(15608..16990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0019"
FT                   /note="ORF_ID:gll0019"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87960"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87960"
FT                   /db_xref="GOA:Q7NPN6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPN6"
FT                   /protein_id="BAC87960.1"
FT                   /translation="MPPALSDPLQGGAAVDVGGPLSLDELLSRVERYHPKLLGAFVARR
FT                   IASAKLLEKQGAFDPVFRAYSESIEYNSTSARGRFSAAFQNELKVEFPTRSGIKYDFGA
FT                   RYNVGNVKSPLSSTGDTGEYFVSFSVPLLRGLGINEKALAEQQAQLGEPLAQAELVQTR
FT                   QELKLKAATSYWDWVAAGRRLTVAREVLDLAQVRLAAINNRAGSGDLPAIDAVEAEQEV
FT                   RLRRGELVKAERDVQKEAFKLSLYFWQEDGRQGPPPSLARLPAESSPPTAIDPSILAAA
FT                   QREAIERRPELQRLALQRDSARLDLALAENQRLPGLDLYVSPGLDTGNFSVGGTLKFGV
FT                   AVTLPLAQRTADGLIEQARLKMQKVDLDSLGERQRILTDVIDAVSAVDAAYRRYENATQ
FT                   ETQFARRLEQGERDRFVLGDSTVFLVNQRERGYASARTKQIDSQAEYERALATFRAVTG
FT                   QF"
FT   CDS_pept        complement(17120..18490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0020"
FT                   /note="ORF_ID:gll0020"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87961"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87961"
FT                   /db_xref="GOA:Q7NPN5"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPN5"
FT                   /protein_id="BAC87961.1"
FT                   /translation="MSGYVDRRRVSNYEPTSLRSLAQLVTPAPLFSLGTILLLLTLLTG
FT                   LGLSFIPWQQSVVGKGKVMVLSPMQRPQNIEAQIPGRLVRWNIREGQQVQKGAVVAELA
FT                   DLDAKFLDSNQLARLEQQKRVLVAKRAAAQSRIGSIAAQVTALEGSRGLAIPAAQQKAA
FT                   QSVDRERASRQSLEAAETNLTTAGLNVKRLRELHSKGLRSTRDLEVAENDFVKARTERD
FT                   RAGAALDAARREVSVGRFDQDKVVFDTAASLASSRASLASARETLATIEGDILKLDVDI
FT                   ENLRSRTEQRIVRAPSDGVVVRLLKVGSGETVKAGDVLAVVAPATTDRAVEIYLSDNDA
FT                   PLVAEGRPVRLQFAGWPAVQFVGWPSVAVGTFAGRVAVIDAVDDGTSRYRVIVVPDEQA
FT                   QRTEQPWPGPQYLRPGTEATGWIMLDTVSLGFELWRQFNAFPPTLQAEPVKLKAKKE"
FT   CDS_pept        complement(18536..20353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0021"
FT                   /product="HlyB/MsbA family ABC transporter"
FT                   /note="ORF_ID:gll0021"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87962"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87962"
FT                   /db_xref="GOA:Q7NPN4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPN4"
FT                   /protein_id="BAC87962.1"
FT                   /translation="MSLLKTLPLIVPPTQGPSSEFLHEETEDNLSPYGKLVRLLREDLW
FT                   DLVALGAYTVMVGLLSLAVPLAASALVNTIATGVYMQPLVVLTLLVLGCLTFAGVLKLM
FT                   QLVLAERLQQRIFARIALRLAVRLPFIRQSALLNEYAPQLVNRFFDVVTAQKTLAKMLL
FT                   TAPSALLSILVGMVLMAIYSPYLLAFDLFLIVFIVLVWVGLGNGGLETSIKESSKKYRV
FT                   AEWLEELGRCQTGFKMSGVPSFPLERTDALVLEYIKARRLHFRVLFRQAVGNYLFSAVA
FT                   NAGILAIGGWLVINGQLTLGQLVAAELIVLTVLAALDKLIRTLEEFYDLLTSLEKLSQA
FT                   TELPVERQGGKPMLRSHRGASITCRNVRFAYRPGMEVLNGLYLSLKPGERVSLVGNSGA
FT                   GKSTLSALLCGLLEPNHGAVAVNSVDVRDAKLHDLRQVVGLVSDTNDEVFEGTIEQNIL
FT                   LGRTDTPYEDLVLALEVSQLADELATLPDGLKTMLISGGRNLSRGQVQRILIARALVAQ
FT                   PQLLILDEAFTGIDEKDKLAILDNIYSGDHNWTILNISHDPEVVMRSDIVHVLADGRIV
FT                   ETGSPLEMAARPAGRFAALFPSLRAELVA"
FT   CDS_pept        complement(20457..21125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0022"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:gll0022"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87963"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87963"
FT                   /db_xref="GOA:Q7NPN3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPN3"
FT                   /protein_id="BAC87963.1"
FT                   /translation="MNRILIAEDETRIAAFLEKGLRANGYTTIVVRNGVEAAQMASCDD
FT                   FDLMILDLGLPGKAGLVVLEEMRGRGERLPVIILTARDDIADKVAGLESGADDYVTKPF
FT                   RFEELLARVRARLRDTGNGRTQEQLVLRSGEISLDLRTRKVSAGGRTVELSAREFTLAE
FT                   TFMRHPGQVMSREHLLSRVWGYDYDPGSNIVDVYVGYLRRKLNTDRIETVRGMGYRLRA
FT                   "
FT   CDS_pept        complement(21151..22677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0023"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="ORF_ID:gll0023"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87964"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87964"
FT                   /db_xref="GOA:Q7NPN2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPN2"
FT                   /protein_id="BAC87964.1"
FT                   /translation="MGAGRFSDWDKQLNPSVARLWRRTFGGVRTRILAWYVLLIALCGV
FT                   TSVLAVREILFMQLQERLETSLVREVRLFELLSAEEPVVQEQPMRERAAHIFDRFFYRY
FT                   VPHDNEFMLAYIDGELYRTMPQKLDGTMRANGKLTSRWSHLRAPERDERTGSSGEKFLY
FT                   IAEPLRLGGEPRGLLVAAYCVSCERREVERSVMVVAQVFIGATLLASLLAWIAAGRVLA
FT                   PLRLLAETARSIGESDLTRRIPAGDRGELGELAATFNQMLDRLEAAFASQRNFISDAGH
FT                   ELRTPITIVRGHLELLGDDPGERAETMAIVYDELDRMNRFVDDLLLLARAERPDFLFFE
FT                   LFDVGELTDELYAKARALAPREWSIEARGSGRMVADRQRLTQAVINLAQNAVQHTAPGD
FT                   RIAIGSALRGVWVYLWVSDCGPGIAPEDQRRIFERFERGSHSRYEGSGLGLAIVQAIAT
FT                   THGGSIQLTSVPGAGATFTLVLPLDPPQELQLHNQLAGQSCSTVLSVYSH"
FT   CDS_pept        23077..23634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0024"
FT                   /note="ORF_ID:glr0024"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87965"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPN1"
FT                   /protein_id="BAC87965.1"
FT                   /translation="MNRLFVSALLGIALVAPTAALAGEVAGGGSIVFASGQSRPAELWE
FT                   RANTYVRDKSVRTHIPGRTIAEVVDLQKQVKASQVQPVASAPTAAVAEAEPAKAQFLGN
FT                   TIAAEPIAQAAQPKQDTKTAELDELATSGSIIFSPGKQQPCIDNPRFNPDNDESGPRAS
FT                   EPYSDSTPYAGTPAVASGAACR"
FT   CDS_pept        complement(23846..26275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0025"
FT                   /product="primosomal protein N'"
FT                   /note="ORF_ID:gll0025"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87966"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87966"
FT                   /db_xref="GOA:Q7NPN0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPN0"
FT                   /protein_id="BAC87966.1"
FT                   /translation="METFRPGPLLRPAAWVQVLVDAPARERTYTYRLADGMTAAGGDVV
FT                   CVPFGSQLVGGIVLGCLDQLPTGLDPGRLKTVESVVGTGLFAPGFWPLLVRVADYYLVP
FT                   LARVLETALPPGILSRARRRVRLVADAAPMAQWGLSAAAKSAFDFLRSQAHADFSWRFC
FT                   VQRLSGGVSSLRELQARRLLESYYVFGETARPRTQQFVVLAGAGADLCGRSAAVVQCLR
FT                   RLGGEVSVEQLLAEARTTRALLQKLDAGGHVRIYERQILRLAAPTASADAPKLLTDAQK
FT                   QVLDRLQGATPGPVLLEGVTGSGKTEVYLQAIAPVLDRGESALVLVPEIGLTPQLTDRF
FT                   AARFGARVRVYHSALSEGERFDCWRQMLTGEAQVVVGTRSAVFAPLPKLGLIVLDEEHD
FT                   GSYKQDRPAPCYHARTVALWRGELAGCPVLLGSATPDLESFDRATAGRYLHLEMPERVA
FT                   GRPLPAVEVVDMREELNRGNFTPFSATLQRAVAEMHGAGRQGILFINRRGYSTFVLCRN
FT                   CGETLRCPHCAVSLTYHRLEAGDHLRCHYCNHGAPQPRACPHCTSPNLRYFGAGTQRIA
FT                   AQLSEQFPTLRVLRFDRDTTARKDAHRQILEQFGRGEADVLVGTQMLTKGLDLPQVTLV
FT                   GILAADGLLNLPDFRASERAFQLLTQVAGRAGRGSEPGRVILQTYAPEHPVVEAASTHD
FT                   FRRYAAAELTQRRALGYPPFVQLVALQLSAAEQQSVVESAEALARRLDGSADFEGRLLG
FT                   PAPCTVERVAGRYRWQLLIKNPNGEAGRASLRALLTQFVPCAGVTVAVDVDPLRLL"
FT   CDS_pept        complement(26350..26910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0026"
FT                   /note="ORF_ID:gll0026"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87967"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87967"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPM9"
FT                   /protein_id="BAC87967.1"
FT                   /translation="MSAPVLTTATAIEERAGLGADDGIDWAGLGAPYTRLERSFVARSI
FT                   GGMAVQVQVAGHKAPPLVLESCPANHTNFVLGEMVLFTGLEQNPGPIVLVLSEPVWGAG
FT                   AQIQPDYPGAFTGVLEAFDDQDRPVASVRRAGLSTTACDGSAIFVGFHCLQVPVVRLVF
FT                   AVEAAGGPYALAVNRLDLRHTRA"
FT   CDS_pept        complement(26907..27989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0027"
FT                   /note="ORF_ID:gll0027"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87968"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87968"
FT                   /db_xref="GOA:Q7NPM8"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPM8"
FT                   /protein_id="BAC87968.1"
FT                   /translation="MRGALCCERCGFCLTVKGSCAVLNNFWYGLAHSPAITSIPRQVVV
FT                   MGRPLVLYRTVGGRVVALEDRCAHRDTALSGGWVEGNCLRCPYHGWRYAPDGGCTEIPA
FT                   NQPGVAISRLAKVETFPVQERHGLVWVFLGELPEAQRPELPSLPEYAAPGWRAVRGEFT
FT                   WSGHYTRVIANTVDMSHAPFVHAAAFGRKEAPRIQTYHIESERWRGSASIQFKTKPAYF
FT                   LKLVLGKTPPDGSITSTFHLPNVTQVHHRFGRIQFILFLVHVPVDERTTHTCWLHLRNF
FT                   VTHAWADPFMHRDVVRTFRQDDSVVRLQPPGPVPEQLNAEVHAPSDGLEVAYRRLRRLC
FT                   GRLEWASPTQNPRITEGASP"
FT   CDS_pept        28214..28672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0028"
FT                   /note="ORF_ID:glr0028"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87969"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87969"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPM7"
FT                   /protein_id="BAC87969.1"
FT                   /translation="MVEIFEQQIRIAASLGAAERCLSDPGLMRRWLNPLLECRSVGEWS
FT                   TAVGSRFRFYLRLPPVYPHLECEVVERALGLVQWQFTGFFEGTDRWEATGPDGAVLLVN
FT                   RFCFDIPNPVVRFGFALFAQALTRADMHAQLQRLKAVAESLEAPGGLS"
FT   CDS_pept        28697..29236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0029"
FT                   /note="ORF_ID:glr0029"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87970"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87970"
FT                   /db_xref="GOA:Q7NPM6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPM6"
FT                   /protein_id="BAC87970.1"
FT                   /translation="MTADTRLFNQRFAKNFLPLPGFSVPAVGEAAPDFVLPRVGGAPVR
FT                   LSDYRGRMPVVIAFTRIFTEKLFCPFCYPHLQDLKNRYGEIRQAGAELLMVTSTDPVQS
FT                   AQVVADLALPYPFLFDPGCTLFQAYGAGQALGAPLPAQYIVDMTGTIVYRHLFSFIDSN
FT                   ASTDEVLAVLKALQKV"
FT   CDS_pept        complement(29214..29906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /note="ORF_ID:gll0030"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87971"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87971"
FT                   /db_xref="GOA:Q7NPM5"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NPM5"
FT                   /protein_id="BAC87971.1"
FT                   /translation="MDLDILKQTAARRAVELVEDGMVVGLGTGSTAAFAVSVLAERVRL
FT                   GLRVVGIPTSERTARQAEAEGIVLGTLAEQSRVDLTIDGADEVALGELALIKGLGGALL
FT                   REKIVAAASERLIIIVDATKLVEQLGSHGPLPVEVAPFGWQATARALERLGAEVNLRAQ
FT                   HGQAFLTDGGHYILDCRFGPIARPAELEAAIDRIPGVVESGLFVGMASAVIVADEGGIE
FT                   VLTPSAAP"
FT   CDS_pept        complement(29929..30165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0031"
FT                   /note="ORF_ID:gsl0031"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87972"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87972"
FT                   /db_xref="GOA:Q7NPM4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPM4"
FT                   /protein_id="BAC87972.1"
FT                   /translation="MNDKARSFLIRLTQDPFLAQRFRQDPEQRRAMLEAADFDASTREA
FT                   LESRDEGRIAKILGVSGLPAMMIVAIIVPNGPF"
FT   CDS_pept        complement(30219..31022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0032"
FT                   /note="ORF_ID:gll0032"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87973"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87973"
FT                   /db_xref="GOA:Q7NPM3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPM3"
FT                   /protein_id="BAC87973.1"
FT                   /translation="MSGSLIVVGTGIRAGHLSQEAISAVRTADAVAYCIAEPLTRLLVD
FT                   ELRKEAAKPVAEDLHRFYADGKPRTQTYHQMVARILELVRLDLQVAAVFYGHPGVFAYP
FT                   SHESIRQARAEGYPAEMLPGISAVDCLFADLGVDPATAGCQMLEATDFLLRRRHLDTAC
FT                   GVVLWQIGCVGHGDYQGSGYDLRYIPMLVEALLAFYPPEHEVVVYQAAHFAMCDPIVEC
FT                   VAIAEMLKASITAVSTLYIPPLLVPAIDSQVLKKFDIATFRGTEG"
FT   CDS_pept        31169..33247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0033"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /note="ORF_ID:glr0033"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87974"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87974"
FT                   /db_xref="GOA:Q7NPM2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPM2"
FT                   /protein_id="BAC87974.1"
FT                   /translation="MREALALSTAQICINNYQNFAVDPLLRRQPPVQVLRVLSSAELEA
FT                   CFSRSPWKFVAAVPIFCNGTLAGNLWICDEQERLLSAAQSALLEHAAGLVGERLEAEER
FT                   LDEIHQRNLMYEKYIEMAPDQIGLLDSELRTLTVNAALSRFSGMPKEWILGKSLWEMGI
FT                   PESILAQMADWEQLIRRVFETGEPGTTSFAYSVGDASCKLYCYSLAVPQFNCRGEVVAV
FT                   LNITYDRAALEMPFNPEDWAGMGEQLMREVAAHRVTQEELARLNAELEERVRERTVRYK
FT                   LLNQKLRAEIGERQRIEVELQAAQARAEAAARAKSDFLAAASHELRTPMHGIISMTDLL
FT                   LESDLGAEQRELAAIIGYCGETMLSLINNILDISKIEAGRMELDVVPFELPRLIDSVVA
FT                   MFAEQLRSKDLRLQVLIDPEVPAQLEGDPVRLAQVLTNLVGNSLKFTPRGQIAIRVHPA
FT                   AQGGDDLRLRFEVVDTGIGMAPETTGRLFQSFFQADTSTTRKYGGTGLGLAISRQLVEL
FT                   MGGQIGVESRLEQGSTFWFVLPLKVSAPVEPPPPSAPMTVRLPQYGPILIVEDNAVNQK
FT                   VLLRHLERLGCGAEVAETGAEALTVLASRSFALVLMDCQMPVMDGFQATAEIRRREDSA
FT                   RRTPIVGITANASAGVYDLCLAAGMDDCLIKPVRRDQLTAAIERWALPVVGTEWATG"
FT   CDS_pept        complement(33259..35388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0034"
FT                   /note="ORF_ID:gll0034"
FT                   /note="similar to replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87975"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87975"
FT                   /db_xref="GOA:Q7NPM1"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPM1"
FT                   /protein_id="BAC87975.1"
FT                   /translation="MTSSELDLRIEERLPPQNIDAEETILGGLMMDPEALTRVVEHLRP
FT                   EAFYVESHQIIYRAALALHAQGRPTDLLTLSAWLEDNKLTEKIGGRTYLRRLTDAAINT
FT                   INIDGYGRLVSDKYALRMLIRAGQEIAALGFDSATEIPKLLDRAEQTLFAVTQERVQRS
FT                   LVPASEVLMNIFEQLETRYQDGSNVFGIPTHFYDLDNYTQGLQPSDLIIVAGRPGMGKC
FT                   CAADTPIADPVTGALVTIEEIYRRGEAGKLVEVLTLLGDGRLARVEPSHFVDDGIKPVY
FT                   RVRTGLGREVKTTLTHPYLTPTGWKPLAEIAAGARIAVPCRIPVFGSESLPPKEISLLC
FT                   SRATRDNRIPDPVFRLPRAQLVAFLKQLCITADSARVSDRTVEFTSPSKSFCHQLQHLL
FT                   LRLGVLSALREVSGIFYLDIKPAAETPIKPASLWSQDLAHHCDLHWDEIASIEYVGNEQ
FT                   VYDLTVPVTHNFVAADICLHNTAFSLSIAQRIAQKAGLPAVVFSLEMSKEQLVQRLLCS
FT                   EAGVESHRLRAARISENEWQRIGQAIGELASIPLYIDDSPNATVTEIRSKARRLQAEQG
FT                   GRLGLVMIDYLQLMEGAGSDNRVQELSKITRGLKGLARELRVPVMALSQLSRSVEARTN
FT                   KRPMLSDLRESGSIEQDADIVLMLYRDDYYNPDSPDRNIAEVNIVKHRNGPTGTVKLLF
FT                   ENQFTRFLNLTSGNH"
FT   CDS_pept        35538..36401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0035"
FT                   /product="L-asparaginase"
FT                   /note="ORF_ID:glr0035"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87976"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87976"
FT                   /db_xref="GOA:Q7NPM0"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPM0"
FT                   /protein_id="BAC87976.1"
FT                   /translation="MPRPGLIIHGGLGATEAEQSSRQVRREALQEILKDAHEVLKNGGA
FT                   RQAVVRACELLEDCPLFNAGTGATIQRDGQIRLSCALMDGREHRFSGLVNARYLKNPIR
FT                   LAEQLQNRVDRLLDPQGAELLARALGEAVHEPALPEVIRRWADERFEGQYAGTHGTVGA
FT                   AAVDGEGGLAAATSTGGRFMAGVGRVSDSCTPAGNYATDRCAVSCTGHGEDILDEALAA
FT                   RIAIRVDDGMSLQRAFERSFAEAESRGRDFAAIAVDSDGHTCWSVTMGILVAAYFDGKG
FT                   EFRATF"
FT   CDS_pept        complement(36493..37110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0036"
FT                   /note="ORF_ID:gll0036"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87977"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87977"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPL9"
FT                   /protein_id="BAC87977.1"
FT                   /translation="MTSASPSSGRSKMVDFERVLVTSRAEWRGWLTDNHTRTKSIWLVT
FT                   YKKRSGMPHVPYDVVVEEALCFGWIDSRPGKLDERRSMLLLSPRRSGSPWSKINKARVE
FT                   RLIEQGLMTAVGMQKIEQAQADSSWSVLDGVESLVIPSDLAAALAENSQAAVYFAAFSP
FT                   SSKKGILQWIQSAKREETRRKRIAETIELAANNIKANFPRKA"
FT   CDS_pept        complement(37107..38303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0037"
FT                   /note="ORF_ID:gll0037"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87978"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87978"
FT                   /db_xref="GOA:Q7NPL8"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPL8"
FT                   /protein_id="BAC87978.1"
FT                   /translation="MGCAPSLKPGRELTMFRILLLIALLALPPGAALAAEAGDIDGDGR
FT                   VDAGDIQAIDAYLEGAVVLQDSQIASADADGDGKITRRDRDLLKRRVDGVALKGEARVG
FT                   DGGGGKIDLTSADSGVVTDKETGRPLAGVDVSLPDEGITVRTDSEGRFKLPKATGGKIL
FT                   TAKANNYAPFSLSAATGSPGGGFNLELERLSPRLQVIDDELHHLGDDRFGSGSANATDF
FT                   RLRAEGIAYVRTFTLKNQPTGDMILRIGSVIGLDTPQSAAAGQTQVAFFGTEQDGLRVY
FT                   LNGNMIKQIYINGDNIPVKLPRWLLNSGKNELRIETHAFNQPAFMSAGGLAGLLGAFGI
FT                   GGMGMMAGAGIVDHDDLEFAHLVLEDSAGRPQEFSSRGRVYGGETPRGGEVYTPQVRP"
FT   CDS_pept        complement(38379..38750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0038"
FT                   /note="ORF_ID:gll0038"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87979"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87979"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPL7"
FT                   /protein_id="BAC87979.1"
FT                   /translation="MDHSPDFMKLVADAKTRVRECKIAEVRERQARGENFHLVDVREDS
FT                   EWQAGHIPGARHIGKGVIERDIEQAIPERAAPIVLYCGGGYRSALAADSLQKMGYTAVV
FT                   SMDGGMRGWREAGYAEQRP"
FT   CDS_pept        complement(38784..39467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0039"
FT                   /note="ORF_ID:gll0039"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87980"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87980"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPL6"
FT                   /protein_id="BAC87980.1"
FT                   /translation="MSVVPNPPRRNTIEIANDAAAPFDPQRWIATMSGGLTAALGDSAQ
FT                   ILVASDLTWFPLADDPAVRIVPDLFVVFGRPAGSRGAYYQWQEDHIAPQVVFELVSPVE
FT                   SLTQAAKEFAFYDRHGVEEYYLYDPLKEDICGWLRYENRLEVIDPVQGWLSPRLGLRFE
FT                   ITREGLTLLLPGGAPIAAEAQREHERALALQQLEEERQRANLERLRAERLAEQLRTLGI
FT                   DPDKL"
FT   CDS_pept        39755..39943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0040"
FT                   /note="ORF_ID:gsr0040"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87981"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87981"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NPL5"
FT                   /protein_id="BAC87981.1"
FT                   /translation="MGIDKRAEATAKDVQGKAQEAWGDLTDDPKLELEGKAKQVEASAE
FT                   HKKEDLKDQAHRTIDNV"
FT   CDS_pept        40091..42412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /product="single-strand-DNA-specific exonuclease"
FT                   /note="ORF_ID:glr0041"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87982"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87982"
FT                   /db_xref="GOA:Q7NPL4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPL4"
FT                   /protein_id="BAC87982.1"
FT                   /translation="MPIGLSSMLPKQRWRIAQEDPVQARQLAEAFGLSPLIAQVLINRG
FT                   LTTCELAEHFLAPESWVLPSAGEAFDQLPRALDLLAQAIESGTAIAICGDYDCDGMTST
FT                   ALLLRAVRSLGGHIEYAIPSRLQEGYGINLRIVEAFYERGIGLILTVDNGICAYAPIAR
FT                   AVELGMGVIITDHHDLPERLPPADAILNPKMIPRTSPYAALAGVGVAYVLAGELARRLG
FT                   RTGLADCLLELFTLGTVADLAPLVGVNRAWVLSGLAKIPGSSNTGVQALLAASGLAGRS
FT                   DLKPEAIGFALGPRINAVGRIGDPVTVIELLTTDDPAVAAERAAECELANQHRQALCAQ
FT                   IEAEAARMLEVEQAGGLDLGCERVIVLAREGWHHGVIGIVASRLKDRHGAPVFIAAIEG
FT                   EHARGSARGTPEFHVYEALKDSAELLTGFGGHPMAGGFSLLAANLPAFRERLVQFARAR
FT                   LAPEQVAPLVEVDAQVQLARVDRRLLGEIDRLQPCGLGNAEPVFWVAGARVVEQKAMGK
FT                   TRTHLNLTVSDGTAERRAVGWRMAEWLPLPPFVDIAFQVKENNWQGHSKVELELVGLRA
FT                   AHPAPIELPEPPPLDRPIRWHDHRHCEAAAFLHAFVAAQASPVLLYGHARPQLPRGLPV
FT                   HYDRPQPAHDYEHLLLWSLPPSPLHLRWLIAATRPNCVHLFAQAVPTAHAWTLQRHLRA
FT                   TYLPERPVEILRLAQLWWVSPRALCEALVEAGYLADWRSVVADEWHDWLGAELAGLAAW
FT                   YASPVEVLEALLAPQPTLKR"
FT   CDS_pept        complement(42391..42669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0042"
FT                   /note="ORF_ID:gsl0042"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87983"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87983"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPL3"
FT                   /protein_id="BAC87983.1"
FT                   /translation="MHRCSGCGSGLNGVEVRWSIAVLLKNKTTDSLVEINDIAQLVNPV
FT                   AERVKAQNQAGEEEQNPEMFAKADLVFPSGEALPRCWIDADYRLSVG"
FT   CDS_pept        43042..44337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /product="adenylosuccinate lyase"
FT                   /note="ORF_ID:glr0043"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87984"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87984"
FT                   /db_xref="GOA:Q7NPL2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPL2"
FT                   /protein_id="BAC87984.1"
FT                   /translation="MIERYTLPEMGALWTEEQKYRNWLKVELAACEAMVELGEIPQGAW
FT                   QEIRTKAGFDVGRIAELEAEVRHDVIAFLTSVNEHVGPAGRFIHLGLTSSDVLDTALAL
FT                   QLVQTLDVLALRLEELIAATRAKAREHRDTVMIGRTHGIHAEPITFGFKLAGWLAELAR
FT                   HAERLRALRPRLAAGKLSGAVGTYANLDPRVEARACELLGLVPDTASTQVISRDRHAEF
FT                   VQALALTAGSIERFAVEIRNLQRTDVLEVEEYFAAGQKGSSAMPHKRNPIASEQLTGLA
FT                   RIVRSNATAALENMALWHERDISHSSVERVILPDSAILVHYMLVKFTALVEKLAVYPEN
FT                   MARNLHRYGGVVFSQRVLLALVAKGLTREEAYRIVQTNAHKAWNREGGDFRALIEADPE
FT                   VQILLAPAELAACFEPRHHLKHLDTIFARLEI"
FT   mobile_element  44336..44381
FT                   /mobile_element_type="insertion sequence:ISGL3f"
FT   CDS_pept        complement(44494..44904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0044"
FT                   /note="ORF_ID:gll0044"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87985"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87985"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPL1"
FT                   /protein_id="BAC87985.1"
FT                   /translation="MPQQLLSRATLGERRPQMVYLAAHRDWPLSVGTTSQVVPRTGIAV
FT                   VQTDSWALTVWLIEAINAILDGKDFHTRRPPGKIQRSGRFEVIEGNLFVWGWPWSWSRS
FT                   SIQVARHVPTALGEKLNLLCGATAARSAEYPG"
FT   CDS_pept        45175..45621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0045"
FT                   /note="ORF_ID:glr0045"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87986"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87986"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPL0"
FT                   /protein_id="BAC87986.1"
FT                   /translation="MKRLLYENSVSHRGFLIVPFRYGAMVGKEIYSYWLLSALAYRSRW
FT                   HRTENPAGLYSSTLTGIVEIAHEHLDRHGDTPIADDHFARRYVYCDNLIVVCRIGDRIF
FT                   YDHYLPGGLDNIAAPKLFASETQCLAWIKAGIDRLQVKTGQDSF"
FT   CDS_pept        complement(45641..47422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0046"
FT                   /note="ORF_ID:gll0046"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87987"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87987"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPK9"
FT                   /protein_id="BAC87987.1"
FT                   /translation="MHLIKSVRLAAIALAWAGGSALCWNGPLRAEPIVNATPAQLVVND
FT                   VLGGTASTPQTVTIANGGSTGLSIQSLTIVTIDGTPGQFQIASQPTLPATVAPGTSVSV
FT                   GIVFNPTAAGPAIARLDIATDAPATPTASMSLQGLGTKGIGGNLEPSLQWIFDTYLIAV
FT                   DVGDPDPAETDLAGSVPLGGEMSIQRFLKAGSGPVTVEPLAVFAPQSNSGLVFRVGHHP
FT                   SGNPAAKSELFTVADANHQTLAPPVTGKREFDPGVGSFGFYAILPFQGNREVFLEDGLN
FT                   TFTDALPHHMRVYPLKKSDGTVELNAFVVALEGITTSFDFQDLVFVVRNARPIPPAHFS
FT                   GGGLSNLLWRNGQTGANTLWTVQSDTLGSAASFSAQAIALPAVGDPNWKIVGTGDFNFD
FT                   TKADILWRNTATGANTVWLMNGTVLASTVALPAVGDLGWHIGGTGDFDFDGSADILWRN
FT                   HSTGANTVWLMNRTTFIASVPLPAVGDLAWQIGGTGDFDFDGRTDVLWRNTVTGVNSLW
FT                   LMDQTTLKNTAALPAVGLDWQIGGVGDYDADNRPDILWRNTATGANAVWLMNDTVLGVS
FT                   ATLPPVADSKWQIRGPR"
FT   CDS_pept        complement(47532..49289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0047"
FT                   /note="ORF_ID:gll0047"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87988"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87988"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPK8"
FT                   /protein_id="BAC87988.1"
FT                   /translation="MLRNLPAIVPLAVLALNLAPASPVAAQANVAFGSTRVVTNDIIGG
FT                   APGTPRNVTITNNGNAALNLSGLTLTGVSGGEETQFQLTPAQPLPLVLTPGASTTVGVV
FT                   FNPTVAGPVIARLGLTSDAANNASVSVSLQGLGTLGIGTGKEPSLQWVLDTYLIPVNVG
FT                   DTNPATDALPATVPLGEEISPPQFRKASSSPVTVEALAVFSGQGAPGYVVSLGYYTAGN
FT                   PNAKTQLFTVPNANYQSLAPATTGTLSFDPGNNSFGLYSVWPFLSNRTVYSEERLNTFS
FT                   GAIPHQTRIYPLKKSDGTREPNAYVVSIEETTINFDFQDLVLIVRNVKPVPPGDFYGNV
FT                   GKSDILLRNPVTGENTVWQMNDAAFLEAFPVAPVGDANWEIVGTPDLNFDGKVDILWRN
FT                   KATGANSVWLMNGTAFVSSVVLASVGDLNWQIAGTGDLNFDGKVDILWRNKVTGANSVW
FT                   LMNGSAFVSSVALPAVADLGWQIVGAGDFTGDSRPDILWRNQTTGANTVWRMSGTTFGA
FT                   AVAIASVSDPGWLIGGVGDYNSDNKPDILWHNQTTGVNSIWRMNGTTLSSSVAIPALED
FT                   LNWQIRGPR"
FT   CDS_pept        49484..49807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0048"
FT                   /note="ORF_ID:glr0048"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87989"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87989"
FT                   /db_xref="GOA:Q7NPK7"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPK7"
FT                   /protein_id="BAC87989.1"
FT                   /translation="MASEVRPSLPTSPTGTTHTHDPVHTKVLLDRLARIEGHVRGIGNM
FT                   VREDRPCPDVLVQISAVRAALNQVAKLVLKEHLSDCVVHAVENGGAHEEIQALNQAIDR
FT                   YID"
FT   CDS_pept        complement(49883..50044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0049"
FT                   /note="ORF_ID:gsl0049"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87990"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87990"
FT                   /db_xref="GOA:Q7NPK6"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPK6"
FT                   /protein_id="BAC87990.1"
FT                   /translation="MLLYLSLIGVGFAACVVIGSVAWYASKRPVGWEGAETPGWVKKLG
FT                   ADKLRTQG"
FT   CDS_pept        50393..51367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0050"
FT                   /note="ORF_ID:glr0050"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87991"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87991"
FT                   /db_xref="GOA:Q7NPK5"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR015233"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036917"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPK5"
FT                   /protein_id="BAC87991.1"
FT                   /translation="MAFTLESAQAIFAETGKPSPIPGILADFNRLSLEDRLALLWYAYT
FT                   ETGRTITRAALGAASMALVEGMLDQIKQMPPAEQTRVMFDLARRADTPISRSYGYFSVN
FT                   TKLGFWYQLAEWMAQGTVAPIPANYQMSTDAQLLFESIKNLDGGQQIQVLRDIVLNMGF
FT                   DPSVVPDEAPEAEDFQFERTEPVSTERIDVKGVDDPTPLRYFEAMNSDNFEAAVALFEP
FT                   EGALQPPFQKPIVGREAIAAYMREEAQGLTMKPIEGITEVLPDGSKKLKVTGKVQTPWF
FT                   GVNVAMNIAWRFALNPKGEIFFVAIDMLASPEELVNLRPPSYR"
FT   CDS_pept        complement(51413..52609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0051"
FT                   /product="Na+ ABC transporter permease protein"
FT                   /note="ORF_ID:gll0051"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87992"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87992"
FT                   /db_xref="GOA:Q7NPK4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPK4"
FT                   /protein_id="BAC87992.1"
FT                   /translation="MKPSARRQDALDRIGVVFCKEVIDNLRDRRTLLTALLTPLTGPLI
FT                   LAATVILAGQVISQEAEKPVTLPVAGTQNAPQLVAFLESQPGVEVRPLVAVDEAQVRSG
FT                   QYDFALVIPPEFGREWRAGRPAAVRLIVDTGRRQTSGALARVRALLAAYSRQIASLRLL
FT                   ARGINPAIQQAVAVESVDVASSEGRAAFILGLMPFYLMFAAFIGGFYVAIDTTTGERER
FT                   GSLEPLVINPVARWELIVGKLAATLLFALVVVAETLVGLAAVLAVVPLEQFGLRYSFNP
FT                   SMFVGLFLLCLPVVLLAGAVLTILASYARSFKEAQNYLTPIILVPTFPSLLVALLPLKA
FT                   EGWAAFVPIYSQLLLMSQIIKGEAVNGGFAAVSSLFTLVVGGVLVWLATRIFDRESVV"
FT   CDS_pept        complement(52606..53340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0052"
FT                   /product="Na+ ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:gll0052"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87993"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87993"
FT                   /db_xref="GOA:Q7NPK3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPK3"
FT                   /protein_id="BAC87993.1"
FT                   /translation="MIEAREIYKSFGAVAAVRGVSFTAPDGQITGLLGPNGAGKTTLLR
FT                   ILATVFKPDGGSALVDGFAAASSPREVQSRIGVLPDNRGLYARLTARENVRYYGRLHGL
FT                   KGDALEGRIDELAGLLEMGEFIERRTEGFSQGQRLKVAIARALVHAPGNLLLDEPTNGL
FT                   DVMSTRALRQILRRLRDEGCCVLFSSHVMQEIASLCDRIVIIADGAVAAEGTAEQLLAA
FT                   TGKASLEDAFVAVIGSEEGLLL"
FT   CDS_pept        complement(53346..54809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0053"
FT                   /note="ORF_ID:gll0053"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87994"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87994"
FT                   /db_xref="GOA:Q7NPK2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPK2"
FT                   /protein_id="BAC87994.1"
FT                   /translation="MALVSWRFASAVLLGMVPLAGCSGPPGKRTEANIQLSDCRLAAPA
FT                   QAERVEARCGRLGVYEDRAARSGRQIALHLAVLPATGRQVDSDPLFMLAGGPGQAATEA
FT                   FVPLIKAFERVNRRRDIVLIDQRGTGRSNPLDCPIDPNTATPERALASAADCAKSLQAN
FT                   LKLYTTAIAADDLDAVRSALGYGRINLYGGSYGTRLALAYLRRHPERVRTAVLDGVNPP
FT                   DTSLGETVAADAQRVLEIAFARCRADNACNKAFPSLGSKFKALLARLDREPLTVTVADP
FT                   TSGLPRSVKLDRTVLALTIQSLSYAPETVSLLPLLIHTAHQSGDWRPLAAQLQLTVGNI
FT                   GDQVSLGMRLSVLCAEDIPFISSKEAGRTYLGNAWVQALRETCSVWPRGAIPADFKRPV
FT                   TSNVPVLLLSGEADPITPPRNAERARRTLPNALALVVPGAGHITAFRGCTPRIVADFLA
FT                   AGRARGLDTACLKKNRALPFFVDPSGPEA"
FT   CDS_pept        complement(54893..55915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0054"
FT                   /product="serine/threonine kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="ORF_ID:gll0054"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87995"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87995"
FT                   /db_xref="GOA:Q7NPK1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPK1"
FT                   /protein_id="BAC87995.1"
FT                   /translation="MASESLQGFAIGRVVGGRYRLLGRLDGGSMGSVYEAADTKLAGKV
FT                   VALKVMHRSLAGDTEVVKLLRQRFEEEARLSAILGSHPRIIQVTDYGVEGPQPYLVMEL
FT                   LKGRSLKEVLAQGPMPPGRAVRLAVQLCDGLQHAHAAQATVEGRTIRGIIHRDIKPGNL
FT                   FLIEDESLGETVKILDFGIAKANSDISLALGTQAGFVGTSGYASPEQLRGEALDARSDI
FT                   YSLGVVLYQMLTGQMPLKPKTETFAGWYHAHNYTTPTGFQAHRLPYMLPPALAAVVLSC
FT                   LEKDPANRPQSMQMLGMQLQWAMGWFPREETSQPLLPRDVFIGGAIALLALVGFLFLLS
FT                   "
FT   CDS_pept        complement(55984..57918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0055"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="ORF_ID:gll0055"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87996"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87996"
FT                   /db_xref="GOA:Q7NPK0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPK0"
FT                   /protein_id="BAC87996.1"
FT                   /translation="MGIWQNDVIAVDITNASALNFSKNLQRWFSEFRIQTRLLAAAALI
FT                   ISLVLASFTFWALNYIQEDARRSDQRFGEAVGNLLAATAAPLIALDQYPQLGEFTEEFL
FT                   ASNADNILYVLYADSKGDILYGSPFNTNDTRANAPVPALIRHIELPPVLPAKRQHRTPR
FT                   GLVTDIFVPIEYGERQLGVVLVGINPEANLVSRSDLTRDVTVAVFVLVWIIAILGSVFN
FT                   ALTITQPLKELVQGVQRIAQGNFKQRVTLAYPGEIGELITSFNLMAQRLQSYEEQNIEE
FT                   ITAEKAKLETFIATIADGGILLDSSLRILLVNPAMLRIFGWGSRVVGKNILDLLPVGMR
FT                   AEVEEPLDSVSRNILEQAECRVVLDKRTLRVLISPVLAPRGDNLLKGVVLTVQDLSKEA
FT                   ELNQAKSQFISNVSHELRTPLSSIKSYIETVYEFGDSLDDSTKNEFLKTANQETDRLTR
FT                   LVNDVLDLSRLESGREYHFEPVDLVQPIEQTLRTHRLTARDREIELVSDIATDLPLVLG
FT                   NYDLLQQVFSNLVGNALKFTEPGGRVTLSARRTDDPAKVRVAVTDTGIGISEEDQRRIF
FT                   ERFFRVENRVHTLEGTGLGLSIVDNIVKKHNAQVHIESEVGQGSTFWFDVEAYMETCEW
FT                   PRREQEEVI"
FT   CDS_pept        57986..59155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0056"
FT                   /note="ORF_ID:glr0056"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87997"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87997"
FT                   /db_xref="GOA:Q7NPJ9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPJ9"
FT                   /protein_id="BAC87997.1"
FT                   /translation="MSIVRRRLLLLGGFSLGAVGVGVAAARLWPAGGARPTTTPGADNA
FT                   QAALPRPVGPQGMFAPPRGDVRLVVISDLNSYYGSVEYEPQVTRAIALIPGWKPDIVLC
FT                   GGDLVAGQSPSLKRERLLAMWAAYDRLIGAPLRKARLPFGFTVGNHDASCERAIRGNYL
FT                   YKLERDVTAGYWRDPAHDSGLAFIDRGEFPFYYTFAANDIFYLVWDASCARIPAEQLAW
FT                   AEKALASAPAQNAKLRVAIGHLPLYAVAVGRDEPGEILDNAEKLRMLLERYRVHTYISG
FT                   HHHSYYPAYRGQLQLLHAGALGSGPRPLIDGNLRPWHPLTVIDIDMATLATTYTTYDME
FT                   TLKVFDIARLPRMLSGPTGAVFRRDVRWEDLSAAERKRCLDQLGEKGCR"
FT   CDS_pept        59206..59895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0057"
FT                   /note="ORF_ID:glr0057"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87998"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87998"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPJ8"
FT                   /protein_id="BAC87998.1"
FT                   /translation="MRVRHQSRVFIPNLAMLPPPQRSLWPELGATPEAFALYGGTALAL
FT                   HLGHRTSVDFDFFCNVPFDPDQLAYALPYLKGAERVQLAPNTLTCRVERGGPVLVSFFG
FT                   GLGLGQVALHEQVQAMPLQVASLLDIAGTKVAVVQKRAEIKDYLDIDALLQHGIDLPTA
FT                   LAAGAVVYGRSFNPLIALKALSYFDDLPTLPAAVRARLSAAVTAVNVNQLPVLTPYIER
FT                   PNQEFRR"
FT   CDS_pept        60314..61408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0058"
FT                   /note="ORF_ID:glr0058"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC87999"
FT                   /db_xref="EnsemblGenomes-Tr:BAC87999"
FT                   /db_xref="GOA:Q7NPJ7"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPJ7"
FT                   /protein_id="BAC87999.1"
FT                   /translation="MRVRHRSQVLFITAASLLLLAQSLPAASGDVNSDGRVDDLDIRIV
FT                   EQYLRGDLLLQNDQIKAADADGDGKVTRNDRDLLKRRLEGITVKSGPASQLELQSVSGG
FT                   VVLDKATGKPLAGVEVSLPDEGITVRTDAQGRFKLARAPAGKILTAKASSYAPQSITLA
FT                   RGGSGGYRLLLEQLNPQLMVVDDNLYHLGNDDFDPNSAGALQFNLRSIGGRFEKTFELT
FT                   SFPREDLTLRIGSLIGLDTPESVAAGQSGLTDRILPRGGLRIFLNGSAIERLVLNGDDL
FT                   EVKLPRWLLQRGTNRLMLSVDPYDQNNISISKPVTGLYGTATRSSFDLDDIEFAHLVIV
FT                   DPTGSLVDGKLEGELGKKPSPPGP"
FT   CDS_pept        61425..62516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0059"
FT                   /note="ORF_ID:glr0059"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88000"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88000"
FT                   /db_xref="GOA:Q7NPJ6"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPJ6"
FT                   /protein_id="BAC88000.1"
FT                   /translation="MRRIVFLFVCLGVWTAGAAARAASGDVNGDGRVDAGDIRLIDEYL
FT                   GGTRLLQDEQIKAADADGDGQITATDREMLDRRVSGLAAGSAAPGRSASRGQVDLTSAD
FT                   GGVVVDKATGRPLAGVEVSLPDEKITVRTDAQGRFRLPGTASGKILSARAENYVPSSVT
FT                   TRGQRGFQLQLERLNPRVQVLDDELVHLGDNNYDRRSAGARQFQAPAAGTRYTRTFALG
FT                   RLPGQDLQLRIGSLIGIDTEESIAAGQSNLPAAGRREQRAGGVKVRLNGRIIGELLLGG
FT                   DDIAIALPRQLLRPGANEIALEAALINRSGVVIEPDSFLGKMRGLGLGDMALSPDSLDY
FT                   DDIEFTHLVIVDPSGKALERREP"
FT   CDS_pept        62566..63699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0060"
FT                   /note="ORF_ID:glr0060"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88001"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88001"
FT                   /db_xref="GOA:Q7NPJ5"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPJ5"
FT                   /protein_id="BAC88001.1"
FT                   /translation="MIRVLCLVGLALLAAAPAWAESGDVNGDGRVDAGDIRLIDEYLEG
FT                   SLLLQDEQIKAADADGDGKITATDREMLDRRLSGLAVAPAPAGRSASAAKNQRTAPPDT
FT                   SGASIDLNSADSGVVVDKTTGRPLAGVEVSLPDEGVTVRTDSQGRFQLPKSSAGKILTA
FT                   KASNYAPTAMASRGGGGFQLKLERLSPRLQVVDDGLVHLGDNSFGPGSANYAEFRQPAQ
FT                   GRSYTKTFALDRLPQRDMILRIGSLIGLDTPESVAAGQSQLPLYGTSSDGLRVYLNGSL
FT                   IKQIFVNGDNLPVTIPRWLLVRGNNELRLETHPVGGNRGGAVMSSRGFGGMLGGLFGFG
FT                   GSMRFPVDSTPDYDDIEFAHLVLEDPSSNERPSRVEF"
FT   CDS_pept        complement(63740..64879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0061"
FT                   /note="ORF_ID:gll0061"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88002"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88002"
FT                   /db_xref="GOA:Q7NPJ4"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPJ4"
FT                   /protein_id="BAC88002.1"
FT                   /translation="MGVSKIRRGGVAVALSMVLLACQGVPLLAASVQQLEQTVSGSGLV
FT                   GSQFTLKRDKAKLNIQSEQIFPNRDELKLALIQLASLLEGADPAIKTVTLRAYLLGSPT
FT                   PLEGSIAPSAATQLQRSGDPEMLEKIRLASVAVPAGKKPGKLIAASKPTSEEPGGIPVL
FT                   GDPIDPPAGKGNLPVLGEPLYPGQAVADPATGGGPSDSERPFRTGVSVLRAGSPIPVLL
FT                   EREVVVEGESPVPIQAVVLQDILSDDGELMIPGGSQVRGTVEPTPSGARLTLRELYVND
FT                   RQYTIRAVSQVYPSQTSRSGGNQGTGMMIGGVAGGVGGSLLGRSVDRRWGGLWGGLLGG
FT                   LLGSFLGGSMSQPQTRTTVAIPAGTANPQLLEDLTIGNN"
FT   CDS_pept        complement(64964..65668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0062"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:gll0062"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88003"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88003"
FT                   /db_xref="GOA:Q7NPJ3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPJ3"
FT                   /protein_id="BAC88003.1"
FT                   /translation="MSIRVVVVDDHPDVLLGAAAYLGNCPDIRLVAQAQTIAEALVVIR
FT                   DHQPQVALVDLELPRAAGESAEYLGGLAIGRAIRAGGWPTRLIIMTGHQDRSGLVAAQP
FT                   FVDCKPRVVYDYLLKTATPQERIEAIRQAAQGVGRPLKLDVPKLTPRERIVLRYMALGL
FT                   ENGEIAQKLVVAPSTVASHVKSLMAKILSEPGVEDGQLRRTRTLCVRRALEYGILRPDQ
FT                   INRNHLGRDPVR"
FT   CDS_pept        complement(65718..66386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0063"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="ORF_ID:gll0063"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88004"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88004"
FT                   /db_xref="GOA:Q7NPJ2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPJ2"
FT                   /protein_id="BAC88004.1"
FT                   /translation="MALKIHVPPHPFVTNLLAVCRSEATPTPVFRAAVADLGRWLTYEC
FT                   VRDWLPVLEVGVKTPLDVITAARIVDSSVPVAIVPVLRAGLALLDGVLPLLPAASVYHL
FT                   GYARDERTLEAACYLDRLPPRFAPETRVLVLEPMLATGGTATAVVAKLVERGADPALVR
FT                   IISVICAPPALQRLGLSYPSLAIYTAMIDERLDERGFIVPGLGDAGDRAFGTGHPPGVG
FT                   "
FT   CDS_pept        complement(66396..66827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0064"
FT                   /note="ORF_ID:gll0064"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88005"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88005"
FT                   /db_xref="InterPro:IPR021498"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPJ1"
FT                   /protein_id="BAC88005.1"
FT                   /translation="MWSGRSLSDCKVRFVCRASTAILIPAFLPDLSTHSGDQSLARRKR
FT                   VNPRRLEGKRILDLVPRFGLECCEEKSVTAARRFIEANRIQPPAIVVVHRSERIQERYF
FT                   WGFKGLFSAQYVEENHFTFPSLALLRAQLSGEAQGDSVA"
FT   CDS_pept        complement(66796..67233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0065"
FT                   /note="ORF_ID:gll0065"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88006"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88006"
FT                   /db_xref="GOA:Q7NPJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPJ0"
FT                   /protein_id="BAC88006.1"
FT                   /translation="MFRKKSSVVPVAVFRRLCARLDEVEQTLDELVSRNERLERQNQAL
FT                   ELQVRRLNLKLSEAPLPPAPVVAESASHRAVAAPATRPLMFTKWTEPVEEEESFPAPRF
FT                   AAEKSALPEGPGWLFWVLTLLVAAAAGVGTFYVVRPLTFGL"
FT   CDS_pept        complement(67312..68277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0066"
FT                   /note="ORF_ID:gll0066"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88007"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88007"
FT                   /db_xref="GOA:Q7NPI9"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPI9"
FT                   /protein_id="BAC88007.1"
FT                   /translation="MPVHLYWGEDAYRRGQAVEQLRAAAVEPAWEAFNFGRYAGEALID
FT                   ALNQAASAPFGGGGRLVWVEEARIFSHCPEGELAELARTLPHLHPNGHLLFTLQGKPDG
FT                   RLKSTKLVAKVGEVREFSLIPPWQEAKLKAQVQQMAQERKVTLSAPALQLLTEAVGNDT
FT                   RRLDNELEKLALFAQGRSVDAEAVGALVATTAHTSFQLAAALLAGEAATALRVLDELLR
FT                   RNEPALRIQAVLVNQFRTWLWVRVLIEAGERDAQAIAAAAEIANPGRVYFLQKEVERTS
FT                   AERLGRVLPILLGLEVALKSGRPERAALESAVLHIVNALR"
FT   CDS_pept        complement(68283..69554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0067"
FT                   /product="carboxyl-terminal processing protease"
FT                   /note="ORF_ID:gll0067"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88008"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88008"
FT                   /db_xref="GOA:Q7NPI8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPI8"
FT                   /protein_id="BAC88008.1"
FT                   /translation="MEANLDKPNDARPVRLRRHAVWAAALASAALAGCSAEVLSSTAGP
FT                   APKEVLTETWTYINNEYVDPKFNGQDWWSVRQTYLEKPAETSEQVYEQIASMLKTLDDP
FT                   YTRFLNPKQFKSLQTTTSGELSGVGLQITLDTESELPVVIAAVEGSPAFRGGVKARDLI
FT                   VEIDGRPTKGQALDDVADRLRGKIGSQVNVGLRRGERTFDVTLTRETIQVNPVTSQLKR
FT                   LDGRPIGYIRLSQFNGNAAQQVRQAIEKLEAQDAAGYILDLRSNPGGLLEAGVEIARYW
FT                   LTPGQTVVYTVNRQGERDQARAQRAPLTARPLVVLIDGGSASASEILAGALQDNRRAQL
FT                   VGTKSFGKGLIQAIHPLKDGSGLAVSIARYQTPSRRDIHKQGIEPDVKVELPKSFSLEQ
FT                   LATDADSQYQAGAKALSRALASSQ"
FT   CDS_pept        complement(69600..69989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0068"
FT                   /note="ORF_ID:gll0068"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88009"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88009"
FT                   /db_xref="GOA:Q7NPI7"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPI7"
FT                   /protein_id="BAC88009.1"
FT                   /translation="MHKMMSFQPQEKLTGVVELEHLQKLCEDDPAFEIELLQTFISDAE
FT                   ERLQQACLAVARGDCLALQQQAHQLSGASASVGAPAILFLARRLESGCCSGGFAEAPEL
FT                   CRRIGEHLEAVRAFAAQRRCSLQPG"
FT   CDS_pept        complement(70061..71170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /product="glutamate 5-kinase"
FT                   /note="ORF_ID:gll0069"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88010"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88010"
FT                   /db_xref="GOA:Q7NPI6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NPI6"
FT                   /protein_id="BAC88010.1"
FT                   /translation="MVALVVKIGTSSLSDPSTGDLRLATLGGLAETLTRLRRAGHRIIL
FT                   VSSGAVGVGCARLGLKERPATVAGKQAAAAVGQGLLMSMYDRLFGALGQPVAQVLLTRQ
FT                   DLMDRVRYLNARETLSELWRLGTVPIVNENDTVATDELRFGDNDALSALVAGLVEAQWL
FT                   VLLTDVAGLYSANPRLDPQARLLSEVTEISEELLQSARGRSLWGSGGMASKLEAARIAA
FT                   SAGVATVITEGNTPQNIERILAGEAIGTRFALARPGGRLSLRKRWIGYGLVPAGALHLD
FT                   EGAVLAVREGGKSLLPAGVRGVEGRFETGALVRLIDGQGLEFARGLVNYSSEELEKIRG
FT                   RKSHEIAALLGIEGQPPTAVHRDNLVTLS"
FT   CDS_pept        complement(71182..71517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0070"
FT                   /note="ORF_ID:gll0070"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88011"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88011"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPI5"
FT                   /protein_id="BAC88011.1"
FT                   /translation="MIPSLTLNFSGGSVAVALPAAAVRSLDAEMQTLLEHLRAASAQTG
FT                   KKTPRPSSEYRYSGEVFLEVFCNPNLWPSPFAARVLVTLKTSQVRLSVEVDLNQLREDI
FT                   QVFLQAV"
FT   CDS_pept        71624..72922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /note="ORF_ID:glr0071"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88012"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88012"
FT                   /db_xref="GOA:Q7NPI4"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NPI4"
FT                   /protein_id="BAC88012.1"
FT                   /translation="MVTSAFQTAQSHRLFAEAQQLMPGGVNSPVRAFKSVGSEPVFIER
FT                   AEGAYLWDVDGNRYIEYINTWGPSIVGHSHPEVISALREALPKGTSYGAPTRLENQMAR
FT                   TVIDAIPAVEMVRFVNSGTEATMSALRLARAFTGREKIIKFEGCYHGHADMLLVQAGSG
FT                   VATLGLPDSPGVPKSTTAATLTAPYNDLAAVEALFKQYPSDVAGLILEPVVGNAGCLVP
FT                   EIGFLEGLRDLTHAHGTVLIFDEVMTGFRLSYGGAQARYGIEPDLTCLGKIIGGGLPVG
FT                   AYAGRREIMQMVAPAGPMYQAGTLSGNPLAMTAGIKTLEILQRPGTYERLEGLSARLAD
FT                   GLLAAAREAGHAATGNRVGAMFTLFFTEGPVRNFADAKRSDLQKFARFHRGMLERGVYL
FT                   APSQFEAGFMSLAHTEEDIDYTVAAARTVLAAL"
FT   CDS_pept        72977..73498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0072"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="ORF_ID:glr0072"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88013"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88013"
FT                   /db_xref="GOA:Q7NPI3"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NPI3"
FT                   /protein_id="BAC88013.1"
FT                   /translation="MSAKNPWFWLAAILAIALDRLTKVWVVAQLAPGESIALWPGVFHL
FT                   TLVKNSGAAFSLFAGGSDWLKWISLLVSVGLCVYALVGPHLGSWEQMGFGLLLGGAVGN
FT                   GFDRFAFGEVTDFLDFRLIQFPVFNGADIAINLGLACLLIGTLRSESRTPAPARPASKQ
FT                   IREPTDTTGG"
FT   CDS_pept        73503..74435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0073"
FT                   /note="ORF_ID:glr0073"
FT                   /note="probable pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88014"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88014"
FT                   /db_xref="GOA:Q7NPI2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPI2"
FT                   /protein_id="BAC88014.1"
FT                   /translation="MSAADATWLTLTVQPDQSAMRLDRWLAEQVADLSRARIQALIDQG
FT                   LVLLNNRPCRPRDLVHSGDAVALTIPAPEPLAIEARPIALDIVYEDEELIVIDKPRGLV
FT                   VHPAPGHSDDTLVNALLAHCRNLSGINGVLRPGIVHRLDKDTTGLLVVAKTDRAHQHLQ
FT                   TQIQAKTARRDYLAIIAGAPAETTGTIDAPIGRHPVHRQKMAVHPKGRPARTHWRVLER
FT                   LGNFTLVEFSLQTGRTHQIRVHCLHKGWPIAGDPLYGSVKVPATLNGQALHAFRLGFEH
FT                   PVTGERLTFESPMPAEMVKLLDALRRRTP"
FT   CDS_pept        complement(74440..75273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0074"
FT                   /note="ORF_ID:gll0074"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88015"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88015"
FT                   /db_xref="InterPro:IPR029074"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPI1"
FT                   /protein_id="BAC88015.1"
FT                   /translation="MHFPHHAADLDSLQALYEQYKQQYAAALETLQRQKQNSLEQIYGA
FT                   ALGLAGCLAVLDNNDRELFQAIDRAALAVTDTLRLAQAPAGQRDAQLYTVSNDVCLYTT
FT                   GSTAFTQARHWIEGFCLAVAARRDIQLETLLEISNELLRQSSTVAPEYAYLTIDALRAF
FT                   SLRQPMQARRAQLALRSALQETQFDLQALQVRTSEVQLLVALLERNGKAFNDAMLKHLE
FT                   AHREYWSAPGRRANPRGWLSIVGVGLATIFFKVGETLAVESHYLPDVLIRARFGG"
FT   CDS_pept        75452..76285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0075"
FT                   /note="ORF_ID:glr0075"
FT                   /note="sugar-non-specific nuclease NucA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88016"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88016"
FT                   /db_xref="GOA:Q7NPI0"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPI0"
FT                   /protein_id="BAC88016.1"
FT                   /translation="MFRNIFLKRTGIVGAVLSALLLLAPKTSNAQTSSVHLTLGNPSGA
FT                   VTSTSYSYNYLLIKSQYALSYSDYDKIPNWVSWQLNSSWLGSASRQNDFRPDSALPSGW
FT                   YRVASDDYTNSGYDRGHMTPSADRTSSTQNNSATFLMTNILPQAPDNNQGPWAELEEYC
FT                   RELVNQGKELYIIAGGDDNDNYFQSNYSGQYISVPSYVWKVIVVLDYPGQGVGGVNTNT
FT                   RVIAVEMPNVQGIRDDDWRWYRVSVDHIEYYTGYNLLSNVSTSIQDVIEAQIDAG"
FT   mobile_element  76410..77715
FT                   /mobile_element_type="insertion sequence:ISGL10a"
FT   CDS_pept        76474..76791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0076"
FT                   /note="ORF_ID:glr0076"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88017"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88017"
FT                   /db_xref="GOA:Q7NPH9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPH9"
FT                   /protein_id="BAC88017.1"
FT                   /translation="MSLPRRRFSRELKLHILAQIEAGQTIAAVAREHQIHPTLITQWRQ
FT                   QLAKYAEEAFSGNGRTYHEEARVAELERMVGQLTMENVLLKKALTRLESRSRPTRPDGN
FT                   K"
FT   CDS_pept        76791..77657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0077"
FT                   /note="ORF_ID:glr0077"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88018"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88018"
FT                   /db_xref="GOA:Q7NPH8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPH8"
FT                   /protein_id="BAC88018.1"
FT                   /translation="MLQLVAEQSDAQGGLSIAQACRTLGLSRAEYYRCKGALQKSDSDM
FT                   EVRVRIQAIALEWPSYGSRRIRFALKRQGLTVNRKRVQRLMREDNLLCLRKQKFVKTTD
FT                   SEHGLTVYPNLSAGLQLSGIDQLWVADLTYIRLSGEFVYLAVILDAFSRRVIGWSLERF
FT                   LDAGLAVLALRMAITSRSFGSELVHHSDRGVQYASKEYTAILKDRGIQISMSRRANPYD
FT                   NAKAESFMKTLKYEEVYMFEYENMTEARNRIGDFLEEVYNQKRLHSSIGYLPPTEFEQR
FT                   LTMPDPA"
FT   mobile_element  77716..77910
FT                   /mobile_element_type="insertion sequence:ISGL2c"
FT   CDS_pept        78023..78409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0078"
FT                   /note="ORF_ID:glr0078"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88019"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88019"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPH7"
FT                   /protein_id="BAC88019.1"
FT                   /translation="MPRRCTSASNTSNRHRRMWEDGAMTAGRMWAAALWMTAWMAAAGG
FT                   ALAAPPYEFPPAEETPEEVLRLEEPGYGNSAVSGERLSLGDYARLQSELQEVQKTEPKI
FT                   SPQLQNLIFLLKIRKFLRTFVPFV"
FT   CDS_pept        78478..79044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf4"
FT                   /note="ORF_ID:glr0079"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88020"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88020"
FT                   /db_xref="GOA:Q7NPH6"
FT                   /db_xref="InterPro:IPR003359"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NPH6"
FT                   /protein_id="BAC88020.1"
FT                   /translation="MAAPAIYQTDKVLRFEVPGSRRPSTYFFALVLTLGGLGFLFAGLS
FT                   PFVETNLLPFSDTRGLTRFPQGVTMIFYGALATLFSLYYWLVLALDVGSGYNEFDKQNK
FT                   KVTLFRRGFPGKNRIIEIVHPLENILGLKVQIKEGLNPRRAYFLKLKGARDLRLSPVGQ
FT                   PQPLAAVEDQVSAIARFLNIGVEGI"
FT   CDS_pept        79162..82194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0080"
FT                   /note="ORF_ID:glr0080"
FT                   /note="putative alpha-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88021"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88021"
FT                   /db_xref="GOA:Q7NPH5"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041147"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPH5"
FT                   /protein_id="BAC88021.1"
FT                   /translation="MPLIAGWKSHQGDLPDAASPAFDDSAWPVAKPDAKGNIGWPKGRR
FT                   VLWLRQWVTIPRDWQGYASAGTRVHLNLIWWAEKAEIYVGGRFVQAGDLYDAVQRVPVT
FT                   AAARPGERVLIAVKLTSPGHDSGALSQSRLDIDAPAGRTDPGLLADELEVVDSYLKEIA
FT                   TPTERRQWRPALDRALAALDWRALSRRDQARFEASLTRSRERLVPTAQLTRARTIALLG
FT                   HSHIDMAWLWTVPETKEVIERTFRSALGLMEDHPRLDFAQSTAQSYQWLERERPQLFDA
FT                   IRQRVNDGRWELVGGMWVEPDLNLPDGESLVRQVLYGKQYFQSRFGRDIRVGWNPDSFG
FT                   YTWQLPQIYKKSGIDYFLTTKLDWNDTTKFPHRIFWWQGPDGSKILTYFSNLLGAQIEA
FT                   VPMAEKARAYEKNTGLPKLMWIYGVGDHGGGPTRDMLDQAERLASSPVYPKIEKTTALA
FT                   YFEQLAAADPKARRFPTWNSELYLEFHRGTFTTHAGQKQKNRRMEVTLAEAEKFSAAST
FT                   VLQSTAYPAAELEVIWKKVLFNQFHDILPGSAIPAVYEQADREWREAQAAGEDLRTGAL
FT                   RALAAQADTQGAGLPVVVFNSLATPRDAPVALPAPGNLRGARLVAVDRTGKDVPVQAAG
FT                   DWLHFWAAGVPGIGHKVFWLRPADAPAPATTGLENAYLRVEVDPRTGDLASIFDKRTGR
FT                   ETLNGPGNRLQFFKDEGQYWDAWNIDPDYEKHPLEAPTLVSLQTVEQGPVRAVVRVVRR
FT                   FRQSTFEQDLILYRDAPHLEIANRVDWQERHVFVKAAFPLAVRSEQATYEIPFATIERS
FT                   TLRDTPARKAQWEVPALRWADVADARSGVSLMNDSKYGHDARRTDTGTLLRLSLLRGPE
FT                   WPDPKADLGEHSFRYALYPHPGDWREAATVRAGLEFNTPLHALPQTIHPGTLPESFLQL
FT                   DNPQVVVAAWKQVEDGKGWLLRLYESQGQPAAARLRLAIPVRSVVKTDLLERPIAALAV
FT                   QDGQASLQLGPYEIQTVRVQF"
FT   CDS_pept        82256..82849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0081"
FT                   /note="ORF_ID:glr0081"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88022"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88022"
FT                   /db_xref="GOA:Q7NPH4"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPH4"
FT                   /protein_id="BAC88022.1"
FT                   /translation="MLKKSENQSIARTIKSQAQILGGTVAAFWSIEIVDQVLFAGRYLD
FT                   VFGIHPRDLDSLVNIFFAPFLHVGFGHLIANTVPFLVLGWLIMARSFKDFFWVTLIVTL
FT                   VSGLGVWLFAPTNTVHLGASGVVFGYLGYLLLRGYFERSWQSVLVALGVGFLFGGALWG
FT                   VLPLQAGVSWQAHLFGFLGGVLAARWLTPRRPAS"
FT   CDS_pept        complement(82929..84077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0082"
FT                   /note="ORF_ID:gll0082"
FT                   /note="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88023"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88023"
FT                   /db_xref="GOA:Q7NPH3"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPH3"
FT                   /protein_id="BAC88023.1"
FT                   /translation="MHIAWLGKKTPFCGNVTYSREVTNALMELGHRVSFLHFVQEEEIL
FT                   PPRADLGEVTLPCLYKSQAYTIPSLRARKVLVDSLRELKPDLVHASLTLSPLDFALPEI
FT                   CEELRLPLVATFHPAFDRRRRNFAANTQYLMYQWYTSTLANYDRVIIFSQLQKDLLIRL
FT                   GVPGRRIAIIPNGVDTARYCPGYSRIKDELRAGRLFVYMGRLTVEKNVEQLLKAWKQAG
FT                   MHALGARLAIIGDGPQRANLQSFYGTEEGVRWLGYLASEQRRIEILQGADVFVLPSLVE
FT                   GLSLSLLEAMACGTACLATDVGADGEVLAGGAGLLVNPLRVRSELRTLLPMLGEQPEFT
FT                   ALLGQKARARVIEHYTLSSNIWALENLYAEVLERTPARLLKN"
FT   CDS_pept        complement(84082..85326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0083"
FT                   /note="ORF_ID:gll0083"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88024"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88024"
FT                   /db_xref="GOA:Q7NPH2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPH2"
FT                   /protein_id="BAC88024.1"
FT                   /translation="MAPTTQDSSQQHKTLGFRDVLRNRNFLFLWSGQVFSQLADKIFLV
FT                   YMIALIAVHFTEALTAQLSSGIMIASSVPAILFGSVAGVYVDRWPKKTVLIVSNLLRGL
FT                   FVLVVPFLPVQYAFWLALTFLVSTLTQFFAPAETAAIPLIVERRGLLSANSLFTATMMV
FT                   AAVVGFAIGEPLLSLIGGADDGHWIVGGAYVIASLLIGFMHTGEKESLKHRPEPNLAKD
FT                   LREGFVYLKQNAGVRFAFVQLVVLYSVIAALTILAINLAPAIGLKQEQFGFLLASASGG
FT                   LVAGAIAVGKFGNRLPRPSLALVGAILMGAALIGLYWASNVWSALSLTLLLGLGGACIG
FT                   VPMQTLIQEQTPEQMRGKVFGLQNNLVNIALSLPLVLAERAAALFGLRPVILALGLVVL
FT                   LAGFVSKWFSRDLSK"
FT   CDS_pept        complement(85344..86129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0084"
FT                   /note="ORF_ID:gll0084"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88025"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88025"
FT                   /db_xref="GOA:Q7NPH1"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NPH1"
FT                   /protein_id="BAC88025.1"
FT                   /translation="MSGKTYRATGINLRRMPLGESDLLMTILTRENGLVRAVARGARKA
FT                   NARIGGRTEQFVVNDLQLYRGRSLDQLTQAESLRTFPGLLQDLGRLTAAQYLAEGVLQE
FT                   ATEGQAQEDLYDLLLVHLERLAATPSHQIAARLVHGVYQLLAVGGVAPEVHFCTVSHRP
FT                   ISAESAGFSVEGGGLVALECLSHERVGFRLDIEQVAALQLLADADLTPASLDWNYLWIG
FT                   LERLLRRHIEFHFDRPLRAATLLEICFEPLAVPAAASPQ"
FT   CDS_pept        86307..86954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl3"
FT                   /product="50S ribosomal protein L3"
FT                   /note="ORF_ID:glr0085"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88026"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88026"
FT                   /db_xref="GOA:Q7NPH0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NPH0"
FT                   /protein_id="BAC88026.1"
FT                   /translation="MSLGILGRKLGMTQIFDEEGRAIPVTVVEAGPCPVTQVKSEATDG
FT                   YTAVQLGFGTAREKVLTRPEVGHCKKAGLEAPVRHLREFRLPDSSQYTPGQQITVDLFA
FT                   AGQLVDVVGTSIGKGFAGGQKRHHFGRGPMAHGSKNHRAPGSIGAGTTPGRVFPGKRMP
FT                   GRMGNERVTVRKLTVVRVIPERNVILIQGGLPGVEGGLLMISPAKSVGRAKG"
FT   CDS_pept        86987..87628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl4"
FT                   /product="50S ribosomal protein L4"
FT                   /note="ORF_ID:glr0086"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88027"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88027"
FT                   /db_xref="GOA:Q7NPG9"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NPG9"
FT                   /protein_id="BAC88027.1"
FT                   /translation="MATCSIKDWQGNATGEVDLDLPVASAATASHVVYLAFKRQMVNSR
FT                   QGTASTLTRGEVRGGGRKPWKQKGTGRARAGSIRSPLWRKGGVIFGPKPRDFEIKMNRK
FT                   ERRLALRTALQSRVEDLIVVDEFEGQLAAPKTRELVQAFERWGVDMASQSILLILRERQ
FT                   TNTYLSARNLPNVKVITAGNLNVRDLLATDWIVVTGPALELIKETYGAVA"
FT   CDS_pept        87625..87927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl23"
FT                   /product="50S ribosomal protein L23"
FT                   /note="ORF_ID:glr0087"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88028"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88028"
FT                   /db_xref="GOA:Q7NPG8"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NPG8"
FT                   /protein_id="BAC88028.1"
FT                   /translation="MSSGTKRALADIIRRPLITEKGTRLLEENKYLFEVTPGANKIQIA
FT                   QAIEELFSVKVTKVNTFNPPARQRRVGKYLGTRSSYKRAIVTLQEGDSITLFPEV"
FT   CDS_pept        88105..88680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0088"
FT                   /note="ORF_ID:glr0088"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88029"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88029"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPG7"
FT                   /protein_id="BAC88029.1"
FT                   /translation="MKKTQALLLSLPLIVGLAACSTPNTTAEGVRQDQTASDQRAETQR
FT                   ENAGEATGEAANRTGQAMENTADNAGKRAENAMQDGAQTATGESGAEAKDDAASDTRKR
FT                   QLESDIRAREQRSDATGQVSDGDIESKVRSKLEANIQQGSIAVTAKEGNVTLKGRVPVQ
FT                   SDIDKAMKLAKEINGVKQVQSELTVGKG"
FT   CDS_pept        complement(88677..89216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0089"
FT                   /note="ORF_ID:gll0089"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88030"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88030"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPG6"
FT                   /protein_id="BAC88030.1"
FT                   /translation="MIDQRRSLSAMPHCGVNRGGGGARIGKIRPIWRTRRSKCPRTTFY
FT                   IFVVSGTDKEHGVAELSWEQRARVATHDVAPQLQKLLANLGGRLPWLNYIHPGDPVAYP
FT                   LDPLIFDLVDGERRHLEVEDVLATRNDLFGSVIDLVLEQTEFALLNGGTAHDSYFSNPG
FT                   VAARIAGAVKAAARRG"
FT   CDS_pept        89381..89851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0090"
FT                   /note="ORF_ID:glr0090"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88031"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88031"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPG5"
FT                   /protein_id="BAC88031.1"
FT                   /translation="MLNRLRELRSRYFGELEEAIEDVDAPASGEALLTDTDAVEAEAEE
FT                   AAAAEGLDPEVRQAVTDLYRRCLARYEYVKEANEKFLAMLDEGLMSDLSDNEEEQKIRK
FT                   FAESLTLDPVDQPMAFANYEAEDIVDEAQALTEKEAVLFGDDTNLDNRSERS"
FT   CDS_pept        complement(89856..90407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0091"
FT                   /note="ORF_ID:gll0091"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88032"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88032"
FT                   /db_xref="GOA:Q7NPG4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPG4"
FT                   /protein_id="BAC88032.1"
FT                   /translation="MLPEPPPEASFAIRRYCFEDIEPIYQAVRESMADLAPWMPWCHAG
FT                   YSREDSAAWVLTREDDWKSDRTYDFVIYERTSGDIVGGVGLNHLSRAYRLANLGYWVRS
FT                   SRTRRGAASTAALLVARFGFDYLDLERLEIIAALTNTASRRVAQKVGARCEGLLRRRLP
FT                   LGDHIHDAVLYSLIRTDLVS"
FT   CDS_pept        90488..90808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0092"
FT                   /note="ORF_ID:glr0092"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88033"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88033"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPG3"
FT                   /protein_id="BAC88033.1"
FT                   /translation="MLKYSALSLPLLVGLLAAPVLAQGEPTVVTTPPAAVTPDGLGALD
FT                   EAAPLPPGEFLDELTVTATRRPARIRDTTVNTYILRKEDFKAVGAVTVRDALILVPGFF
FT                   GK"
FT   CDS_pept        90820..92208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0093"
FT                   /product="aminopeptidase P"
FT                   /note="ORF_ID:glr0093"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88034"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88034"
FT                   /db_xref="GOA:Q7NPG2"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPG2"
FT                   /protein_id="BAC88034.1"
FT                   /translation="MTAWMERPSMAEALKERRRRLAALVERPAVLWSGQSIGRNYPANT
FT                   YPFRANSHFLYFAGVPLEGAAIRLDSGKLELFLDEPGPAHALWHGEVPGREAVATFVGA
FT                   DAAYPLAELGARATGAATLPATDTTTRAGQTQLLERTLPASHELDRADRALAEAVIVLR
FT                   LSHDEAALGELRRAAAVSVVAHQAGMRVTPKAKYESEVRAAMEGVIIANRMATAYGSIV
FT                   TVHGEVLHNEQYHHTLTPGDLLLADVGAESELGWASDITRTWPVSGRYSPTQRAIYDIV
FT                   LAAHDACIASMKPGVEYRDLHLLACAVMAAGLVDLGILRGKPEDLVERDVHALFFPHGI
FT                   GHLLGLDVHDMEDLGDLAGYAPGRERSERFGLGYLRLNRPLAAGMLVTIEPGFYQVPVL
FT                   FGDPLNREKYADAVNWERLGQFADVRGIRIEDDVLVTETGTEVLTAALPTRAEAIESLV
FT                   LAGA"
FT   CDS_pept        92607..94766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0094"
FT                   /note="ORF_ID:glr0094"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88035"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88035"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPG1"
FT                   /protein_id="BAC88035.1"
FT                   /translation="MPMADIKALIVAINDYPGTTNDLPSCLEDARKFIEVLKSPSYGLR
FT                   TQQLRTLYDAEATIKNVTDGLDWLLSGVSRSANGKQDARRILYFSGHGFRTELEGILRE
FT                   CLCLHDGFFFDQQLSAKTQGLPPGMLTVILDSCHSGGMEKPFLLVVSTDESEERTRNKV
FT                   WIPEDLSKEIAVELDQTVSLPFKAFGGPVEPPLAASKSGAMRLMATSAIARQKADAPRV
FT                   NGLVLSACRAEQTAAASTSRTNGMSAFTYGIVTALTKAGQSLPSYDRLSNARLLQAVAA
FT                   ELSNLNFKQTPEVKEPDTPQDLGSYTFITLQPMGSIPPPPPDAPATGSSNWLNSLWDML
FT                   RGTTGKSFTGEQAMVSSMSTWTIAKSQTDRNAVEEKFFGSVLRAAVRLAPMIANVVSQL
FT                   NKDYQPDGTSQQQEKFLGALIGIGSGVIPYIPRIIRALRKDFEVDASPEADEKFLGAAL
FT                   RMALHLAPTVSQIIEGLRKDYQPDGSGTPEGEEKFIGAVLQTALTLSPTLSNLLERLRQ
FT                   DLRKDYEPAASEEDEQKFFGAVLRAGLRLAPAIAGIVQALGKDFQMGESEQADEKFFGS
FT                   LLRVIRQVAPVVGEIVQELRKDYQIDKAVVDEEVEEKFFGSVLRAAVRLAPMIVNVVGQ
FT                   LNKDYQPDGASQQQEKFLGALIAAVTTIAPAIPDIIQAFRKDFEADGTAEKLLSEQVSN
FT                   GHGRKLPIPVSRVSSHELPVGAGMS"
FT   CDS_pept        94907..95146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0095"
FT                   /product="cell growth regulatory protein"
FT                   /note="ORF_ID:gsr0095"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88036"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88036"
FT                   /db_xref="GOA:Q7NPG0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPG0"
FT                   /protein_id="BAC88036.1"
FT                   /translation="MKSQVARWGNSLAFRIPRQIVIQLGLKPHTTLLCSVEAGALVVRP
FT                   VREVKEYSLEELLVGPLEVEDEVDWGKPEGKEAW"
FT   CDS_pept        95140..95475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0096"
FT                   /product="cell growth regulatory protein"
FT                   /note="ORF_ID:glr0096"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88037"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88037"
FT                   /db_xref="GOA:Q7NPF9"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPF9"
FT                   /protein_id="BAC88037.1"
FT                   /translation="MVEYVPRRGEFIWLSFDPQAGHEQIGVRPALVVSQTLFNERLGFV
FT                   FVCPVSNTQRKNPFYVLIPEGQAVTGVIMADQLRSLDYRARRAAAISLCSEELLIEVLR
FT                   KIQPILF"
FT   CDS_pept        complement(95612..96085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0097"
FT                   /note="ORF_ID:gll0097"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88038"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88038"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPF8"
FT                   /protein_id="BAC88038.1"
FT                   /translation="MSDVDRFKQAAGELVAEAAEVLDAYLAIDDRMFSWKNTFGWNDVS
FT                   PLKPLVQPLIERLLAVSKQIKDLQGAAGELPEEIPEKAPLLGLFKVFANYVESLRFAVQ
FT                   TMGRVLEHIETRRLNGAEFKKTRYESDLLIYKSQIDKYQLYGEQLNTLIRQLR"
FT   CDS_pept        96173..97906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0098"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:glr0098"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88039"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88039"
FT                   /db_xref="GOA:Q7NPF7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPF7"
FT                   /protein_id="BAC88039.1"
FT                   /translation="MLRLESVSKIYPTGEVLRDCTWEVLPGERIGLVGANGAGKSTQIK
FT                   MLLGHEEPTSGQVVRPSHVKIAYLAQEFMVTPGRTVREELLSVFEEAQAVQHELNEANL
FT                   ALADAGGASEAELTRLLKKIDRLQSHFEALDGYLLVSKVEKLLPELGFNDVDGDRAVET
FT                   FSGGWQMRIGLGKLLLTAPDVLLLDEPTNHLDLETIEWLEGYLKDLNRAMVIVSHDRRF
FT                   LDRIVTKIVEVERGMASTYSGNYSFYQTAKSERADAQLSAYERQQRELGRQQAFVDRFR
FT                   ASATRSTQAKSREKQLEKIERIEAPVGTERTLRFRFAPAPASGKQVMLVRDLSLEYGDK
FT                   ILFLGANLEILKGERIALLGPNGAGKSTLLRLFIGEEQPTTGKIEFGHNVLAGYYAQHQ
FT                   AETLDMGKIVLETLHGEAPQLTNEEVRTMLGRFLFSGDTVFKKVSALSGGEKSRLALAR
FT                   LLLRPSNFLLLDEPTNHLDIPSKEILEEALREYTGSAVIVSHDRYFIQRVATKIVEIRE
FT                   GELVAYEGDYDYYLDKKAEETERQALEAKLAREQAKEKEKRAKEKEKQKQKAAQAKATK
FT                   P"
FT   CDS_pept        complement(97911..100268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0099"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /note="ORF_ID:gll0099"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88040"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88040"
FT                   /db_xref="GOA:Q7NPF6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPF6"
FT                   /protein_id="BAC88040.1"
FT                   /translation="MQERRRHVCWMCLVCSADRALPLERPIHSTWPTEVSAADPADPAA
FT                   SEGLVMACSPENLLAEIAALREHNARLEALLGEGRLKAPALLESEERYRSLITVTSAIV
FT                   WTAGSDGAIVEEVPSWEEFTGQSPEQYQGWGWVEMLHPEDRASTAEIWRQANANKRPVE
FT                   VEYRLRRRDGEYRHMVARGVPLLNAGGRLCSWVGTVTDIHDRKVAEQQRELRLLQAKRH
FT                   TTRLQKLAEASLAINSALSIQQVLQGITEQAAALIGAHMALTSLTPERDWARAVHTVYL
FT                   SDKYRYWHHGEARLGGVGIAADVCRTNRPARLTQSQLEGHPQGRLLAFGATDRPALRGW
FT                   LAAPLVGRDGRNIGLIQLSDKHEGDFSEEDEAIAVQLAQLASVAIENTRLFEAEQAAKV
FT                   DAEEANRLKDEFLATLSHELRSPLTAILGWTKLLRQVDLGAVRAAHALEVIERNALAQN
FT                   QLIEDLLDISRIVAGKLRIEAAAVDLAGVIEAAIGTVRPAAQARAIEVDTEIEPGVPLL
FT                   MGDATRLQQVVWNLLANAVKFTPNGGRVRVRLSRRGTAAEVAVSDSGLGIAPHLLPHVF
FT                   ERFRQADSSSTRSHGGLGLGLAIVRQLVELHSGTVSAASPGEGQGATFTVRLPFDGART
FT                   LLAGDHSPGDWTRESPTACCGRLDGLRVLVVDDEPQARELVRTTLELCGAQVATAGSAA
FT                   EALAEVRRSKPAVLVSDIAMPGEDGYALLRQLRLLEAECGGRIPAVALTAYARVEDRRR
FT                   ALLAGFQTHLSKPVEPSELVAAVANLSCQAAI"
FT   CDS_pept        complement(100300..101559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0100"
FT                   /note="ORF_ID:gll0100"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88041"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88041"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPF5"
FT                   /protein_id="BAC88041.1"
FT                   /translation="MHLEHRAMKKFVQLLLTIGVLLSAMFVLVNRLGAAPTQRTGYLIG
FT                   IQELNNLGPIGDNGVLKLGPVDLTGLPMPPDFVTATAEAQMGIANSCVKLEMLLNYTYS
FT                   GLTGVPNNMAGSTDNTDCQVNGGGNQKDERTYTLASVTANIDDSQTSMSLSVFAYFFGN
FT                   NENASKVTLRTVRLSYYSLEPPTAGAAQSVQLVPSAFNGLVIYPSVATFFGKYFVYIDN
FT                   QRYEPAIDTNGYLKGNLLGSALGARQIGFFLPENSLYQSSLLYLQNGDPASAQKLTVQG
FT                   MTTKGTYTAPGVYGNPIGLQALDLREVNWLSGYLIPYPKPATLVAIPAASTVASGQTLR
FT                   VTLSMSGIDPGTLRARIGSTETYPAATNSPKWRELIDKGKGAIELNLSGSTGQSVPVIL
FT                   MARPLDSDQELAYSFVVTIK"
FT   CDS_pept        complement(101535..101984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0101"
FT                   /note="ORF_ID:gll0101"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88042"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88042"
FT                   /db_xref="GOA:Q7NPF4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPF4"
FT                   /protein_id="BAC88042.1"
FT                   /translation="MDCMLFTRPLRGFSLVEMVLALAVGAALGLAAVTVGLYWRGEAQR
FT                   RLLGASVPLIAQAMRQYARAHGSLPDLAVAEDSDRWLVLYTPPGSTTLPDGARRTLPDG
FT                   IAYQRLQTYVPSSIPFGQVPGRVRLTGTGCEPTDRLTECTLSIVP"
FT   CDS_pept        complement(102033..102941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0102"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="ORF_ID:gll0102"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88043"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88043"
FT                   /db_xref="GOA:Q7NPF3"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NPF3"
FT                   /protein_id="BAC88043.1"
FT                   /translation="MKTVRLRAAAKINLYLEILGVRPDNFHELVMVLQSVDLADTVTLR
FT                   AAPTTRVSCSHPLVPNDRTNLAVRAVEVLQKHTGIDEGVEIVIEKRIPVASGLAGGSTD
FT                   AAAVLAGLNVLWDLGLTQRQLQSLGAQIGSDIPFCVTGGTALAMGRGEVLSPLPALKGV
FT                   YLVLAKLADLQVSTAWAYQTYRREYLSEGTAPRARTSALLSAVASQEVARIAPLLHNDL
FT                   ERAVLPAYPQVSALREHLVSAGALGAMMSGSGPAVFGLARDRAHAEAVCAVLAGEPGLE
FT                   LFVCKTQQAGILMEESESSDL"
FT   CDS_pept        complement(102938..103657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxJ"
FT                   /product="pyridoxal phosphate biosynthetic protein"
FT                   /note="ORF_ID:gll0103"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88044"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88044"
FT                   /db_xref="GOA:Q7NPF2"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NPF2"
FT                   /protein_id="BAC88044.1"
FT                   /translation="MPTLGVNIDHVATIRQARRTVEPDPAAAAVLVELAGADGITVHLR
FT                   EDRRHIQDRDVEILRRTVRTHLNLEMAATRAMVDFALDVRPDYVTLVPERREEVTTEGG
FT                   LDVGGQIASVGLAVEQLQCAGIPVSLFVDPDAAQLQASARTGAKFVELHTGRYAEARGE
FT                   QAQRSELAQLAAACDEAQALGLRVNAGHGLTYWNVAPVARLSGMEELNIGHSIIARAVL
FT                   VGLERAVREMKQAMIAG"
FT   CDS_pept        103788..104183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0104"
FT                   /note="ORF_ID:glr0104"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88045"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88045"
FT                   /db_xref="GOA:Q7NPF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPF1"
FT                   /protein_id="BAC88045.1"
FT                   /translation="MIDFFLYKFGLSPAVAAGISLWSLALYLCFSRFNGRLVDVLCGWL
FT                   NDADRAIYTAQTLERRPKGWEERNQLFASILSILPSLILAVVVFIVLRHTLGGSWALAG
FT                   GLMVSIGAGVYQLGIKDAENSRPGGRP"
FT   CDS_pept        104307..104567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0105"
FT                   /note="ORF_ID:gsr0105"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88046"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88046"
FT                   /db_xref="GOA:Q7NPF0"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPF0"
FT                   /protein_id="BAC88046.1"
FT                   /translation="MGILSFILFLVVAGICAVIAEAIVPGRIPGGFLVAAVFGVIGAWV
FT                   GAALFGNFGPALANVSLIPTILGSAILVFIVALVSGYAVRR"
FT   CDS_pept        complement(104645..105133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf52"
FT                   /note="ORF_ID:gll0106"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88047"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88047"
FT                   /db_xref="GOA:Q7NPE9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPE9"
FT                   /protein_id="BAC88047.1"
FT                   /translation="MARLKMLRWLKCLSSCPSVSQTAAPAITLSFDAASVEPMQLQQLF
FT                   DTGAFWARNRQIGRIECMLACSKPVVAAYAESRLVGFARATSDGAFRATIWDVVVHPDY
FT                   QKLGLGRRLIEALLDEPAIRDVERVYLMTTFQQGFYEKLGFQRNASTTMLLMRSDEVG"
FT   CDS_pept        105182..105448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0107"
FT                   /note="ORF_ID:gsr0107"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88048"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88048"
FT                   /db_xref="InterPro:IPR021492"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPE8"
FT                   /protein_id="BAC88048.1"
FT                   /translation="MASGRLPQTEINLRVSARSLSGGWLEGDAEGGQYVWTFRWHFLSG
FT                   GQLEIHPSLGRALIKEPLQRFLEKNDFRLETGETYAFTVKARI"
FT   CDS_pept        complement(105491..106240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0108"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /note="ORF_ID:gll0108"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88049"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88049"
FT                   /db_xref="GOA:Q7NPE7"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NPE7"
FT                   /protein_id="BAC88049.1"
FT                   /translation="MTTPHTLLRSLPSDLDPNRLPRHVAAIMDGNGRWASKRNLPRVMG
FT                   HQAGVSALKELLRCCKDWGIGALTVYAFSTENWKRPQYEVEFLMALFEKVLNHELSEMV
FT                   DEGVRIRFVGALAHLPGALQSAIEGAMAATEANTAVEFTVATNYGGRQEIVNACRELAE
FT                   QVRSGRLLPEQIDEKLFAQHLYTRELSDPDLLIRTSGEQRLSNYLLWQMAYTEIYVADV
FT                   LWPDFDRAAFHAALQSYQGRQRRFGKV"
FT   CDS_pept        complement(106245..107126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0109"
FT                   /note="ORF_ID:gll0109"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88050"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88050"
FT                   /db_xref="GOA:Q7NPE6"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPE6"
FT                   /protein_id="BAC88050.1"
FT                   /translation="MNGPLEQLSGELALRPLIISILDWAAVGLLLYLAFQLIRQTRTVW
FT                   LIRGFLILSGAFFLSNLLGLTTLNFILDKILIGVAVAVPVIFQPELRRFLEQLGRGEIF
FT                   TLLKPDRVPDFEKEALDELLDAVQDLSEERIGALIVIEQSPIDDRLLQDPGDTMDAVLS
FT                   KSLLLTIFYPKTRLHDGAVLVRDWRIQSASVILPMSTQIPARQLGTRHRAAMGITEQTD
FT                   ALCIVVSEETGSISLAERGKLQRPLTVEQLAEALNRRYRRDQPPSVFTIPALSDWTRKL
FT                   FPASSSQSGNSD"
FT   CDS_pept        complement(107123..108457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="ORF_ID:gll0110"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88051"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88051"
FT                   /db_xref="GOA:Q7NPE5"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPE5"
FT                   /protein_id="BAC88051.1"
FT                   /translation="MPADIPSPNQMIAPLETRTDARGHLMIGGCDVVDLAQRFGTPLYI
FT                   LDEATLRAACTQYVEAFKRHYAGDFRVLYASKAWSNLAICAIVHRCGLGIDAVSAGEVH
FT                   TALRAGVPGELVYLHGNNKSEAEILLAAEVGATVVADNWLDLEILSAISAECPVRVMVR
FT                   VAPGIDIHTHEYIRTGHLDSKFGFDPSELAAVLAYLARIPSLRAVGLHAHIGSQSFELA
FT                   PHGDAAQLLLEWYPKALALGLSDFNELNVGGGLGIRYTDDDDPPAIDEWVGTICQAVTR
FT                   TCNTYNLPLPKLLCEPGRSLVGPACATAYTVGSTKTIPSIRKYFSVDGGMSDNPRPITY
FT                   KALYTAVVANKMHDGRREKVTVAGKHCESGDVLLRDVELPPLERGDCLVVFSTGAYNCS
FT                   MASNYNRIPRPAAVLVSDGEATLIVKRESPDDLLRCDCLPERLQT"
FT   CDS_pept        108590..109516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0111"
FT                   /note="ORF_ID:glr0111"
FT                   /note="similar to ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88052"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88052"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPE4"
FT                   /protein_id="BAC88052.1"
FT                   /translation="MPTHRERLAGGLVGLLVGDALGVPYEFNPSTNLPPIGLINFEPPP
FT                   GYTPTHAVPPGTWSDDGAQALCLLASLLDCGRLDAEDVGRRLLAWHDEGYLAVDGCVFD
FT                   VGVQTGEALAALKAGTPALRAGAADERANGNGSLMRVLPLALWHRGGDAQLARDAALQS
FT                   QITHGHARAQLCCALYCLWARRILEGAAQPWAAATATVRTLYAAEPMALRELDAEIRPE
FT                   APPRGRGGAYVVDCLHSVRWAVEAGQTYEQVVKLAVSLGNDTDTTACLAGGIAGLQQGI
FT                   EAIPERWMRHLRGSELYKPLLERLLAQ"
FT   CDS_pept        109702..110904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0112"
FT                   /note="ORF_ID:glr0112"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88053"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88053"
FT                   /db_xref="GOA:Q7NPE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPE3"
FT                   /protein_id="BAC88053.1"
FT                   /translation="MNERIDQIQSDATLVFERYANYIKHVQNEFSSLDERLRELRLHSK
FT                   HSWREKIEQIPQIFLYAVDYVSAQLEREPLQRLLLVTLKQIAKGLTGQLPRHGEQIRYL
FT                   YNDIKTFVQENEPKQPWYSKYKGYLFIAAICVTFYWILPVAQRKEVIDLVLGYQDSWKS
FT                   FLEGLGRSEQIHITMIEFAFAASLWSLMLIAPYLLFRVSVERKRRTVVRFAQELPTNWN
FT                   PSSLYIFYRQKPMQLRFSESKPTDVELAQARLWRNLEVKPEVRREHITEFRANLIPPIV
FT                   MLFIILVIEAFALRLVVIRPQIFGSIWLAFLLGLLCIGLLLWEVKIALKTQKEWQTVFE
FT                   AETFWLEEGLDSQVELDEKQISEIDSNIEEASMEIIDGLPVVHTRVDTDLVDAIRSMRE
FT                   E"
FT   CDS_pept        111447..111665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0113"
FT                   /note="ORF_ID:gsr0113"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88054"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88054"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPE2"
FT                   /protein_id="BAC88054.1"
FT                   /translation="MVNWHWAVEAGGAYEQVVKLAVSLGNDTDTTACLAGGIAGLQQGI
FT                   EAIPERWQARLRGGALYRPLLERLLAG"
FT   CDS_pept        complement(111838..112395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0114"
FT                   /note="ORF_ID:gll0114"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88055"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPE1"
FT                   /protein_id="BAC88055.1"
FT                   /translation="MTHANDLPRPVTIERDDSPLSALQDLFERIRQVHALEHATIWVLS
FT                   EQDPDLKLSGFSTDRGFFIYGPVDTGALLRAAHRALERINRGEENLAIHPRCGTNLSVG
FT                   MLITAGVGLGASLFLPRRPLPQLVALGTAVVAASQLATGLGALAQRHLTTSIPRNLEIA
FT                   GARTLSDLAGRHSHFVETRYIG"
FT   CDS_pept        complement(112414..113133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0115"
FT                   /note="ORF_ID:gll0115"
FT                   /note="probable short chain oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88056"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88056"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPE0"
FT                   /protein_id="BAC88056.1"
FT                   /translation="MQGKVVLITGASGGIGSAVARRMAAQGASLALAGRTQASLDALAA
FT                   ECEAAGSPQTLAMATDVTVKEQVDNLYTKVAATFGQLDVVLNAAGLGILKPIQNLSEAD
FT                   LDRQMAVNLKGTFLSCQAAVPLMSQQSGGGHIFNIPGILGQHPMATAAAYCASKYAVVG
FT                   LTKSMALDLKRAGVKFTLLYLGGVNTPFWDNAGMRVQRDKMLSAETAAEAVAFALALPS
FT                   PGVPNEIVIQPDSHQFL"
FT   CDS_pept        113268..114104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0116"
FT                   /note="ORF_ID:glr0116"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88057"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88057"
FT                   /db_xref="GOA:Q7NPD9"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPD9"
FT                   /protein_id="BAC88057.1"
FT                   /translation="MTQQQPAARTPNTPLGDSLRNLVQERLQSASRIVEGQIGPQVVTW
FT                   VAAARSRLGDSLQAVRTSDWMQQIGRTIGANWILQLLDQVNVQKVRETVTTLQIEHPGE
FT                   SPPELAQRLIQRKAVFAGGVGVASGLLPPGINLPMVAADVVATVMLEIELIYEIACLYG
FT                   LDLGDPDRKGEAVLVLALGSGVDRLAGAGTQALKQAVGQQMARIGTEQLARLVGKQMAE
FT                   RLLLKGVPLFVGALVGAGVNATALMLIGNTASKFYTLQISVEPVADTATPKSLPAA"
FT   CDS_pept        complement(114108..115565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0117"
FT                   /note="ORF_ID:gll0117"
FT                   /note="similar to cyanophycinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88058"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88058"
FT                   /db_xref="GOA:Q7NPD8"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR011811"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPD8"
FT                   /protein_id="BAC88058.1"
FT                   /translation="MRKFLNLVPALMLLAAPCYAQGVVMVAGGGSEGDIGDTASWSYRL
FT                   YPTLIEAGDVNGDGRVTVAVIADSSQSEFIPEYFEWLGADDAFNVLVATRTQANDPAAV
FT                   DRVRDVDAIFIKGGDQGKYYDNWNDTRLEDHIRYVVQTLGGGVGGTSAGAMSQSQYALA
FT                   GEKDLISQDVLTNAQTRYLDDADGGSGIHADFLGFVANTVIDSHFNDRGRLARLLGVMA
FT                   KVNEDFGLTTGLLGIGLGDLTGLVIRGDRAEVIGQGSVSFLQATPETVTHRPGGAPLYM
FT                   TNVRADVLTEGWSFNLSGRAVAAQPAGVVTVSYAGDSAANRGALTIQGSKKGNERLYAL
FT                   KPTYFPQSYGLVPTTASTYIFNSLGLNDAQNPDNRGAIQETALRALYDYPHYTGILLSV
FT                   GAKLSRTQSSPDAIAFGAGTGGSEAAAIVLDGKKIEARGLSPYAAPTDSGNGSLRAAAL
FT                   VNLRVHILGQTGIWGTRYNTRTHTLQQ"
FT   CDS_pept        complement(115630..115974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0118"
FT                   /note="ORF_ID:gll0118"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88059"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88059"
FT                   /db_xref="GOA:Q7NPD7"
FT                   /db_xref="InterPro:IPR025642"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPD7"
FT                   /protein_id="BAC88059.1"
FT                   /translation="MAMAHNRNFTEEAYVLGNQLVDKVKEAIQEGNVRRILIQDPQGKT
FT                   LLEIPLNIGVAAGAGLLFFAPLLAGVAGVAAVVSRAKVVIERYEDPAAKKPTGNEPRPI
FT                   QIEDEDDPPT"
FT   CDS_pept        complement(116079..117365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0119"
FT                   /product="carboxyl-terminal protease"
FT                   /note="ORF_ID:gll0119"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88060"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88060"
FT                   /db_xref="GOA:Q7NPD6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPD6"
FT                   /protein_id="BAC88060.1"
FT                   /translation="MQDFFRKSVLLTVILSLVGSAAVTAAPKQPVKLRAEYEARLEDSP
FT                   KAIVDEVWQTVDREFVDPTFNKQNWIAAREQLLGRDYKSKEEAYEAIRNSLKVLGDPYT
FT                   RFLDPREFQALRDQTSGELVGVGIQLGVSQASKLPVVVKTLEDSPASRSGIQAKDELLA
FT                   VDGKATAKLEIGEVSRMIRGDRGTQVTLSVLRSGQKMSFTITRAPIELKVVTSSLKEEN
FT                   GRKVGYIRLAEFSEKAPNEMQRAFAKLSEAGVQGWVLDLRGNPGGLLDAATRVASLVLD
FT                   QGTIVSTVDRAGTQDQLTADRHPVTNLPLVVLVDQGSASASEILAGAIQDNRRGTLVGM
FT                   KTFGKGVIQQVNALSDGSGVNVTIAHYLTPSGNDIHKKGIQPDVVVAFPEEARKAPIEP
FT                   ATGADIQYQRAVTVLAKLIETKPATNARK"
FT   CDS_pept        117549..117830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0120"
FT                   /note="ORF_ID:gsr0120"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88061"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88061"
FT                   /db_xref="GOA:Q7NPD5"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPD5"
FT                   /protein_id="BAC88061.1"
FT                   /translation="MDWKLVGVTFGAIFLAELGDKTQLATFLMTAKSGSPWAVFLGSSL
FT                   ALVLASLLGVLAGAWLSKLIPPTYLQLGAAAGFVIIGCLMFYQVWRGG"
FT   CDS_pept        117922..118935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0121"
FT                   /note="ORF_ID:glr0121"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88062"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88062"
FT                   /db_xref="GOA:Q7NPD4"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPD4"
FT                   /protein_id="BAC88062.1"
FT                   /translation="MSLHAELHRHLGGSVVPRILWRYLVRQDHPLAEQYPEYKDFEAFF
FT                   TRPRRSLEEYLELHTLVEHVQTLDALPYFVMRLIRGAYIFENLAYLEIRYTPYLRTDRN
FT                   LAEDQRIAQMAEVVRAIGDAARSPEYPIVTSQILCMHSRLSDKVNRAIVDLAASMPEYI
FT                   CGIDVAGGDSHYAARLETFADLYKYALAMGIKTTAHLYETKDGIYPQLLPYVCRIGHGI
FT                   QIPLLHPELLPQLAARRQCLEICPTTYIKTGTLSDIGQLRPVFERCFEAGVDIAICTDN
FT                   AGLHDVRLPFEYENLLTNDVIDFKQLKACQEASFRHAFAWPHAKPPAAMLTTQTVG"
FT   CDS_pept        119016..119891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0122"
FT                   /note="ORF_ID:glr0122"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88063"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88063"
FT                   /db_xref="GOA:Q7NPD3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPD3"
FT                   /protein_id="BAC88063.1"
FT                   /translation="MRVQAVHKQPFHAIPYRAVAPSGEVRSRWFGLSHATVDRLPEGCD
FT                   AVFACSDLQGIFERAGEEAPRLLGEAVAAELAKLAGGGYLPGAARVGVLLCGDLFVRPQ
FT                   LDRRGGIGDVRPVWRAFARHFRWVAGVAGNHDDFGTAKERAAFLSEPGIHLLDGEVVDL
FT                   GGLRVAGLGGIIGDPVKPQRRKEKDFVRALKKLVGARPDVMLLHQGPDAPEFKLSGHRA
FT                   VREVLGRAPVPLVMSGHTHWKEPLATNFRGSQLLNLEGRGLLLQRGVPSLPAGLKLQFS
FT                   GAHWHLAAEL"
FT   CDS_pept        complement(119842..120897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobW"
FT                   /note="ORF_ID:gll0123"
FT                   /note="cobalamin synthesis protein cobW homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88064"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88064"
FT                   /db_xref="GOA:Q7NPD2"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR012824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPD2"
FT                   /protein_id="BAC88064.1"
FT                   /translation="MQKVPVTVITGFLGSGKTTLIRHILTHNQGLRIAVLVNEFGELGI
FT                   DGELVKACGGCGEEDIIELTNGCLCCTVQEEFLPTMQRLIARRDEIDHILVETSGLALP
FT                   KPLVQAFRWPEIRNGATVDGVVTIVDAASVARGGLFERTSDAPGHGATEEELVELFEDQ
FT                   LACADLVLLNKSDQVAPADQPAVEAHLRALLPDSVKLIAASHSRVDPRTLLGLGQAVEE
FT                   QIAKRPSHHDSEAEHDHDEDIRALSVRLEGPQDPDRLVAALQRLVRSDEIYRVKGFVHA
FT                   AGKPLRLVIQGVGHRFERYFDRPWGKDETRRTDLVIIGKDLEAETIGRALAEGALTAPR
FT                   PDASALPKTAT"
FT   CDS_pept        121048..121533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0124"
FT                   /note="ORF_ID:glr0124"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88065"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88065"
FT                   /db_xref="GOA:Q7NPD1"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPD1"
FT                   /protein_id="BAC88065.1"
FT                   /translation="MHRILALLIGGYGGASPLADVGLLVLRVFAGLTMAVHGLGKVPPN
FT                   EGLVETVASLGFPAPVFFAWSAGLAELVGGILLAVGLLTRPAAAAVLFTMLVAGFILHG
FT                   SQPFAEKELALLYAAVSFAFLLVGAGRYSLDGLIGGRLLGSGAGGRPLGRDRAPSPR"
FT   CDS_pept        121637..121867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0125"
FT                   /note="ORF_ID:gsr0125"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88066"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88066"
FT                   /db_xref="InterPro:IPR018739"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPD0"
FT                   /protein_id="BAC88066.1"
FT                   /translation="MVKEPRRVETDMQCEEKDLFDKIRSLPPEKLAEVADFVDFLYQRE
FT                   QARLTQASSALSEDSFRRIWDNTEDAVYDTL"
FT   CDS_pept        121845..122192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0126"
FT                   /note="ORF_ID:glr0126"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88067"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88067"
FT                   /db_xref="GOA:Q7NPC9"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPC9"
FT                   /protein_id="BAC88067.1"
FT                   /translation="MPSTIPYDFGDIILVAFPFSDLKTKKKRPAVVVSSSFYQTRYPDV
FT                   ILMAVTSQIQTPQYPGEVLIADWQAAGLLKASVTKPVLATVETELIIRKLGQLASADQE
FT                   AVRATLLIIFG"
FT   CDS_pept        complement(122286..122966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menG"
FT                   /product="2-phytyl-1,4-benzoquinone methyltransferase"
FT                   /note="ORF_ID:gll0127"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88068"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88068"
FT                   /db_xref="GOA:Q7NPC8"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032904"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPC8"
FT                   /protein_id="BAC88068.1"
FT                   /translation="MQGSQEIQGIFNAIAPVYDQINDRMSFGLHRVWKKMAIRWTDCKP
FT                   GDTVLDLCCGTGDLAFLLARRVGVAGTVWGVDFAAAQLAQARRRDREGRVRWLEADALD
FT                   LPFADDSFDAVTQGFGLRNVVDIPACFAQLRRVLKPGGRAVILDLHAPADAGWRAFQRW
FT                   YLEGWVTALGRAQGLEAEYAYIAPSLERFPTGDEQVRLAQQAGFSQASHYPLIGGTVGV
FT                   LVAQ"
FT   CDS_pept        complement(122966..123541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0128"
FT                   /note="ORF_ID:gll0128"
FT                   /note="probable molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88069"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88069"
FT                   /db_xref="GOA:Q7NPC7"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPC7"
FT                   /protein_id="BAC88069.1"
FT                   /translation="MLILAGGHSSRMGRDKALVEIGGKPMLRRVWEAARGGLGAGAPSW
FT                   AVTPWPERYRELLPGCIWIEERYSEGPFAAFLQALPHIQSEWVLVLACDLPDLEAGVIG
FT                   RWARALGGAPDSALAALVPSAKGWEPLCGFYRRRCFSSAMQYLAEGGRSFQGWLERIEI
FT                   FALAADRDMLRNCNTPEDLSEEGERAVF"
FT   CDS_pept        123820..125856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0129"
FT                   /product="oligopeptidase"
FT                   /note="ORF_ID:glr0129"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88070"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88070"
FT                   /db_xref="GOA:Q7NPC6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPC6"
FT                   /protein_id="BAC88070.1"
FT                   /translation="MKPPIAEVIPKSRTLHGETLVDDYFWLREKDNPIVITYLEAENRY
FT                   TEAVMQPTEQLQQTLYAEMLARIKQTDLTAPELWGGYYYYRRTEEGKQYPILCRKPGSL
FT                   EAAEAILLDQNELARDKSYFRIGTYQMSPDQHFIAYSVTTTGAEVYTIFIKDLKTGETL
FT                   AEQLTNASGYGFDWAGDNKTLFYTVQDAANRPYRICRHTLGTEPKTDPVALEEKDELFI
FT                   LSLEKTRSDAYLLATSVSKQTSEVSYLRADDPTGRFITFAPRRTGVLYSVDHRGDRFYI
FT                   LTDENAKNGKLLQAPVADPAHANWQERLPHRSDVKLDGIDLFKGYMVVYERENALKRMR
FT                   VYDFAAQAFQPVAFDEPVYTFFPARNPEFDTEQLRFTYTSLVTPSSVYDYDLRRRTREL
FT                   KKQETVYGYDPALYTSERQWAVAPDGERVPISLVYKKGRAKDGTQPLLLYGYGAYGISM
FT                   DPGFSSGRLSLLERGFAFAIAHIRGGGEMGRAWYDDGKLLKKKNTFSDFIACAESVISE
FT                   KYTTAEKLAIYGGSAGGLLMGAVVNLRPELFKSAIAKVPFVDVVNTMLDPSLPLTVGEY
FT                   EEWGNPNELEYFRYIRSYSPYDNIEAKAYPNLLLTTGINDSQVPYWEPAKWAAKLRKRK
FT                   TDNNVLLLKTNMGVGHGGSSGRYDALKEVAFDYAYLLMTLGVD"
FT   CDS_pept        complement(126121..126990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0130"
FT                   /product="ABC transporter solute-binding protein"
FT                   /note="ORF_ID:gll0130"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88071"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88071"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPC5"
FT                   /protein_id="BAC88071.1"
FT                   /translation="MVGSRFAFSMPPTRSRRLFLGWFGTTLLSSCTATAPVSSAGPDWV
FT                   LVRQRGFLRTAADPLVGAPYFFKRAGEYTGFEWEILSALCRQLRVGLEIVEVAWPEQPD
FT                   ALVAQKVDLLLNGHELPPSGEADTPRPPFESTRPYYLSSQQLLVSAPAAEAPANFAALA
FT                   GRRVGVIDQSGGWALVSAYNRKSSPPISVAGFRNLQDLLAQLEGGGLDMALIEAPVAAW
FT                   QARQHKGWRRVGPGWLPVALVGLVRTQDRSTREQIDLALGKLVAAGRLQAILRRWGLWN
FT                   ELQNRLVF"
FT   CDS_pept        complement(127010..127699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0131"
FT                   /note="ORF_ID:gll0131"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88072"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88072"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPC4"
FT                   /protein_id="BAC88072.1"
FT                   /translation="MSGSPSRRCPMLWLLLGLPLLAQTPAPPPVEPPVPAPSIEPAPVL
FT                   TPPPPDAATLKIGGYTILTLRGPDSTARVEQALQRFANIVGEAPQPQLFVAVRGNDGGA
FT                   IILVNDRGLVELSPRDTAPNGTSRVLPIARVWAGRLKSVLTNPTVLKGLFVFSGLPERI
FT                   AYNSAEYVRGPAPVRDVGRFTTDGSRTTPDPEGKTWVLFWDSQLPLPQPTLYMLNRYRE
FT                   YVPYTRQ"
FT   CDS_pept        complement(127839..128189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0132"
FT                   /note="ORF_ID:gll0132"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88073"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88073"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPC3"
FT                   /protein_id="BAC88073.1"
FT                   /translation="MAVKRIVANIAADKVEHAAAFYADVLGLHLVMDQGWIMTFAANGR
FT                   SAPQISIASEGGSGTPVPDLSIEVDDLDEVHQRVVAKGLNVEYGPTREPWAVRRFYVRD
FT                   PFGRLINILAHE"
FT   CDS_pept        complement(128334..128786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0133"
FT                   /note="ORF_ID:gll0133"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88074"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88074"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPC2"
FT                   /protein_id="BAC88074.1"
FT                   /translation="MIFCSYFVVVCCCRNPMRQRPRTTRLVRQRSDQMGNPVVYFEIGC
FT                   RDSSKTAEFFAQVFGWKGLPEGPAVSIRTGSEEGIQGMINSLGHEPHNYVTFYIQVEDL
FT                   QAALDKAESLGGKTCIPPTEVPGSGHFAWMSDPEGNTIGLWKPLQP"
FT   CDS_pept        128938..129441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0134"
FT                   /note="ORF_ID:glr0134"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88075"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88075"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPC1"
FT                   /protein_id="BAC88075.1"
FT                   /translation="MNQGEPVDTETRERVGYDEDFHAWAFAQATLLREGRLDRLDLENL
FT                   AEELESLGRSERRALESRLEVLILHLLKWQYQAEKRSKSWLATIAEQRYRISRLFHESP
FT                   SLRPLLEELVPVAFIGATFSFERETELPRSLVGKSCPYSTTQIVDDAFLPQETGGPPIE
FT                   PQSL"
FT   CDS_pept        129703..130410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0135"
FT                   /note="ORF_ID:glr0135"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88076"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88076"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPC0"
FT                   /protein_id="BAC88076.1"
FT                   /translation="MAVDVLQIHLHQSGRLQLTVELLLHESGRRERLTLAATPCPGERE
FT                   SSLCLQDVRVQFGQIALALLDLKPGEDELAVEAEVHFDPESRDDTSAGVDIRSGSLAFA
FT                   RIRLPHVERALARVLLPLAGINGLLASPWVQGNLQMLSLQLGERSIAGAVEQLAMRLQP
FT                   GLLELEGIFCEAKAAGRTPLKLQATTCAGSGALNFLHLRLGAATLEIGIETCEVEAGKL
FT                   TLGLAIHPSPPPG"
FT   CDS_pept        130561..131202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0136"
FT                   /note="ORF_ID:glr0136"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88077"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88077"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPB9"
FT                   /protein_id="BAC88077.1"
FT                   /translation="MLTAALLQTGEQRIWLEGISWETFERLLDELGESRAIRLAYDQGV
FT                   LEIMSPLNIHEKIKKLIARFIEAWADEMDIAVEGIGSWTMRRPDLARAIEPDECYYIAH
FT                   QSEILGVERIDLQVSPPPDLAVEVDVSSSSRVRLAIYRRLGIPEVWTWRGQGLIVQHLI
FT                   DGEYVEADHSRVLPGFAVQQLSSLVLQGLEIGQSAAVREFKQQIRTRANP"
FT   CDS_pept        131296..132090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0137"
FT                   /note="ORF_ID:glr0137"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88078"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88078"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPB8"
FT                   /protein_id="BAC88078.1"
FT                   /translation="MQKFARIQILGLVFAVGLLMAAAAAAQQAPKPLQTYVNDLLAFIK
FT                   SVQDSTYETISASYQEQMEALYGELEDLEFDDFLGELGLPDTFALGLSLNEDDNGDPFN
FT                   LGPFAPRALMRNLVTRESNRALARATQTDRLSAESQTRIQKNNDQFHTKLKDSANRAVT
FT                   YASTAEAAPSTQDALKQMNQQMALVNTSIVSTSLESLKLQTDFVGGLGNLQMLVSDVGE
FT                   AFDEQVRDRYHQRSQQALATAAAAFAAGETFAWKTSTAEAPR"
FT   CDS_pept        132087..133190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0138"
FT                   /note="ORF_ID:glr0138"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88079"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88079"
FT                   /db_xref="GOA:Q7NPB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPB7"
FT                   /protein_id="BAC88079.1"
FT                   /translation="MSFLFAWTTPDSAAEGLAQFAQQAASQNRLYWDGLWQSLFSSGLW
FT                   RGLEAAAGVVAGLALLVWGAFFLRGLIEEDSTPALSELLWPLLVIFGLVHTGSGTSNLA
FT                   GWINSARTVPYTLVDIVSNYSGRELTTLSTATGPLDLHDTILLAEYRVGMEQLVRNLYN
FT                   QCATLPVGQFKPCLAERRGDVQAVLAVVRSRVTTSEAFESAAQEIDRVFSGTVDPYTAV
FT                   SATRSLFARDATVDGWMVLLLSWQKNTVPTLEYALMVSATLAPLCLAASLLPVGNRSIL
FT                   GWAAGFAGICTAYFSYYILLGLGAHNYVFNLGFGLDSTAFLMKTCLVDPFIALVLGIGS
FT                   TRSLLWGGGHLLTSSHGYGFGLLRRGG"
FT   CDS_pept        complement(133435..134118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0139"
FT                   /note="ORF_ID:gll0139"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88080"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88080"
FT                   /db_xref="GOA:Q7NPB6"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPB6"
FT                   /protein_id="BAC88080.1"
FT                   /translation="MYSYPDASGLNRQREQRASNLPGAFAAMGISLALTGAVSWWASAL
FT                   PGIDAWFWPLLIVQLGLLLAIGTVRSWSKNADNLSLILLFVFAVVEGLVLAPITAIYLA
FT                   SSVGQAVVLKALAAAGATFGAGAIYGWTTKRDLSNLGSILIMAVLGIVISSLLNVFWLK
FT                   SPVTDLVISWMTVIVFTAFTAYDLNIARDNRFGQTAGQIALSLYLNFLNLFLAFLRIFG
FT                   GGGRD"
FT   CDS_pept        134219..134995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0140"
FT                   /product="exodeoxyribonuclease III"
FT                   /note="ORF_ID:glr0140"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88081"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88081"
FT                   /db_xref="GOA:Q7NPB5"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPB5"
FT                   /protein_id="BAC88081.1"
FT                   /translation="MSNLTVATWNVNSINVRLGGVCAWLSAHRPEVLCLQETKVPDERF
FT                   PVAAFEALGYEVAFAGQKAYNGVAIVSRKPVTVVRRGLPGDEADAPRRLIAATVEDTQI
FT                   INVYVPNGSEAGSEKFAYKLLWLERLRQYLLADFDPKAAVLLCGDFNIAPEERDVWDPK
FT                   AVAGKVLFHPDEHAALERIRTWGFIDAFRLHSPAAGQFSWWDYRAAAFRRNLGMRIDHI
FT                   WVSSPLAERCSACWIDAQPRAQPSPSDHVPVAASFR"
FT   CDS_pept        complement(135008..135190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0141"
FT                   /note="ORF_ID:gsl0141"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88082"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88082"
FT                   /db_xref="GOA:Q7NPB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPB4"
FT                   /protein_id="BAC88082.1"
FT                   /translation="MCIMIINRRPNEAVLWLEFAIHIAVLLAVFFQMALALQAVQQLGA
FT                   GEVYTLPPVLVRPAA"
FT   CDS_pept        complement(135303..135689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0142"
FT                   /note="ORF_ID:gll0142"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88083"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88083"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPB3"
FT                   /protein_id="BAC88083.1"
FT                   /translation="MDECEAVLGANAAFYRAFEKRDIEAMAAVWSQGAASLCIHPGRPA
FT                   LRGWSAVRQSWEQIFKVTAYIEIETEILTCEVQGTLAYVVLMEKVLQAAGGQSASVQSM
FT                   ATNVFALLGGSWYLVHHHGSPIRR"
FT   CDS_pept        complement(135699..136217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0143"
FT                   /note="ORF_ID:gll0143"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88084"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88084"
FT                   /db_xref="GOA:Q7NPB2"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NPB2"
FT                   /protein_id="BAC88084.1"
FT                   /translation="MLCPFCSYSDNRVLESRLAEEGESVRRRRECKQCRRRFTTYERIE
FT                   FVPTVVIKRNGRREAFDRSKVLRGVMIACEKTDVPAELIEQLVDDLQAELQQRSSREVT
FT                   SAEIGEMVLALLKPLNEVAYVRFASVYRKFKGVADFVSELQTFEANAELDSLKARLERL
FT                   AAAHDQSAD"
FT   CDS_pept        complement(136227..136667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0144"
FT                   /note="ORF_ID:gll0144"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88085"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88085"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPB1"
FT                   /protein_id="BAC88085.1"
FT                   /translation="MVHALIWLPLLALFSFLSWAGWNEYQKVQAYSHWAKDFDNAKYDV
FT                   FAMLGRRGDRLVWGRPTRQGPTELQQISLQTVRSVALAVDGRPASPDAPPARARRIALQ
FT                   LALESGQQISIPFTETGLAARWCKLLQQYVSGGPDCPKELIQ"
FT   CDS_pept        complement(136652..137161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0145"
FT                   /note="ORF_ID:gll0145"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88086"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88086"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPB0"
FT                   /protein_id="BAC88086.1"
FT                   /translation="MTGAQQTEALSKMWVMDSQSGEDTTATPTGKGALRPPLCSGPCLP
FT                   SLGRETEQLSGGGNVSHTGGGSAEQPRPPKTIVTPGRARVPEALQAVLDRWPEVSARLD
FT                   DRCLRNLVAYRHELRRIDQVLAMADAQPAGSFWRGVSAWVTMALKRGIVPVKMKISFRC
FT                   CPWCMP"
FT   mobile_element  137109..138595
FT                   /mobile_element_type="insertion sequence:ISGL1a"
FT   CDS_pept        137192..138595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0146"
FT                   /note="ORF_ID:glr0146"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88087"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88087"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M7G3"
FT                   /protein_id="BAC88087.1"
FT                   /translation="MPTIDPWTEHELQHLDLGDARRHTRLKQLLSSLARQPHASLPQAC
FT                   EDAAALKAAYRFLDNPQCHPADIRQAHASATAGRLAALPLVLLIQDTTELNFTAHPHTT
FT                   GLGHLSKPESQGLLVHSLLAVRPDAVALGLCWQKVWTRAAQVEHLAARRQKRPQQHKES
FT                   QRWLDGLAAAKGYVPPGGEAVLIGDRESDMFGLFAAPRPPQLHLLVRAARQRRLATPKT
FT                   LLFEVFAGASAQGHYRCDLARRPGRAARQARLQVYWQAVQLQPGRNDQTHKGQPPVSVW
FT                   VVRAWEVDPPAGEEGIDWWLLSSQPVTTLEQALACVHRYTLRWLIERYHYILKSGCAVE
FT                   QLQLETAQRLERALAVYCIVAWRLLQLTYQSRSEPELPCTVALAQHEWQALYCRMTQSR
FT                   QLPEEAPSLRQAVRWIAQLGGFVGRKGDGEPGVKTLWRGWQRLEDLAAGWLIARSAMAG
FT                   DGNEDVGNG"
FT   CDS_pept        complement(138540..139265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0147"
FT                   /note="ORF_ID:gll0147"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88088"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88088"
FT                   /db_xref="GOA:Q7NPA9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPA9"
FT                   /protein_id="BAC88088.1"
FT                   /translation="MYAEIFESERAPALAEQQGPTRRPGRALPFYTGGLAKARRQTAEQ
FT                   ARALVEELATDHRWTGLVHERVSRSRAHTIGRIVEAVIGLVDRAGYCWASAETIADYAG
FT                   CDRSTVFRLWPEIEFAGLLVSVRQAHGPNRVYLGATLIDRMLALLNTTGWAANPASPFW
FT                   LRYRQWLGQSVAYRHSRAALEPSALKSRLNLTPNCHKRRLINKFNVPSTWLSPEHSPPK
FT                   AAIRYPHLRSHRPPSLSGR"
FT   CDS_pept        139525..139863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0148"
FT                   /note="ORF_ID:glr0148"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88089"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88089"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPA8"
FT                   /protein_id="BAC88089.1"
FT                   /translation="MPPPPIPEPVSGRMDIAIKINQLPQAQKLKDGWRRFFVQAGDVRV
FT                   MVTVRPKIFERLVQTTARYPLWVAVITGQMGVSIGGRHFQLEQPNLQVFERKPKPERPP
FT                   QPQAAAAE"
FT   CDS_pept        139924..140511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0149"
FT                   /note="ORF_ID:glr0149"
FT                   /note="probable chromosome partitioning protein, ParA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88090"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88090"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPA7"
FT                   /protein_id="BAC88090.1"
FT                   /translation="MKILTLTGYKGGVGKSTTAVHLATFFSDHGRTVLIDGDPNRTSMQ
FT                   WAQRGKLPFSVADERQAMKAVTGAEWIIIDTPARPDGTDLQELAKGCDLLILPTAPDVL
FT                   SLRPMLETAQALGQARYRALVAIVPPRPSREGEAMRDELDKNGVPVFRTLIRRSAGFAK
FT                   AALEGVPVRDVSNPRARLVWTDYRALGNVSSG"
FT   mobile_element  140495..141457
FT                   /mobile_element_type="insertion sequence:ISGL2a"
FT   CDS_pept        140569..141444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0150"
FT                   /note="ORF_ID:glr0150"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88091"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88091"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPA6"
FT                   /protein_id="BAC88091.1"
FT                   /translation="MPSLEALFCHVDDFCRRFEPLWQQQLLDDGLRHRRRPRRLCLSEI
FT                   LTILIAFHQSAYRHFKAFYTQMVWGYWRSAFPGLVSYPRFVEWMPSTLLPLSAYLRHCF
FT                   GRCTGISFIDSTPLHVCHVRRVHAHKVFAALAAWGKSSVGWFYGFKLHLVVSERGELLA
FT                   MSVTPGNTDDRKPVPELLKDLHGKVFGDRGYISGKLGRQLREDFGIALMTKLRRKMTNR
FT                   LMVMTDKLLLRKRGIIEAINDQLKNISQIEHTRHRSEVNFLVNLVCGLIAYCHKPKKPS
FT                   VASDVDQLNA"
FT   mobile_element  complement(141806..143467)
FT                   /mobile_element_type="insertion sequence:ISGL3a"
FT   CDS_pept        complement(141822..143390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0151"
FT                   /note="ORF_ID:gll0151"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88092"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88092"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M793"
FT                   /protein_id="BAC88092.1"
FT                   /translation="MQPSVWQPPVEPSPAEQAILKRIRRAKLFVFLRRIRHQLFDAAFQ
FT                   SELAGIYKDSPCGQPPIPPAQLALATVLQAYTGISDDETIEVLTMDRRWQMVLDCLDCE
FT                   EAPFGKATLIRFRQALIAHGLDRRLIERTIELATSDGGFGSRALRAALDSSPLWGAGRV
FT                   EDSFNLLGHAMRKALRIMVCQTGVGLAQWAEQTGTTLVAGSSLKAALDIDWSQPDECAE
FT                   ALGRLLGALESLESYLDGQTQPPQAGVARCLQAAEQVHQQDVQLNSRGQFVLRRGVSRE
FT                   RRISIEDPAMRHGRKSRAVRIDGYKRHVLKDIDSGLVRAVGITAANRPEAAVTRDIEAD
FT                   LEPQRVKLIELHIDRAYLSSEWVRLRPEDLRIYCKAWPVRNGPYFQKTAFVLDWEAMRI
FT                   RCPQGVTQPFEVGGKVRFPAARCRRCPLQERCTTSPKGRSVSIHPDELLLVELRERQQT
FT                   KEGRAKLRERVSVEHSLAHIGQWQGRRARYLGVRKNLFDLRRVAVVHNLHVLARQEAAG
FT                   RSQAA"
FT   CDS_pept        complement(143605..144051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0152"
FT                   /note="ORF_ID:gll0152"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88093"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88093"
FT                   /db_xref="GOA:Q7NPA5"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPA5"
FT                   /protein_id="BAC88093.1"
FT                   /translation="MYDNFDWEALWVLMLSAIEARRLAAVQIGTEHLLLGIVRQKHSVA
FT                   ARILTSAGFTREVARKAIARTFGRGSRSTKWWNVEISFTADAKRALELAPAILQEFGDL
FT                   QVDTRHLLLAVIRVDSARVERLFEDTGVELADLEESLLSRWQNS"
FT   CDS_pept        144410..147442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0153"
FT                   /note="ORF_ID:glr0153"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88094"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88094"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPA4"
FT                   /protein_id="BAC88094.1"
FT                   /translation="MVYKDTREFDMSILNLRSSSKGSILSHLSEGIVLSCILVFTTSGI
FT                   ANAQEFATTATTIVNNQVDIYALGEGIGIVLAENVTIGGTPVYYEAPEGTREIQYIAPL
FT                   FANGRLLVGYLTDKPSVSIGPGFLRLFPILPVKFIKNLGFPYGRATMVYFGRSSLNYNT
FT                   SDNKHDPYYFNVSTGDWSTCPSETNSSTALFKLAASAVPNTYSISGGFGFDFDGRADPS
FT                   YFDKSTSNWVARFSSVNQTVTLGNFGNSSTDIPAVDDFDADGVSDRTVFRSTTNDWFSI
FT                   YSSLLRNSGRIIRVPSSGTLHTVAPTGSGTLAWMYRSSSSTAAWNPPAYFGSGVTGNPA
FT                   LIRLAYDSSLRAVYRNTSGGLTEYKLPAGGSGWQKVADFGSGIVGNPSLVETVNGNMWV
FT                   VAPNSSGGLSAYSKVYNTSWGLFSNFGSNVFGNPSLIRLAFDGSLQVVVPNGNGLAHYQ
FT                   LPPYGSWQKIADFGSGVVSNPTLLETVNGNMWALVGNSSGGLTAFSRVYGTTWGATSFG
FT                   SGLSGTPAFAKRTSDGALEAIAIKQTGGLAEYRLLPGGSAWTKQADFATSVTGNPLLID
FT                   TTGGNLSVVAPGVSGGLAHYTRGASSGWSGAVASASIPGRGASLGAFPAAGFVGRPIPA
FT                   DYDGDGRADRAAFDANSYTYQIKQSSDGVTRTHGPFKTSSGGTMVFELPGDYDGDGKVD
FT                   PAAVNASTYNGCPFSPDGVCTNFDIVFRSSANGGTNLQTTVVAYGGQPIDGYLYPLVGD
FT                   FDGDGKDDPAYFFPAFNVTYYVSSLNQTVVESGPGCGYGYETVNNFTNVGINFAISPIL
FT                   IDTKGDGFALTAADGGVLFDLQGRGGIAKNAWTETGSDDAFLVLDRDENGTIDDGRELF
FT                   GNHTAQPASVEPNGFLALAEFDKTAHGGNGDGAISAADTVFYRLRLWLDANHDGISQPA
FT                   ELVALQDKGIARLALEYAQSPLKDRHGNAFRYRARVYDQSGATNGRWAWDVFFAVAKPK
FT                   SREGLMPMGKQVLIYQQPVGQ"
FT   CDS_pept        147765..148163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0154"
FT                   /note="ORF_ID:glr0154"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88095"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88095"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPA3"
FT                   /protein_id="BAC88095.1"
FT                   /translation="MVHSVVVLVQRILASVLARHCRSRLPNCLRSPSAIRSNCMPRATN
FT                   AALAAVLACALSQTAAVPQTSNNFQVKTSGPTATHWQFKSTPYTKGTPTGMPPLTPTAQ
FT                   TLTGMPIGTITQFQEEATANVPLGMYEY"
FT   mobile_element  148163..149125
FT                   /mobile_element_type="insertion sequence:ISGL2b"
FT   CDS_pept        148237..149112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0155"
FT                   /note="ORF_ID:glr0155"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88096"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88096"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPA2"
FT                   /protein_id="BAC88096.1"
FT                   /translation="MPSLEALFCHVDDFCRRFEPLWQQQLLADGLRHRRRPRRLCLSEI
FT                   LTILIAFHQSAYRHFKAFYTEMVCAYWRSAFPGLVSYPRFVEWMPSTLLPLSTYLRHCF
FT                   GPCTGISFIDSTPLHVCHVRRVHAHKVFAGLAAWGKSSVGWFYGFKLHLVVNERGELLA
FT                   MTLTPGNTDDRKPVPELLKDLHGKVFGDRGYISGKLGRQLREDLGIALITKLRRKMTNR
FT                   LMVMTDKLLLRKRGIIEAINDQLKNISQIEHTRHRSEVNFLVNLVCGLIAYCHKPNKPS
FT                   VASDVDLLSA"
FT   CDS_pept        149272..149946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0156"
FT                   /note="ORF_ID:glr0156"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88097"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88097"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPA1"
FT                   /protein_id="BAC88097.1"
FT                   /translation="MFVYLLYQSCNPTPLLLDTDGDGFRLTGPAAGVRFDFSGKGKLTR
FT                   TGWTAAGSDDAFLALDRNANGKIDDGTELFGNHALQPSRGKLPKNGFHALAEFDKADNG
FT                   GNGDGVISAGDAVFGSLLLWTDKNHNALSEPDELRPYADAGATAISLTMWPTKVADAHG
FT                   NWFRWVSRLEGAEATGMGGKVFDVIFATEKRPDARPLPAGTEGAHHTTETPIGITDDPD
FT                   CM"
FT   CDS_pept        complement(149691..150434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0157"
FT                   /note="ORF_ID:gll0157"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88098"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88098"
FT                   /db_xref="GOA:Q7NPA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NPA0"
FT                   /protein_id="BAC88098.1"
FT                   /translation="MRDSQTISANISFRKTITPQEWRFRQTSAQNVVSIHLNCGAEQNM
FT                   ALIPCPECTRPMSQKADSCPNCGYNLKRAREEKQQLTQGIALTVFGLLGVGGVYVGFTD
FT                   LFYWGLFGWQIDALIGAAGAVLLAPVVQHRTGPASGRSREARVLQRTRAVHPDRNLPGA
FT                   HIQSGSSVMPMGVSVVWCAPSVPAGSGRASGRFSVAKMTSKTLPPIPVASAPSSLLTHR
FT                   NQLPWASATLVGHIVKEMAVAPASA"
FT   CDS_pept        complement(150634..152166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0158"
FT                   /note="ORF_ID:gll0158"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88099"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88099"
FT                   /db_xref="GOA:Q7NP99"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP99"
FT                   /protein_id="BAC88099.1"
FT                   /translation="MSLSSPKSRLLNRPSNCLPSGEPAAGCAVESGCRTRTKPPYPTHQ
FT                   HKMYYLATEEYQRLPSPLADRYTVVNRSPLVVRDLYPERESTPPDVTLDTAQPYQRLNP
FT                   WRWAIPEVHAQFTPGRCLLLENAPLEEDGAPWPTLGQSWPMAEPLRQLGWLLQLAKLWE
FT                   PCCRQKVVSSLLASANIGVQGWQVRLFYLTQDRVPVSLQALAASWLSLTPMVGELRAVV
FT                   QALAAGKFARIEVLVAALEALAVQTNTGCRVQAVTSATHPGRRELNEDCLVYDPQGRFA
FT                   VVCDGMGGHEGGKLASFLAISSLQQDFACLSYQDSPPSELRAQLAGAAQRAHQRLWRLN
FT                   QRQGRSGRRQMGTTVAACFLRGPLLHTVHVGDSRVYLIDRRHCQQLSVDDDVLNLEVSL
FT                   ARTTRRALHRQSGSGRLTQALGVIPPNDLKPTTRSFLLPEDCLVLLCSDGLSDGDFVER
FT                   HWREAFLPLLDRGNLEAAGAALVEMALLELGHDNISFVLLKYAAAAPRTDAG"
FT   CDS_pept        complement(152222..154165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0159"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /note="ORF_ID:gll0159"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88100"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88100"
FT                   /db_xref="GOA:Q7NP98"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP98"
FT                   /protein_id="BAC88100.1"
FT                   /translation="MSSFEIESLLHENRRFAPPAGFGEGAWIKSLEHYRELCARAEADP
FT                   EGFWADLARSELHWFTPWQQVLDWQEPTARWFVGGKLNLAYNCLDRHLQTRGDKVAVLW
FT                   EGEPGEVRALTYRELHAEVCRFANALKALGVGKGDVVAIYMPLVPEAAVAMLGCARIGA
FT                   PHTVVFGGFSGDALRDRLIDAQARVVVTADGGWRKGAIVPLKPRVDEAVAQAPGVAHVI
FT                   CLKRVGQEVAMEPGRDHWWHELVASRSAECPAEAMDSEDLLFILYTSGTTGKPKGVVHT
FT                   TGGYNLYTHITSKWIFDLHDEDVYWCTADVGWITGHSYVVYGPLSNGATTFMFEGAPNQ
FT                   PDPGRFWQLIEKHRIGIFYTAPTAIRTFIKWGDDWPARYDLSSLRLLGTVGEPINPEAW
FT                   MWYHRVIGQERCPIVDTWWQTETGGIMITPLPGATITKPGSATMPFPGIVADVVDREGN
FT                   SCPPNQGGYLVIRRPWPSMLRTVYRDPERYRQNYWSQVPHAYFAGDGARRDEEGYFWVM
FT                   GRVDDVINVSGHRLGTMEIESALVSHPAVAEAAVVGRPDEIKGEAIVAFVTVESEVETT
FT                   PQLLEELRAHVVKEIGALARPEEIRYAEALPKTRSGKIMRRLLRSLASGSDLTGDTSTL
FT                   EDRSVLEKLREG"
FT   CDS_pept        complement(154170..154478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps20"
FT                   /product="30S ribosomal protein S20"
FT                   /note="ORF_ID:gll0160"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88101"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88101"
FT                   /db_xref="GOA:Q7NP97"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NP97"
FT                   /protein_id="BAC88101.1"
FT                   /translation="MPNIKSAIKRVDVAERNRQRNIAYKSMIKTFTKKFMTRLGEYAQS
FT                   PSEAVLTEVQALLNQTFSRIDKAIKAGVIHTNTGARKKSRLDAALRTALAKAQAKAG"
FT   CDS_pept        154621..154890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0161"
FT                   /note="ORF_ID:gsr0161"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88102"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88102"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP96"
FT                   /protein_id="BAC88102.1"
FT                   /translation="MDLEALHSKRDLLYREAREIHQQRLVLDRNLRRVTGTDPMACQRR
FT                   ALLQAEFDELTIHLRTLSTKIRALSQQIDARLTTVEVWRNEHTG"
FT   CDS_pept        155006..157126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0162"
FT                   /product="penicillin-binding protein"
FT                   /note="ORF_ID:glr0162"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88103"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88103"
FT                   /db_xref="GOA:Q7NP95"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP95"
FT                   /protein_id="BAC88103.1"
FT                   /translation="MTAKFFASMADTWRRHRRAWFIGIVVTLAGALLGLWFALLWDLPT
FT                   AQQVRRFTPENRLIVKAMDGSRLYSAARGPAKQVKYRQIPEYLVQAVVATEDRRFYNHP
FT                   GIDLIGIGRALWRDAEAGEVREGGSTITQQLARNLFLTQERTLWRKFKEILIAARIEQE
FT                   LSKAEILTLYLNQIYFGSGAYGVADAARLYFSKNIEKLTLTEAALLAGLPQAPSRYSPL
FT                   IDKTLARKRRDVVLKNMVEVGYLNAQQYASARKKSVVLRPGPRSEKTQAAYFVDYVRSQ
FT                   LASLLGTESVPGGLTIETTLDPQMQAQAQKALGGALADYRSRRVGQGAIITLDPATGEI
FT                   RAMAGGGDYQKSQFNRTVQALRQPGSTFKTFVYTAAIESGSRPEDILSDRPVRFGAYQV
FT                   KNADRRYYGEMTLVNALKESRNTVAVQLFTRVGEDKVVDVARRMGVRSRLRTGAAMALG
FT                   ASELTLLELTSAHGTLANGGVHVAPTAVRRIVDSQGKVLYAAVPRTRVALSSAVAATVT
FT                   RMLEQVIANGTGRKAAIDRPAAGKTGTSENYRDLLFVGYTPQLVTGVWLGNDDNRPTRG
FT                   SSALAAVLWGRYMGRVMATFPVKAFPALEQSEPLEVSPPMGEEYPAELPEGLEEPSPEP
FT                   EPTGECYESDQGQLVCPNETDSAASPATAEPPPEVPDIPESPASPQNPEEPAETNPSRP
FT                   SAELDRPPAPTP"
FT   CDS_pept        157153..157506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0163"
FT                   /note="ORF_ID:glr0163"
FT                   /note="putative translation initiaiton factor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88104"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88104"
FT                   /db_xref="GOA:Q7NP94"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP94"
FT                   /protein_id="BAC88104.1"
FT                   /translation="MSPDRTVYSTHPRPQPRCEICGELESVCVCEPQFIAPNKQTARLA
FT                   HDRKRRRGKVVTMVSGLILPEAQLDELAKLLKSECGAGGTVKDGEIEIQGEHREKVAGI
FT                   LQKLGFKIKLVGG"
FT   CDS_pept        157512..157802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0164"
FT                   /note="ORF_ID:gsr0164"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88105"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88105"
FT                   /db_xref="GOA:Q7NP93"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP93"
FT                   /protein_id="BAC88105.1"
FT                   /translation="MKFLEDPYQSSGKSPVGRTAPGAVDSDQRPIDTITFRGEIEKGRD
FT                   WVVFVRQMVSRLDGPEAWIRAVAMGVGALLMIFPKAAWCALVKLGIAKDKD"
FT   CDS_pept        157811..158353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0165"
FT                   /note="ORF_ID:glr0165"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88106"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88106"
FT                   /db_xref="GOA:Q7NP92"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP92"
FT                   /protein_id="BAC88106.1"
FT                   /translation="MFLDTKDYPFAAHLEANWRVILAELQQLDNQNFFAWPEKQYYGEG
FT                   WDIFALYTYGVPLGKNCKLCPQTAALVKKIPGMMTAVFSRMAPGLHIAPHRGEPAGLLR
FT                   YHMGLIIPPGCGLRVGPETRSVQEGGSIVFDDTTEHEAWNRSDRERIVLLVDFKSPNAK
FT                   QGFTLASMFQRLRGSKG"
FT   CDS_pept        158496..158714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0166"
FT                   /note="ORF_ID:gsr0166"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88107"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88107"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP91"
FT                   /protein_id="BAC88107.1"
FT                   /translation="MTRFNISEQAERDLTEIRNYIARDNIEAADRLIDGFFEAFERIAT
FT                   MPNAGHRRTGKLDPPGRRLRALIAPAG"
FT   CDS_pept        complement(158895..159194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0167"
FT                   /note="ORF_ID:gsl0167"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88108"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88108"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP90"
FT                   /protein_id="BAC88108.1"
FT                   /translation="MRVVITAAARADLVAIGSFIRLHNLERAIIFVDELLDRCLALADM
FT                   PRAFPLVPRYEQFNIRRCVYRDYLIFYRVRGSLIEIVHILHGAQDYETLLFPSP"
FT   CDS_pept        complement(159191..159466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0168"
FT                   /note="ORF_ID:gsl0168"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88109"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88109"
FT                   /db_xref="GOA:Q7NP89"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP89"
FT                   /protein_id="BAC88109.1"
FT                   /translation="MRPAEKLSITLPSEMADFIRQKVDSGLYASNSEIIREALRGMMER
FT                   ERRLERLDTAIARGLADAEAGRVQDIDQMRTELRDSFTNGPEHFPV"
FT   CDS_pept        complement(159622..160164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0169"
FT                   /note="ORF_ID:gll0169"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88110"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88110"
FT                   /db_xref="GOA:Q7NP88"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP88"
FT                   /protein_id="BAC88110.1"
FT                   /translation="MVSKKRLIVIPGDQGSPAKRAATVAFCAALGLPHRLLAPEAPPYL
FT                   PGSVRALLADCTGCSVVVIAFSAGVVGAAAALQRSYLVGAGITIEALIALDGWLVPLFH
FT                   AFPIYRLSHDAFTHRTSLPFGMGRTNFFADPAVAHLDLWTAPNRVVGWQVTGNTRVPTT
FT                   ALAFIYSRLREHSCTAD"
FT   CDS_pept        160245..161249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0170"
FT                   /note="ORF_ID:glr0170"
FT                   /note="similar to ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88111"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88111"
FT                   /db_xref="GOA:Q7NP87"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP87"
FT                   /protein_id="BAC88111.1"
FT                   /translation="MAVLLVGYGEVEEYQNFAAYNEMALRLLTAKFLKIPEFGFKLLAG
FT                   TLARKDRREWAGRDNFRSPHNDVFEAQRAGIARHLQEHFGDRVEIFKAFNFCEGYLPQQ
FT                   VLAQIRARGFRRLLVYPLLVIDSIFTSGLALQQINEALAEEERWVDELRYLPSFYNESD
FT                   FHERLASHIESHLLRLSVRHQPSRIGLVLVNHGSPYEVKGFTTGIEESQVLYERVRERL
FT                   ITRYPLISIGWLNHDTPGKWTTPDVPQAARNLLTVGASTLVFCPIGFVTENHETILDVE
FT                   AIMRCFEQKAIPCTRLDCLNDDPEFLAAAAGWVVPLVGELLAARATQPVAAQD"
FT   CDS_pept        complement(161268..162440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0171"
FT                   /note="ORF_ID:gll0171"
FT                   /note="similar to fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88112"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88112"
FT                   /db_xref="GOA:Q7NP86"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP86"
FT                   /protein_id="BAC88112.1"
FT                   /translation="MENAGLSYVDHVALSVILPTESNPMSFDTMVASYASARRVRKQLS
FT                   KEVRRRSTPRGIASFAFCFAVYLLAFTGFLLLPWWWAKAICSIALGLAIAQLFHVGHDA
FT                   GHGVLTTNSTLNVWLGRVAFLPLLHAFNLWDANHNQLHHIYTNFAPLDRFWAPLSRKEY
FT                   DELSPLHRFAQRMYRSGWGSGVYYLNIWRQFLLVPNPLLQDKIKSTLDTWLVFGFGSVQ
FT                   ILLLIWVPNWLADVTGWPVMPWWVSILGGLVVPMLIWSWLLGTATYLQHNHPSIAWYSK
FT                   FEEWSFYRGQVGSTVHIKLPAFWRLLTWNLMEHTAHHVDVGISFAKLNDAQQLLQKAYG
FT                   EHITADALSWGSFLDTLRRCKLYDYENHRWLDFDGNSTIAGTNLRVPEQP"
FT   mobile_element  162573..163734
FT                   /mobile_element_type="insertion sequence:ISGL11a"
FT   CDS_pept        162634..163749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0172"
FT                   /note="ORF_ID:glr0172"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88113"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88113"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP85"
FT                   /protein_id="BAC88113.1"
FT                   /translation="MTLSRTATETVALVDCYCRAYEHLFVDVRSFEHFKLLHFGLIAVS
FT                   PRKTLPAIARVLGTEDAQALHHFVANSPWDARILRQQRLNLVRQTLRQRPFLLCIDETG
FT                   DRKKGRTTDYAARQYITNLGRVENGIVSVNACGVLDGAVFPLTFKVFKPEHKLKSSDQY
FT                   KSKSQLAVQIIEELMGQEFCFEMVLADCLYGESRQFIEALEGWGFKYAVMLRGSQGVWM
FT                   PQGRNIRLTRWRQFNCVFDADEHQPYYIREALFGRRLTPRFCFVTTDPRLLPVETTRLI
FT                   MTDLEGDLPGIVGHYYRLRARIVQRFKRMKNGLGWADYRLTEYAAIERWWELVLSACWM
FT                   VSQQSQAFAESLAFWADGSERSVLTEETPEP"
FT   CDS_pept        complement(163771..164622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0173"
FT                   /product="ABC transporter permease protein"
FT                   /note="ORF_ID:gll0173"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88114"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88114"
FT                   /db_xref="GOA:Q7NP84"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP84"
FT                   /protein_id="BAC88114.1"
FT                   /translation="MSNTVDTTARPARSGEPFRPRPRPLLGIRTDVPKNAYLLAMTLSI
FT                   AVPLAGWVLLSVGGRVDPLFVPTPLAVWQAAVRLAQSGDLLNDSLASLSRVGLGFLLSA
FT                   LVAIPLGLLIGTFKLVEGLFEPVLGLFRYMPAAAFIPLIILWVGLDEPAKVAIIFIGSF
FT                   FYNTLMVADAVKFVPADWLKVSYTLGAGRRDAFFRVILPATLPSVIDTLRINIATAWNF
FT                   VVVAELVAANSGLGYRILVSQRFLKTDEIFVGILVIGLIGLAIDALFKWLFRLAVPWAV
FT                   DA"
FT   CDS_pept        complement(164619..165407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0174"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:gll0174"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88115"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88115"
FT                   /db_xref="GOA:Q7NP83"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP83"
FT                   /protein_id="BAC88115.1"
FT                   /translation="MTDPPTLQIRHLSKLFSTKSGPLLVLDDISMSVKAGEFACLVGAS
FT                   GCGKSTLLNIVAGLEDPSAGEVLLSGSPVAGPGADRGMVFQNYTLYPWLSVRGNVEFGL
FT                   KLRKQSAPERRERVDHYLEIVGLAKFADSLPRALSGGMKQRAAIARAMVNEPQILLLDE
FT                   PFGALDCQTKETLQEFLLSVVRRTGITVLMITHDVEEAVFLADRVYAMSARPGRIAREV
FT                   HVSLGRDRCLACKRTAAFQQIEQDILDLLRARVPLAEETR"
FT   CDS_pept        complement(165404..166420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0175"
FT                   /note="ORF_ID:gll0175"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88116"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88116"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP82"
FT                   /protein_id="BAC88116.1"
FT                   /translation="MDLADFALHRWTRRSVLTLGGLALAGCTGGGDGATRPAGTSFGIV
FT                   DWVGYTPLYIAREKGYLPEAFNVRNFPSPGQGTLAFAGGKLEGGAEVTAGAVDVRAKGK
FT                   DLRVVMVVDRSVGGDGILARHSIRDLADLKGRKVALELGSVSHFFFLQAIAGAGLSGRD
FT                   ITIINTPPDAAGAAYRSGQVEAAVTYAPYLGSANRAQADGRILFDSARLPDAISDIYVF
FT                   DARFVQAHPEVVQGFVDAVLKGLADLQADPQAGYALTARLLNITPAEVEDYLRGLQLAD
FT                   LALNIDMLTNPNSKSYLPNALQSLARFLKDQGQIPAVPDLTNVVDPRFVLAARATQR"
FT   CDS_pept        166647..168581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0176"
FT                   /note="ORF_ID:glr0176"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88117"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88117"
FT                   /db_xref="GOA:Q7NP81"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP81"
FT                   /protein_id="BAC88117.1"
FT                   /translation="MSLALLAASAGAAAQTKPPAPAPSAPEDVPVPVPGSLGLAGARCA
FT                   DISRYLNARAAVNPSLSPDGGELVYRTGVSGQPQLWVNGPDGPRQITFGESVNIAAWSP
FT                   AGDGIAYSVDRGGDEREGYYFISPDGKRERELVAPADSFRVWGGFSRDGSQVAYAATEP
FT                   GKADFNVYVLTVATGQTRRVLSGQAGIYPVAWRPDGKALVLSRVRGEDANDLLYLDLTT
FT                   GQASDLLAPPEASAYTQIAWTPDGKGFYLSTNQDRDFAALAYYDFAARKLRTVETPAHD
FT                   VEAVALSGDGRYLAWSENVGGFSEARLRDLRTNRTVPILGLPKGVIQTLSWAERAPRLA
FT                   FQVSGPQVPGDVWVLNAQRGDLKRVTKSATGGLDESTFVIPAAVSFKSHDGETIYGLLY
FT                   RPAGATTRTLPPAVVMVHGGPTAQARPDFDAATQYLVARGYAILDLNFRGSTGYGKRFA
FT                   RLDNGRLRPNAVKDMASAVEWLGTQDLDNRRVAVMGGSYGGYMTFAALTTLPDVFQAGV
FT                   GFVGVSNWVTALEGASPQLKASDRYEYGNIDDPAEREFFTQLSPITYVKQVRSPLMVLH
FT                   GANDPRDPVGEADQLVDALRSQGGDVEYLRFPDEGHSIRKLTNRVIAYRRIAAFLERTI
FT                   GKGIAVCGG"
FT   CDS_pept        complement(168961..170742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0177"
FT                   /note="ORF_ID:gll0177"
FT                   /note="reverse transcriptase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88118"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88118"
FT                   /db_xref="GOA:Q7NP80"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP80"
FT                   /protein_id="BAC88118.1"
FT                   /translation="MVEWNSLNWRQIQRRVFKLQTRIFKASQRGDFKAVRKLQKLLIRS
FT                   WSARCLAVRRVTQDNQGKKTAGVDGVKSLTPKARLALTKNLRISEKAKPMRRVWIAKPG
FT                   TQEKRPLGIPTMTDRARQALLTLALEPEWEARFEPNSYGFRPGRSCHDALQAIYNAIRQ
FT                   QSKFVLDADIAKCFDRIDQQALLKKMNTSSAIRRQIRAWLKAGVMEGSELFPTPTGTPQ
FT                   GGVISPLLANIALHGMEERVKQVSKMAQLIRYADDFVCIHTDQQIVQSCQTVLEEWLAG
FT                   MGLELKPSKTRIAHTLLLEEGQPGFDFLGFTVRQFPVGKYHTGTNSRGKPLGFKTIIKP
FT                   SKKSIKTHTEKLRRIIHKHKAQPQSFLIEHLNPIIRGWTHFFSKVVSGATFKKLDRTLY
FT                   MQLKAWATSHHRNQSQKWLARKYWLTIGTQNWCFAVQKGEGIKRLVQHSDRPITRHVKV
FT                   KERRSPYDGDWVYWSNRIGQHPQIKAEVARLLKSQTGKCTHCGLYFMNGELLEVDHRKP
FT                   KRFGGRNISSNKQLLHRHCHHQKTAAERIQQLQSQSRITEAERLQLQAKRQALLEDYQP
FT                   YKSKKRLTDAEWMQQWH"
FT   CDS_pept        171416..172066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0178"
FT                   /note="ORF_ID:glr0178"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88119"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88119"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP79"
FT                   /protein_id="BAC88119.1"
FT                   /translation="MPVRMATYALFVLNRYGQVPDQVLILLKDSEAARQVPDRFEQGRV
FT                   RVEYDVIRLWEQDPELLLASGLVGLMPLVPLMRGEDVSSLLERCTALIESEIESGQERN
FT                   EVLAVTGLLASLKDRRIVQAFFRTKSMLSLLQETPLFQELTQELVREADRRARLQFLQH
FT                   QLEHKFGPMPEDVLTALQAITDVDALARLGIAVLDAMDIDAFRQQLPLRSEAG"
FT   CDS_pept        172112..172312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0179"
FT                   /note="ORF_ID:gsr0179"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88120"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88120"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP78"
FT                   /protein_id="BAC88120.1"
FT                   /translation="MAVKSTGYILIFGTAFVISTTARVPGGPAIAQDKPELLEAAERLL
FT                   ANPGFIEPNGKPLLRAKINVG"
FT   CDS_pept        complement(172498..172833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0180"
FT                   /note="ORF_ID:gll0180"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88121"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88121"
FT                   /db_xref="GOA:Q7NP77"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR035668"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP77"
FT                   /protein_id="BAC88121.1"
FT                   /translation="MFRPLPTLALVLAAVPAAVLAAPAPPPATVIAIESFQFTPEAVVI
FT                   PKGSRVTFLNKDAAPHTATPEEDGAKFAGTGRLLAGESKTLTFPDKGVYNYFCEFHTTM
FT                   KGRVTVR"
FT   CDS_pept        complement(172840..173451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0181"
FT                   /note="ORF_ID:gll0181"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88122"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88122"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP76"
FT                   /protein_id="BAC88122.1"
FT                   /translation="MDNAMRAASRRSVLLAGAAGTLSLMAGTRLAFGQDKGDLAILQAA
FT                   HDLESQAIWAYGAAAGKLSKTDVGKTVLELALRNQADHKSHRAALADAIKSLGATPAPA
FT                   KDSYDLSAYLKAGEGGLDSDANIAKLALALEIDAALAYQSAFGKLKTPALQAAASSILP
FT                   AEAGHATAIRAVFHGLMPTVQEVPAAFLSAQTRKDWILKV"
FT   CDS_pept        complement(173588..173872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0182"
FT                   /note="ORF_ID:gsl0182"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88123"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88123"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP75"
FT                   /protein_id="BAC88123.1"
FT                   /translation="MQRIDVEFYGQEGHPMLAAQTQPKLFVTECGVVLFTYLGLTKFKD
FT                   DLYDAWQTAVELMDGQTVHGTVVRPPGVLPDLECADDLAQQLWEEDRAA"
FT   CDS_pept        complement(174026..174970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0183"
FT                   /note="ORF_ID:gll0183"
FT                   /note="probable pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88124"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88124"
FT                   /db_xref="GOA:Q7NP74"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP74"
FT                   /protein_id="BAC88124.1"
FT                   /translation="MQNVYQVPVNPGTGTPMNQGWTYCDRIGPESAGLTVLEYYLLRYR
FT                   HSGDHEWQARIETGQVLLDHRSTSSTELLRSAQVLTYCRPPWQEPSVPLDIVIIYADEQ
FT                   VLVVAKPGGLPVLPGGGFLEHTLLWQVRRRFAGEEPPVPIHRLGRGTSGLVLLARTHSS
FT                   RAALSEQMRRQRIGKLYRALASGTGMRDRFTIRQPIGKVPHPLLGTLWAAAADGLPARS
FT                   DCVVLRRQCTDSLLAVAISTGRPHQIRIHLAAAGYPLVGDPLFGPGGVARLDNDASVPG
FT                   DGGYFLHAHRLSFLHPTSGRRLVLECPPPPELT"
FT   tRNA            complement(174970..175042)
FT                   /product="trnE-CUC"
FT   tRNA            175145..175216
FT                   /product="trnK-CUU"
FT   CDS_pept        175511..175750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0184"
FT                   /note="ORF_ID:gsr0184"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88125"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88125"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP73"
FT                   /protein_id="BAC88125.1"
FT                   /translation="MFLKTQMDGDLVEVLSIDDLFNPLKTVVTGRLQAGEEVQEIEVFS
FT                   KAELVFPSGELLPRCWSDKDYRQTTGRSTHLQTA"
FT   CDS_pept        175825..176400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0185"
FT                   /note="ORF_ID:glr0185"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88126"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88126"
FT                   /db_xref="GOA:Q7NP72"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP72"
FT                   /protein_id="BAC88126.1"
FT                   /translation="MKNAQTVGWNLWLQWVLAYALGSLAGGAIARPLGEAVGSVLGAAV
FT                   AGLVVGAALGLAQAVVLGRYLKAGTPWIRATALGSALGSLLGGTTEWLALNRMGLPDLP
FT                   SNVLGMTVVGACLGVAQWWAVRKQFPQFGWWILGNTIALAIGPIVTLLAVLALGYFGPA
FT                   LTVFLRPLVSAAVSGGVLVGLLREAKIE"
FT   CDS_pept        176664..176882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0186"
FT                   /note="ORF_ID:gsr0186"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88127"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88127"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP71"
FT                   /protein_id="BAC88127.1"
FT                   /translation="MNALRLPILVGCLQTKPAKPSAIHKFLLLSGAPVGNTAIRYLRGR
FT                   CDQTPWRGRPIGRVETTLARILASSLN"
FT   CDS_pept        complement(176887..177228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0187"
FT                   /note="ORF_ID:gll0187"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88128"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88128"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP70"
FT                   /protein_id="BAC88128.1"
FT                   /translation="MPPGSQRLRWVHSTDAAMNEFPADAGFARPALPGDHDDEHLPELE
FT                   GVEELSLAIGRLTDRLDHFAEELERRTDAYRNGARRAIPEPETVERWETFILRTRQEFD
FT                   TLSRLGWPL"
FT   CDS_pept        complement(177242..177820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0188"
FT                   /product="TetR family transcriptional regulatory protein"
FT                   /note="ORF_ID:gll0188"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88129"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88129"
FT                   /db_xref="GOA:Q7NP69"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041478"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP69"
FT                   /protein_id="BAC88129.1"
FT                   /translation="MSDTTRSRILEAAELLLRRHGPAKLTVTDVARHLGMSHANVYRHF
FT                   ASKADLLDAVAERWLHTVSGALEPIALADGPAAERLEDWAVGLWQQKRRKISDDPEHFA
FT                   MYHGVAEAARGVVARHVETLLGQLERILADGAASEEFQMTDPAAAARAVWNATVRFHHP
FT                   HLVTADPACEAELRAVLALVTAGLRTGAL"
FT   CDS_pept        complement(177871..178851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0189"
FT                   /note="ORF_ID:gll0189"
FT                   /note="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88130"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88130"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP68"
FT                   /protein_id="BAC88130.1"
FT                   /translation="MEQRQLGKGGPRVSALGLGCMGMSDFYGKADEQESIATVHQALDA
FT                   GITLFNTGDFYGMGHNEMLLREALADRREQVFLSVKFGAQRAPDGTFLGFDARPAAVKT
FT                   ALAYTLRRLGTDHVDLYQPARIDPAVPIEETVGAIAEMVQAGYVRYIGLSEASAATVRR
FT                   AHAVHPIAALEIEYSLLTRDIEAEVLPTVRALGIGLVAYGVLSRGLLSDRATGTFAADD
FT                   FRAHLPRFAGENLQNNLALVEALRALAAEKGVGVAQLAIAWVLARGEDIVPLVGARRPA
FT                   RLSEALAAAQVHLSAEDMARIEAAVPTAAVAGTRYSTDQMAMLDS"
FT   CDS_pept        179009..179830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0190"
FT                   /note="ORF_ID:glr0190"
FT                   /note="probable monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88131"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88131"
FT                   /db_xref="GOA:Q7NP67"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP67"
FT                   /protein_id="BAC88131.1"
FT                   /translation="MGQHERRREQLDFALELARVAEEAIMPHFRTAVAEYKGDGSEVTA
FT                   ADRSAERVIRERIAGAYPGAKILGEEFGGEARPVSGEQWVIDPIDGTTSFVLGLPMFGT
FT                   LIALLEDSQPVVGVIHMPAMGETVYAGRGLGCWFAYSGGRAVRVRAAPEVELQAAFASA
FT                   TGAHCSDIQHQAAQTPYRLAALINTTKKFRFVGDCVQHALVCRGRLHLAVDTLMNPWDT
FT                   AALVPCVREAGGVAATLEGKEDDVVFGGNFISVCSRALLHEALAVLSPVQK"
FT   CDS_pept        179836..180450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0191"
FT                   /note="ORF_ID:glr0191"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88132"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88132"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP66"
FT                   /protein_id="BAC88132.1"
FT                   /translation="MAYGLHWEWRGFGPLDPAVRERIEALPTAQPGVREETDSYLWTPQ
FT                   CTANVKFRTFGEGSLKFKRPVGVNGPLQLWLEDPREDYRFPVPPEAVRELAAVLGVVLP
FT                   TANGPVEQATLWQWLQQAEGVRIVEVKKRRTVHTWLGNGMQASVELADILTPQPLQSVG
FT                   IEGADETDEAANAVVGARDALEVSDTLVALSYLDILRRWTG"
FT   CDS_pept        complement(180454..181413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /product="quinolinate synthetase"
FT                   /note="ORF_ID:gll0192"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88133"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88133"
FT                   /db_xref="GOA:Q7NP65"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP65"
FT                   /protein_id="BAC88133.1"
FT                   /translation="MLTIQRPAIDPRLDLFAEIERLKRELNAVILAHYYQDPDIQDVAD
FT                   YIGDSLGLSRQAAATDARVIVFAGVHFMAETAKILNPTKQVLLPDLAAGCSLSDNCPSD
FT                   RFAEFLRAYPGHIVISYINCSAAVKALSDIICTSANAVAIVNQIPKDQPIVFAPDRNLG
FT                   RYVMAQSGREMVLWPGTCIVHETFSERKLIALKVRHPDAEVIAHPECEPAVLRHADFVG
FT                   STTALLKYAGTSDRRAFIVVTEAGILHQMQKAHPDKLFIPAPPEADCACNECPFMRLNT
FT                   LEKLYLCMRDRTPEVTLDEATRLRALTPIERMLAMSPK"
FT   CDS_pept        181556..182584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0193"
FT                   /note="ORF_ID:glr0193"
FT                   /note="carboxysome formation protein CcmA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88134"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88134"
FT                   /db_xref="GOA:Q7NP64"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP64"
FT                   /protein_id="BAC88134.1"
FT                   /translation="MIVIMRPEATEADIAAVCQRANEMGLAGHPCYGVQQATISIIGFD
FT                   ESVSPGDFSSLGGVDRVVRVSTPHKLASRQSGLPATAIKIAPGITVGSGLTFVAGPCSV
FT                   ESREHIVHTARLVKAGGASMLRAGAFKPRTSPYQFRGLGEAGLDYLAEAGAAAGLPVVT
FT                   EVMTPALVEKVAARADVLQIGTRNMQNYDLLLAVGRTDKPVLLKRGMSATLTEFLLAAE
FT                   YILSAGNPNVILCERGIRTFETHTRNTLDLSAVPALKTLTHLPVVVDPSHGTGRRELVL
FT                   PMARAAVACGADGLLVEVHPDPDRSISDAQQAISPEMFAQLVRDCQAIFAALHPEAART
FT                   PV"
FT   CDS_pept        complement(182701..184617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0194"
FT                   /product="1-deoxy-xylulose 5-phosphate synthase"
FT                   /note="ORF_ID:gll0194"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88135"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88135"
FT                   /db_xref="GOA:Q7NP63"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NP63"
FT                   /protein_id="BAC88135.1"
FT                   /translation="MNLSDLSHPNQLRDLSVSQLGRLAQQIRDKHLQTVAATGGHLGPG
FT                   LGVVELTLALYKTLDLDRDRVVWDVGHQAYPHKMLTGRYANFHTLRQKDGLAGYLKRAE
FT                   SPFDCWGAGHASTSISAALGMALARDFQGLNRKVVAIIGDGALTGGMALEALNHAGHLS
FT                   KTNLMVILNDNEMSISENVGGLSLYLNRLRTDPALRQIRSNLETQLRNIPLVGPTFSPE
FT                   FERFKDTVKYMTMTRSKAGVIFEELGFTYLGPIDGHNLGDLIETFEFAHSLPGPVFLHA
FT                   ITVKGKGYEVAEQNQIKYHAQSAFDLATGKAKPASKPTPPAYTSVFAQTLVKLAEQNEK
FT                   IVGITAAMPTGTGLDKFKERFADRYFDVGIAEQHAVTMAAGLAADGMRPVAAIYSTFLQ
FT                   RAFDQIIHDVAIQDLPVFFCLDRAGVVGEDGPTHHGVFDLAYLRQIPGLVVMAPKDEAE
FT                   LQRMMVTGIQYTKGPIAVRYPRGSGSGAPLMAEGWDPVPIGKAEVLRSGDDLLIVAIGT
FT                   MVHPSLQAAALLSEHGIDATVVNARFAKPLDTELLLPLARRIGRVVTVEEGCRMGGFGS
FT                   AVLEALMDGGIAVPTLRIGIDDKFVTHAGRSQLLDLLGLTPSGIAKTIRESLSTEPVSA
FT                   PRA"
FT   CDS_pept        complement(184746..185792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0195"
FT                   /product="translation initiation factor IF-2B alpha
FT                   subunit"
FT                   /note="ORF_ID:gll0195"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88136"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88136"
FT                   /db_xref="GOA:Q7NP62"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NP62"
FT                   /protein_id="BAC88136.1"
FT                   /translation="MTFSAVQSEIRPVQWNGHTCVLIDQTVLPGIYRTIEIRTSDQMAT
FT                   AIRTMIVRGAPAIGVAAAFGMVLGWQEAPQGDPITHLERVAATLRATRPTAVNLFWAID
FT                   RMLTVARRDPSFARLEREATAILEGDIATCRAIGEHGLLALPAAPERLRLLTHCNAGAL
FT                   ATAGYGTALGVVRSAHRADRLERVYADETRPRLQGARLTAWELVHERIPVTVLADTMAA
FT                   HVIGRGLVDAVVVGADRIAANGDTANKIGTCGVAIIARHYGVPFFVAAPWSTVDLNLSS
FT                   GEQIPIEQRDSEEMRAIEGVALCPQGVEFYNPAFDVTPASLVTGIIVESGVYAPGELAA
FT                   AGQVRLGR"
FT   CDS_pept        186131..186520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0196"
FT                   /note="ORF_ID:glr0196"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88137"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88137"
FT                   /db_xref="GOA:Q7NP61"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP61"
FT                   /protein_id="BAC88137.1"
FT                   /translation="MAPLQGRDLLKLIKENQGKSAKQLAELAGYTTTTKSGQKRVKMLA
FT                   FQSAILQANNISLIPRHEEGEGVRGGRKASYRIQVQQNGNLLIGTAYTRQMGLEPGTEF
FT                   EIQIGRKHIKLVQLDSPDSPQTNED"
FT   CDS_pept        complement(186607..188937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0197"
FT                   /product="alpha-glucosidase"
FT                   /note="ORF_ID:gll0197"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88138"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88138"
FT                   /db_xref="GOA:Q7NP60"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR030458"
FT                   /db_xref="InterPro:IPR032513"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP60"
FT                   /protein_id="BAC88138.1"
FT                   /translation="MPQYFGKLPTNGAPWSVLANVCDLERDGRGITVDCGGPKLRVGVL
FT                   APNLVRVRLTPTGAFFPQRSWAASKEDSAWPETEFSMHQRAGSIEIATEHLRVVVESEP
FT                   CRIACYDRQERPFACDSAPAMGWHTGAVAAWKAIEAGEHFYGFGERTGLLDKLSQRKTN
FT                   WTSDALDYGSLTDAMYQAIPFYIALRPGLAYGVYFNTTFHSHFDLGGDEPGRLRLETQG
FT                   PELDYYLIYGPTPAEVLATYTELTGKMELPPIWALGYHQCRWSYGSEAEVRELAYEFRS
FT                   RRIPCDVIHLDIDYMRGYRVFTWSPKRFADPSGLIADLADQGFRTVAIVDPGVKYELDA
FT                   GYAVFEEGLQKDYFVRQADGRLFHGYVWPDKAVFPDFMRAEVRAWWGSWHKQLTEMGVA
FT                   GIWNDMNEPAIDDRPFGDSGNKISFPLDAPQGDLAERTTHAETHNLYGQMMVRACREAM
FT                   ARLRPAERSFVLTRAGFAGVQRHAAVWMGDNQSQWEHLEMSLPMLLNMGLSGVAFVGAD
FT                   IGGFAENATAELFTRWMQVGILYPLMRAHSALGTARHEPWVFGERVENICREYIELRYR
FT                   LLPYLYSLFWRASTAGEPVLRPLLYHYPDDERTYHLHDQVMLGPALMAAPVLRPGVDCR
FT                   AVYLPGGTWYDWWSGKGHTGPGWILAPASLERLPLFVRAGAAIPMAPVRQHTGDWPPTG
FT                   LIWRVFPGHGTGTLYEDDGHSFAYRKHQWTLTTVRVEGTRVTFDERHGDHPRPDRDVQV
FT                   ELVGRGTQSFHDDGSARQLQFDP"
FT   tRNA            189181..189256
FT                   /product="trnL-UAA"
FT   CDS_pept        complement(189511..190407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0198"
FT                   /note="ORF_ID:gll0198"
FT                   /note="similar to bacterioopsin"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88139"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88139"
FT                   /db_xref="GOA:Q7NP59"
FT                   /db_xref="InterPro:IPR001425"
FT                   /db_xref="InterPro:IPR017402"
FT                   /db_xref="InterPro:IPR018229"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP59"
FT                   /protein_id="BAC88139.1"
FT                   /translation="MLMTVFSSAPELALLGSTFAQVDPSNLSVSDSLTYGQFNLVYNAF
FT                   SFAIAAMFASALFFFSAQALVGQRYRLALLVSAIVVSIAGYHYFRIFNSWDAAYVLENG
FT                   VYSLTSEKFNDAYRYVDWLLTVPLLLVETVAVLTLPAKEARPLLIKLTVASVLMIATGY
FT                   PGEISDDITTRIIWGTVSTIPFAYILYVLWVELSRSLVRQPAAVQTLVRNMRWLLLLSW
FT                   GVYPIAYLLPMLGVSGTSAAVGVQVGYTIADVLAKPVFGLLVFAIALVKTKADQESSEP
FT                   HAAIGAAANKSGGSLIS"
FT   CDS_pept        complement(190723..190872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0199"
FT                   /product="CAB/ELIP/HLIP related protein"
FT                   /note="ORF_ID:gsl0199"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88140"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88140"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP58"
FT                   /protein_id="BAC88140.1"
FT                   /translation="MDSNKSVENNGQDRNAFVFGLSPQAEIWNGRLAMLVATYVLLKDV
FT                   LHLF"
FT   CDS_pept        191454..191816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0200"
FT                   /note="ORF_ID:glr0200"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88141"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88141"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP57"
FT                   /protein_id="BAC88141.1"
FT                   /translation="MAKLFRFIPTPEAIQDRSNVSALKKRLDWGEPALTIVDVRDKNAF
FT                   NTRHIAGAIAMPMGELIERANDSLEQVRDIYVYGETDEQTAEAASRLRGAGYEHIAELV
FT                   GGLTAWKAAKYPIEGV"
FT   CDS_pept        192212..192895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0201"
FT                   /note="ORF_ID:glr0201"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88142"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88142"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP56"
FT                   /protein_id="BAC88142.1"
FT                   /translation="MVFAGGGFLSQLAAGIGTVVGGDAILSEMKEDDGTQGASAQAGAQ
FT                   TDPYGGESMGYASGAGMVAGSDMYTDAYAPGGYSDVGATAGDPYMSGMTDYGSMGLEAG
FT                   FEQPYGGMMGGDDFGFAQGYGEDESFTAMGGFDVGAEDAEMQGGFGTGVQDDEMEGEFG
FT                   EKQLAQLEEEEGSLPGEEPGEEGDLLGDAFSDVGDVASELGDFDLFGAVGEIGEGIGDF
FT                   FGNIF"
FT   CDS_pept        complement(193373..194344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0202"
FT                   /product="pilin gene inverting protein"
FT                   /note="ORF_ID:gll0202"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88143"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88143"
FT                   /db_xref="GOA:Q7NP55"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP55"
FT                   /protein_id="BAC88143.1"
FT                   /translation="MRLFWESTLRSCPFRLRCSSRASCAPRASKIPPPDLNNCVTGSIS
FT                   SNSNTYMLAWKPLVAISKLWLIICINRVIQSAVNPKRIKGYAQAQMQRSKTDQLDATVI
FT                   AHFCAALHPQTWQPPAEAVLVLQSLLRRFEGLQQMRQQEENRRQMPQVCAEVKSSIEQM
FT                   LSFLDQQIAQVKQQIREHFEQHPDLKHQQQLLCSIPGIAELTAARLLGELLGFAPFGNA
FT                   RQLAAFAGLSPRQYQSGTSISGRTHLSKMGNSRIRKALYCPAIVALRYNPKIQEFSERL
FT                   LAAGKTKMCVVGAVMRKLLHYAFGVLQSGRPFDTQARQAQAG"
FT   CDS_pept        complement(194739..195809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0203"
FT                   /product="group 2 sigma 70-type sigma factor"
FT                   /note="ORF_ID:gll0203"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88144"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88144"
FT                   /db_xref="GOA:Q7NP54"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP54"
FT                   /protein_id="BAC88144.1"
FT                   /translation="MSLGGASARGNRKSTRFVMNIACIGLRKAKNCGLFARGSPMMSAR
FT                   GTLFNRHGVPTVAETAQGKPAEARKTRQSASFERDSVGLYLQEIGRIPLLKPEEEVMLA
FT                   RAIAQGGPKGEWAKRKLVQANLRLVVSIAKKYLNRGVPFLDLIQEGSMGLIRAAEKFEH
FT                   ERGYKFSTYAYWWIRQAITRAVASQARTVRLPVHLVEKINRVKKVRRTLAQELGRTPSQ
FT                   GELAEALELAEEDLEHILRAARRTVSLNITVGKEEDTELIHLIEDSQTDQPDVHIDRES
FT                   MRVEVSDLLDRHLTPRERDILQLRFGLRDGQQRTLDQVGRMFDLSRERIRQIQAKAFRK
FT                   LRRVRQRQRLQDWIGI"
FT   CDS_pept        195826..196932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0204"
FT                   /note="ORF_ID:glr0204"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88145"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88145"
FT                   /db_xref="GOA:Q7NP53"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP53"
FT                   /protein_id="BAC88145.1"
FT                   /translation="MPMLTNLQRTLLTWLLLVAAGWAALQVLEYFREFISVFVIAGIIA
FT                   FLLSYPVALLSKRLPRFAAVLVVYSSAGVVVGTLAVALGPLVSQQTAQLIASLPDIIRS
FT                   GSLQLEAFLKWARNLGLPVDVDRLVGGFGLRLQEQLQVITSPQSVEFLLGTFTGVLNFI
FT                   LILVIAFYMLLEGEKLWREAIGFLPANIRLRFSESLQYNLRGFFTGQLVLGLFMALLLT
FT                   PTYLFLNVPFGLVLALFVGTMELIPFIGATLGIGLVVIICLTQNLWLALWVLAASVLIQ
FT                   QIKDNVLAPRILGNFTGLSPVLIFGALLIGAKIAGLLGVLLAIPISGVIKSLYETLAVS
FT                   DPPPRAFQSLPKPAFRKSRPRDGEQDNE"
FT   CDS_pept        complement(197264..197866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0205"
FT                   /note="ORF_ID:gll0205"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88146"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88146"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP52"
FT                   /protein_id="BAC88146.1"
FT                   /translation="MVKVAGVNLTASSSFKVNASMAPLSAHLDLVGVLGALQLLADVGG
FT                   LIPDLNVPSALLGVGVAAALGDAAGVLTSGFALVPFGGFAKAGIGLRNGIVAASRAYGC
FT                   FGEGTAVQTETRAKPIEQIEPGEKVLARSERTGQQSLRRVKSTFQTGEQTLRRVKSTFQ
FT                   FDSQPVYRLQSRETGGNGERDTSTVTGEHPFYLQGQG"
FT   CDS_pept        complement(198027..198509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0206"
FT                   /note="ORF_ID:gll0206"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88147"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88147"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP51"
FT                   /protein_id="BAC88147.1"
FT                   /translation="MSIECETGEVVHLQVDTLEKADLKGYNLHRAILSGVNLRAANLQK
FT                   ADLRGAIFDDASLAEADLSESRMMNSWLRNADLTGAILTKARPIATDFDGANLTKANLE
FT                   GADIAWASFKAANLCDANMLCKRLEEANFEGAFYNLRTLWPRGFDPSKKGAILVNS"
FT   CDS_pept        complement(198509..199576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0207"
FT                   /note="ORF_ID:gll0207"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88148"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88148"
FT                   /db_xref="GOA:Q7NP50"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP50"
FT                   /protein_id="BAC88148.1"
FT                   /translation="MVRSNGERSVGGKPNQELACLVAVLERFSSGRLEFGGCVRGVAVA
FT                   GRCGRADPRAERALGSVGHRGGSGTDAAGALASGLALVPFGGFAKAGVGLLKARTGLSR
FT                   GIVAASRACGCFAEGTEVQTETGAKPIELVAPGEKVLARNEQTGEQTLRRVKSTFQFDN
FT                   RPVYRLELREIDGNGDRDVLTVTGEHPFFLQGQGWTAADKLQVGERVQTVDGQWLRVAG
FT                   LQAQEQKQRTYNLEVERDHTFFVGDSKAWVHNECPSVVTEEIIRAALQDAPLKTLQGSI
FT                   SLPVVERYVRLLEAGSTPPAIKVADGVIIDGNHRYVAGRIFGTVPPQIPGVLRAGVKPK
FT                   ALGDLKIDIEDYGSK"
FT   CDS_pept        complement(200444..200884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0208"
FT                   /note="ORF_ID:gll0208"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88149"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88149"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP49"
FT                   /protein_id="BAC88149.1"
FT                   /translation="MAATTVVVSATQIQVSLPENASTGPLVVKAAGVNLTAASSLKVNA
FT                   STAPPSAHLDLVGVLGALQLLADVGGLIPGLNVPSALLGIGASVVLGDAASAAGFGLTF
FT                   LPFGGFAKAGVGLFKARTGLRNGIVAASRACGCFAEGTEVQT"
FT   mobile_element  complement(202086..203245)
FT                   /mobile_element_type="insertion sequence:ISGL4a"
FT   CDS_pept        complement(202099..203154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0209"
FT                   /note="ORF_ID:gll0209"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88150"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88150"
FT                   /db_xref="GOA:Q7M7H1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M7H1"
FT                   /protein_id="BAC88150.1"
FT                   /translation="MLLDFPQLVKTALSSLPNDDFPVLDSRLFFSCWLALVMDKSTVSM
FT                   RDLFKRVNHTGIPVDISTFSKACKSRSLQIFEQLYQALLVRVRRELPAKKLHPCPIDST
FT                   VVGLTSKLLWAQDYHQVKLLTCLEHGSGTTEGSLINFGYDHDSNFVNEMLQAIPENGVG
FT                   IFDRGFAGLEYLKNAQASSKYFLMRIPSNYKLAFEGNAGRMRVGTGKESGMYRVVNFCD
FT                   IENRAEYRLVTNLPGEGEWLVRDEEVMELYRQRWQIELLWKFLKMHLKLKRLMTKSENG
FT                   IRMQLYITLIAHLLLELVSVPKIWGSQRLDKLRYLQCCMCQEISYVHWLGKLLGSQRRR
FT                   ARLPRACTYVH"
FT   CDS_pept        complement(203925..204197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0210"
FT                   /note="ORF_ID:gsl0210"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88151"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88151"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP48"
FT                   /protein_id="BAC88151.1"
FT                   /translation="MSENRFFLGAAIEMSKRAEQAQEFFTALFEPDERPFFVSDSATIH
FT                   DIYMDDLGIVFEKCLKYYGIRLSEHMFSKPIWQVLDFLEANRSIK"
FT   CDS_pept        complement(204221..205507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0211"
FT                   /note="ORF_ID:gll0211"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88152"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88152"
FT                   /db_xref="GOA:Q7NP47"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP47"
FT                   /protein_id="BAC88152.1"
FT                   /translation="MKATPSINTSGGVVGNPGSGVLSASASDTVLINGTNLNTLNSVTI
FT                   NGIAAYAVAVSATQIQVSLPENASTGPLVVKVAGVNLTASSSFKVNASTAPPSAHLDLV
FT                   GVLGALQLLADVGGLIPGLNVPSAILGIGVAAALGDAAGALASGLALVPFGGVAKAGVG
FT                   LLKAGTGLSRGIVAASRACGCFSEGTEVQTEAGAKPIELVEPGEKVLARNEQTGEQSLR
FT                   RVKSTFQFDDRPVYRLELRETNGQGERDTLTVTGEHPFFLKDKGWTAAERLKSGERVQA
FT                   ADGKWLRVAGLEAQPHRQRTYNLEVEGDHTFFVGHNQAWVHNECPLFKLNTRVVEQLKD
FT                   KRLGGLAGQLTEERLNRLINEPGARRFLDAGPINVSPFDKPNINVIQEVQGRLLRITVA
FT                   SDKFEIISVGPIRERNIINSIRSGRYVPF"
FT   CDS_pept        complement(206315..207322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0212"
FT                   /note="ORF_ID:gll0212"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88153"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88153"
FT                   /db_xref="GOA:Q7NP46"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP46"
FT                   /protein_id="BAC88153.1"
FT                   /translation="MGVLGALQVLADVGGLIPDLNVPSAILGIGASVVLGDAAGALASG
FT                   LALVPFGGFAKAGVGLFKARTGLSRGIVAASRACGCFAEGTEVQTETGTKAIEKVEPGE
FT                   KVLARNEKTGEQNLRRVQSTFQFDDRPVYRLELRQTDGDGERDTLTVTGEHPFFLQGQG
FT                   WTAADKLQAGDRVQAVDGRWLRVVGLAAQEQRQRTYNLEIEGEHTFFVGHNQAWVHNEC
FT                   ISLYRAVLDKELQDIKSSGVFRNPYGIEIKYFSVTAEGAARYARSQFINRPFEGPYTLL
FT                   RTRVPSSLLANPQVTRLILDRGIGGVDTVTIPTELLKNLSPPTMLRAAPLPSLK"
FT   CDS_pept        complement(208031..213952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0213"
FT                   /note="ORF_ID:gll0213"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88154"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88154"
FT                   /db_xref="GOA:Q7NP45"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP45"
FT                   /protein_id="BAC88154.1"
FT                   /translation="MHLRTLSKTYLAFLWWFLMRNAFLSRWRAALRRAVCLLVLFVYCG
FT                   GFALQAASASVDVVSGHYAYDTVDLVLGGRYPLMLQRHYQSSEQDRTPLTSYPGPFGPG
FT                   THMGLYSLRAAPVLDVAGQITKVRLSLPTGGAQLFATGVSGAPAGSYGNANPSDPIRGS
FT                   FTVSGNATSSTLVLTLESGLVLSFSATLSGTRQLNSLTDRFGKAITFSYSGNNLTRVQD
FT                   PFGRRIDFTYDATFTHQVRTATLYDNQGAVGGSVLYEYNSAGDLQYFHNAMDGQSVNNP
FT                   DGTTRTVNGLTTYEYQNHYLTKITDPRGTVRLTNSYENFNTSGQAGRVTLQTLPGMDGR
FT                   PGANGDQYTADDVLAQYVYSTGSTAVNDALYKTSDKQNWDKVTYNFDASTQQITAFSYA
FT                   IDAAATYGFEYDPSTRDLTRFTNAYGQQTRFDYDGSYFRHLSGIELADSGRTSYSFTAP
FT                   FGQIDSVTTPNNQSTYYEYNDPAGSYENSGYKGSLKSIADQLPENTSFEAYNPYGQATR
FT                   VVDGQGRTTEFEYFDYPNNYITPGTANQDPHYITDPSGVQTCFRYDTLSRLKAVFYCYQ
FT                   FEQTNRWTEYSYDTLNRLIKITSPSDASNTRRITEFTYDDNSNVTSVKAPNGVLTTYTY
FT                   DPMDRVATRAQAGRTEYFSYNNLGLLSKYKNARGQETLYEYGSKQRLRYVTFADGTKLT
FT                   YSYNTLDQVASITDSSDASGARNVYFEYFTGTDQVSRLKTERIGTGETVRYFYDASGNL
FT                   TSIKKGTSDASATPLINYDYKDDDASLATAGLCGNSTCDQNNAVVGFEYDPDGSLKSIN
FT                   YPNSIKEELFYNDGGEVERALFSGPGGTLLREIAYQYDYSTRGYLTSRTESGPSTPSVA
FT                   TSQSYSYNETGELTGATTPAGNYTNAYDKDGNLTSSSRPGASTTPSYEAGTNRMTAFEG
FT                   GTLIYDGSGNLVEQNVGSTKVTFTYNARNQLSSYTNNAGFTVSFVYDALGRRMGKTISG
FT                   TTTSYLLSGNQVIEQKTGSTTRRYLVGLGLDEVFMSREGSTDEYLLHDPLNNSVVAAVN
FT                   GSTQAIKTGYGYSPFGQVTASNTSSNNLWLFAGAEAVNSASVVYHMRSRYYHAGNQRFM
FT                   AEDPIGFAGGDTNLYRYLGNAPVTTSDPTGLRPDVRPRGVATLPGLSISTPEAPRATGA
FT                   AESISKERATLSPSTISRPVERLAQSAQTKSVKLGQPGSRTDTAPGQDTLDCTPLPLTV
FT                   VAGQSLGNICGYFEGPNSDLVDGSVRVSPSASGLSASISPDPVYVYSTFTVRVQTSTAT
FT                   PPGVYTLTADGYSVYDGTYYQPDSVTFEVLPPAPQINSISPGRGVTGSTVTLSGANLNY
FT                   APTVQFDNRLTATITSTSASEIKAIVPSGLPSYYGVPVNVTTKSGTSNNATFTVIVPPS
FT                   ISSFSPSSGKAGDNIAVTGADFYNLYGAAFNGTAASILSVSSSGTQMNLSVPSGASSGP
FT                   ISVSTEAGTATSPSSFTVNAPPSVSSLSPTAGAVGASVTVNGSNFTGASSVKFNATAAG
FT                   FSVVSASQISATVPTGATDGAVSVTTAGGTASGGFFDVQATPTINSSGGVVGNPGSGVL
FT                   SASASDTVLINGTNLNTLNSVTINGIAAYAVAVSATQIQVSLPENATTGPLVVQAAGVN
FT                   LTASSSFKVNASTAPPSAHLDLVGVLGALQLLADVGGLIPGLNVPSAVLGIGASIVLGD
FT                   AASAAGFGLTFLPFGGFAKAGVGLFKARTGLRNGIVAASRACGCFAEGTEVQTETGTKA
FT                   IEKVEPGEKVLARNEKTGEQNLRRVQSTFQFDDRPVYRLELRETGGQGERDTLTVTGEH
FT                   PFFLKDKGWTAAERLRSGERVQAVDGKWLRVVGLQPQQQRARTYNLEVEGEHTFFVGDT
FT                   RAWVHNECLPTGLASQYLDVTRRKTTTRNIRTDVSVDEFRENLLDNGFAELPAIEALKG
FT                   DILRFSKGATEYYLRSFSKSGPPTAELLVNGEQVLKLRLK"
FT   CDS_pept        214608..216812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0214"
FT                   /note="ORF_ID:glr0214"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88155"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88155"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP44"
FT                   /protein_id="BAC88155.1"
FT                   /translation="MQGFWGKVVLVAGTAWILGWQATAAWSATGYLLVPKAQEVRRVDL
FT                   ETGKLAGTLNLPVGNVYHNAARTADGQLLVAGDGAVSLIDAEGRLVEQIPLPAPVVSAS
FT                   FKKSDSDIPVLQASEAQTRRLVGFDYSPRTRTAYLGIQSEEVTTLYRVDPVARTVQVFA
FT                   TLKDIANPKDLVVTADGLRVYVSAVDLLPEPAARVYSINPVTGAVSAPLEAAFDPARPQ
FT                   MALSRDGNLLYLMAADDSLIVVNTRSNTAVRRLRIAGASKKEARIQRVLGALDNRHLWV
FT                   LTNRRMLLWDPFNARAVLDKALPVAAMDVAMSADKGRLWSLHPPGGEGKPAEVRAWDST
FT                   KDSLPAAGSFSDAVSGGNRLLLAEPPDPAAALSLPRVAVVGFETGQPRYGRYPNVADVI
FT                   SGDLLWTRRYEIVPPLQVQSVLDSLELSRNQVMGNPDAIRQVATLLGADIILAGEPIGV
FT                   DMPNRSLEALSSLISPIAAFLVPQFFQPRVFSRAEAFDATGKSLWKGDVVNSDSAFFAG
FT                   KTDTVLLANALVITAHDIANKFSKGIYNEIKQKGWRTDLPPLLKNDALKDVKRVALLGP
FT                   EVGPNSSLFNEVTNTPESLGQLIAPRLGDALGWEVEGPDEALSQLAQLGLEPAQILTTD
FT                   PKLLARALGVDAVMLGLVRSSTYISGGFVGLSQNAAADVVLQFELVDQQGRVLWKDIQV
FT                   RNITVGDAQGSALRQAAKAIVERLEQGIEQAEGPDKNQRS"
FT   CDS_pept        216889..218406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlB"
FT                   /product="protochlorophyllide reductase ChlB subunit"
FT                   /note="ORF_ID:glr0215"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88156"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88156"
FT                   /db_xref="GOA:Q7NP43"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005969"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NP43"
FT                   /protein_id="BAC88156.1"
FT                   /translation="MKLAYWMYAGPAHIGTLRIATSFKNVHAIMHAPLGDDYFNVMRSM
FT                   LERERDFTPVTASVVDRKVLGRGSQDKVVTNIVRKDQEEAPDLIVLTPTCTSSILQEDL
FT                   QNFVARAQEQSKADVLLADVNHYRYNEFTAADRTLTQIVSYYIEKLAGNLPARSEKPTA
FT                   NILGISTLGFHNHHDCRELKQLLADLGVEVNVVAPEGCSVHDIQKMPSAWFNVVPYREL
FT                   GRGAAEYLQRQTGQPLIDITPMGILQTARFIRAVQQILNTQGARVEYEEYIRSQTLFVS
FT                   QAAWFSRSIDCQNLQGKRAVVYGDLTHAAAMTRILAREMGVRVVWAGTFCKYDAEWFKA
FT                   EVADLCDEVLISDDHAEVGDRIAAAEPAAIFGTQMERHIGKRLNIPCGVISSPIHIQNF
FT                   PVGYRPFLGYEGTNQIADLVYNSFTLGMEDHLLEVFGGHDTKEVITKTMTAQSDLEWDE
FT                   AATRELAKIPGFVRSKVKRNTEKFARESGRDKITLEVMYAAKEAAGA"
FT   CDS_pept        218507..218830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0216"
FT                   /note="ORF_ID:glr0216"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88157"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88157"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP42"
FT                   /protein_id="BAC88157.1"
FT                   /translation="MEQRLDSIDLRLERLVSGIEGLRDAADRQQSSLDRLEAVVERQSR
FT                   HIERLAHMVGELTRAVSESARASQAAAEAAREAAQAARESAFWARSGVDAVRDLIEELR
FT                   DRR"
FT   CDS_pept        complement(218835..219743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /product="riboflavin biosynthesis protein"
FT                   /note="ORF_ID:gll0217"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88158"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88158"
FT                   /db_xref="GOA:Q7NP41"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP41"
FT                   /protein_id="BAC88158.1"
FT                   /translation="MAVFRSLSEVATPCAVALGNFDGVHLGHQAVIQAVLGRAGIPTVL
FT                   TFDPHPREYFTGKTGFLLAPERERTAAILALGIAQVLVLPFDELLAATEAGAFVEQVLV
FT                   AGLGARFVSVGWNFRFGKERAGTTEMLQSYARAGAFDIEILAERQVRGRRVSSSVIREA
FT                   LGCGDLDLARLLLGRAYGLEGEVVRGDQRGRLLGFPTANLQVSGRKFLPKDGVYLVSAR
FT                   WGVQQRWGLLNLGLRPTFDGLKRTIEVHVLDWEGDLYGQHIKITLERYLRPEQKFGSPG
FT                   ELVAQLHRDREAALKEIAGNP"
FT   CDS_pept        220048..222123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhF"
FT                   /product="NADH dehydrogenase subunit 5"
FT                   /note="ORF_ID:glr0218"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88159"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88159"
FT                   /db_xref="GOA:Q7NP40"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR002128"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP40"
FT                   /protein_id="BAC88159.1"
FT                   /translation="MEWVYTFAWLIPVLPLAAATLVGLGFISVPEWTKRQRLPVAALSI
FT                   GTLAVTFVHSLLILFQAVGGHEAYTWQFEWAAMGGIVVPMGFTVDNLGAAMLTVVTGVA
FT                   MLVMIYSHGYMEHDPGYVRFFCYLSLFSCSMLGLVVSPNLIQIYVFWELVGMCSYLLVG
FT                   FWFYKKAAADAAQKAFIVNRVGDFGLLLGILGVYSITRTFDFPGLAPAIQAAIESGAVP
FT                   LALVVVYCLLVFMGPMAKSAQVPLHVWLPDAMEGPTPISALIHAATMVAAGVFLVARVF
FT                   PVFSEVPGVLEVIAWTGAVTAFVGATIAITQNDIKKGLAYSTISQLGYMMMAMGVGAYG
FT                   AGLFHLVTHACFKAMLFLGSGSVIHGVHDNQDMRLMGGLRKYMPITSATFLIGVLAISG
FT                   IPPFSGFWSKDEILSATFDHSLVLWGIGAFTAAITAFYMARMYFMTFEGAYRGENAAAL
FT                   TAVRAWRQNVDREGVVRGFGSLPSFGPGAMHTDELAAHGHGEGHEHGEEHGHGGTPHES
FT                   PWSMTLPLVVLAVPSILIGFVGLPWDNAFGHFLEEGSGYHGAKHTFELGHFLLIAGSST
FT                   LLSVGGIALAYYLYILRPELPGQIARRFEAVYLFFINKWNFDWLYEQAFVKTSRLLARG
FT                   TLQVDQKGVDGVVNFSGLTTLLAGEGLKYFESGRAQFYVLIIFGSLLGLVAVLGLL"
FT   CDS_pept        222130..223710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhD"
FT                   /product="NADH dehydrogenase subunit 4"
FT                   /note="ORF_ID:glr0219"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88160"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88160"
FT                   /db_xref="GOA:Q7NP39"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="InterPro:IPR022997"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NP39"
FT                   /protein_id="BAC88160.1"
FT                   /translation="MQNMFPWLTVIILLPLVAALAVPLIPEKQVKWYSFAVCLVDFVLM
FT                   VAAFFTSYDLSNPDIQLAERYRWMPQIGLEWSVGADGLSMPLILLTGFITALATLAAWP
FT                   VTLRPRMFHFLMLAMLAGMVGVFAVQDMVLFFLFFELELVPVYLMLAIWGGKGRLYAAT
FT                   KFILYTAVGSLFILVVGLAMYFYGDLRTFNMVELAAKNYDPTFQNLCFLGLLIAYAVKL
FT                   PIFPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALIRMNVGFFPEATQLFAPLLIVLG
FT                   IVNIIYAALTSFGQRNLKRKIAYSSISHMGFVLIGVGSLSEIGMGGAMLQMISHGLIGA
FT                   SLFFLVGATYDRTHTLILSEMGGIAPKMPKIFAMFTACSMASLALPGMSGFVAELMVFV
FT                   GMATTDAYSFQFKALVVLFAAFGVILTPIYLLSMLREIFYGTLNHAVVHEEDLVDAEPR
FT                   EVFIIASLLVPIFGIGLYPKLTTDLYAPTTDQLTRVTRERIARAAPPPALLSGVYSVEF
FT                   ADRDRVSLR"
FT   CDS_pept        224118..225302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0220"
FT                   /note="ORF_ID:glr0220"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88161"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88161"
FT                   /db_xref="GOA:Q7NP38"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP38"
FT                   /protein_id="BAC88161.1"
FT                   /translation="MQPRTQIVQVFCTYAMLDDSQWIGWRVDGELRRNMEAHLQRQPAG
FT                   VQSVEQWCLFWFERWRGGEDRFARAHLIAFLYEPAYWSARFVRAGFHRQLTLTDLCQTA
FT                   VANVDLVLQGFNPARGSDLKRFATRVFRNILYKALREFHEAEVCTTWSLLRKYSLKRLE
FT                   EALQRQGYDERQIKSFLLACRCYKDTYVPVPPAGTRHLQPPVEQDWQRMAGLYTVRREP
FT                   QLHQPAAAGQFREWLELSAKALRQMLTPENFSIGVGSTDEQGDGIELLRDPDLNPLDAA
FT                   GEREEEAYRQAFRLQLRSVLVGTLAVLETPLQRVLELYYGEQLNQQEIAEQLGIKQYTV
FT                   SRWMNRAKKQLATALGQWAKQKLHDSLELDVVEGMNRLLEEWLQMHFQPSDEGE"
FT   CDS_pept        225309..226445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0221"
FT                   /note="ORF_ID:glr0221"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88162"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88162"
FT                   /db_xref="InterPro:IPR014951"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP37"
FT                   /protein_id="BAC88162.1"
FT                   /translation="MTIDPAVLCPQTLWLEIPTAALDLELRAFSHAGARWNAYLNRLAQ
FT                   TTVLAWIQEDFESGARVWPSVEALANFHEFLNGTAITCGQMRLVCIPTEQVDREEVRIP
FT                   REWVDIPEWAADYYLPVEVDCERELVGVWGYVSRARLLKCAQRDDADRTYCLAGCDIHP
FT                   ELHTIWTAQQLKVPLQSRPAPLGSLSLTQARNLIERLGRAEVAFPRLEVPFEECWAPLV
FT                   GHGGWRQRLYEQRVGLPGQWSIGEWLRRGVSELGHSQGWQLRTAQAGGRSSHQMAGRTL
FT                   VRQMVVAGQPYELRIYPLYEEQEHTWRFELRNLAGRIPGGLKLRLLTEDLQPFTNNEDV
FT                   AQTAVDELYIDVRLEPGDGLVWEVEPQPLNYDREVLIF"
FT   CDS_pept        complement(226442..227146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0222"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:gll0222"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88163"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88163"
FT                   /db_xref="GOA:Q7NP36"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP36"
FT                   /protein_id="BAC88163.1"
FT                   /translation="MRGDLHDIDIRTLIEWLAARRSTGELLVGAPDDRFWSVFWDGGRL
FT                   CSCAEQEPGLLQRQLDELVVLEEGWFCFDAAAVPPSGGQGVEAAVWLDRLAAGPPPLSP
FT                   APPAPTGRVVCIDDSTAVQRWVADCLEGACREIRACSDPLQGLAVLREAPADLVLLDSA
FT                   MPGLDGRRLCRVLRRLPGLNRIPVLLMVDGDERTEQAHARLCGAAAVLAKPFSRGVLRS
FT                   LVAHWLPGAPLG"
FT   CDS_pept        227311..228333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0223"
FT                   /note="ORF_ID:glr0223"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88164"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88164"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP35"
FT                   /protein_id="BAC88164.1"
FT                   /translation="MGIAVRYLASVQRKGFLEQRALQLLAKELDEYCWASAQGEVGCGA
FT                   AGRFAPGALVLAHIDAAGRVERLEAADAPLTALLVGMAHCRENLRAQAEEIAAWRESLA
FT                   LQSEELSRRHTAPGNLLDPDPRPLPGGEAVVRRLRRALEQLWAEGAAEVPLAEERHLWQ
FT                   RQWQDTLEQIQLLSEGLAACERLDHRQSDECEQLLSAQKAELSQRKAHQAALAERLIAD
FT                   GHLDIEERQHLEIAQRRAQEHWANLAGSIDRQHRRLERERTACERHLARLGDGPHQRER
FT                   LAQRLGEAEQRREQLQQQKHDLEHRLAAADARRILYDVQIQPLLGELEALVGQPSGPLD
FT                   "
FT   CDS_pept        228460..229038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0224"
FT                   /note="ORF_ID:glr0224"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88165"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88165"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP34"
FT                   /protein_id="BAC88165.1"
FT                   /translation="MFSQGWPFSFEFASRRDCRGGGPDWTKFANAFGFGGPWNFGDEPR
FT                   TRRGDVKYLLLELLAEQPRHGYELIKELERRHGGFYRPSAGSVYPTLQLLEEGGYLTSE
FT                   MLEGKRVYTITDSGRQLLVEGQNSSRRKRGTAEGTEAVGALMELKDAMLGLAAAVMETA
FT                   RPGNQGRVDKVREVLERSRREIYRILAED"
FT   CDS_pept        complement(229416..229631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0225"
FT                   /note="ORF_ID:gsl0225"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88166"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88166"
FT                   /db_xref="GOA:Q7NP33"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP33"
FT                   /protein_id="BAC88166.1"
FT                   /translation="MSEERTFIKLDQFLKLVGAAQTGGQAKILIQEGEVLVNGAVETRR
FT                   GRKLLAGDQVTLAQMNYTVQLNESSP"
FT   CDS_pept        complement(229628..230128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0226"
FT                   /note="ORF_ID:gll0226"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88167"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88167"
FT                   /db_xref="GOA:Q7NP32"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP32"
FT                   /protein_id="BAC88167.1"
FT                   /translation="MRRSFESRWAMLIDTIKADSLEARKRNSREPGVHALRANLLGTLF
FT                   AEAAKVGKDAGNRPSADEEVIAVVRKFLKNLDETIAALEKAHKDTTLQRSEKAILESYL
FT                   PRQMDRAELTAAVEQIASTLADRSPRAMGEVMKQLKERHGGQYDGKTASEVVRAVLHSE
FT                   VGR"
FT   CDS_pept        230131..230673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0227"
FT                   /note="ORF_ID:glr0227"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88168"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88168"
FT                   /db_xref="GOA:Q7NP31"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP31"
FT                   /protein_id="BAC88168.1"
FT                   /translation="MRHTTSVLHSPVSPPGREPVGGRARTFNECHWEAPMSAEANKALV
FT                   RKFYEEVFNRRNLALADELVTPDGINHATPPGVPSVGPSGIRFVVSMLTEGFPDHHHAI
FT                   EDLFAEGDKVAMRCTFSGTHTGSILGLPPTGRAFRQQQMHILRVEGGKLAEHWAVRDDL
FT                   ALMQQLGALQPPAVQPS"
FT   CDS_pept        complement(230721..231266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0228"
FT                   /note="ORF_ID:gll0228"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88169"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88169"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP30"
FT                   /protein_id="BAC88169.1"
FT                   /translation="MTSVYSIAPIFVLRDPRVFRDEFGRSGLFVLKNPWLDLLQRYRNA
FT                   QESRVSKYSLFDAVRLKESVVLAEGGTAGAGTPGAIVEIFEDGKAYLVELFGNWVKYDS
FT                   QGQLAPAHPDELNVFQETLGVELAYPHQLQLIAPAAEAAGVRTRLAVLLDKLPESLLLQ
FT                   VHDFADLLNQQRIADKSS"
FT   CDS_pept        complement(231619..231807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0229"
FT                   /note="ORF_ID:gsl0229"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88170"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88170"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP29"
FT                   /protein_id="BAC88170.1"
FT                   /translation="MRIFSPGLLLAGALLLSNIGTAHAAECMALKPVGSTEAGTSVKKS
FT                   ISPAAVEAPPAMVAQQE"
FT   CDS_pept        232113..234854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0230"
FT                   /note="ORF_ID:glr0230"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88171"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88171"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP28"
FT                   /protein_id="BAC88171.1"
FT                   /translation="MPDTEPSSQESPPPLAYQQEASGWDPLAFWDTPAAAVGEPDWEAD
FT                   IWDEEAFESPGEPEQSALAEDTEPDPAEPDAPELTDSDALPDAEQELEAAEQTLEDDLP
FT                   LQEDALEPVAGFALHLELTPPPPPAATDPPDPQSPLTEAPAEDDTEALQAQQLAQLEAL
FT                   LAQLLAYRAQVDSHFQKILHQDGTVLERAADKINQWTDTAVNAVADGVGDVWDRLSGQD
FT                   EEREHKLLEEDSAAAVQEQTAERFEQLAARLGALEAAIRAGRSAQVEQLRTELFGGQDA
FT                   QGKLQPGLVAQTVTAVDSQVGQFEQGFQAGGEMLKTGLVAAAALGVTVATAGAGAGVAA
FT                   TMLSATAAGAGTSVALGAGDAAVSGDGYTLAEAGEDVLSGATTGALSAVPIPGAAAVGG
FT                   ITRGAITGAVGRIAGQQAAESAMVQAAARLVGEKLASETVHNAGASMLSTGAQVAFDEQ
FT                   LSLQQKYEQVLASGLQQLSPAQMAMNATMAFGFEKATQGVIGAAQRVAPELPRRTGQED
FT                   GLALGTAERGDNDDWGVPEDLDAWLLPHPDTLAPPPALANPESILPAATARPQAPPPPA
FT                   APIPEAPPPVAPVAPLWQSPLAVHPDVQVQRRYQQLLAERGSAELQLPGKPSSSWNGPK
FT                   EAYFRGLEKPRDAHDRIQEEGYRWVLEESGRLRLDRNPEFAGEPENLPRYTVAGDKLVP
FT                   RSEQIDFAASYKGAEEPFTLEQTAQYEHLLSERDAWRERRDRAIAEHRQAALVGDESLA
FT                   ERKLEEAAKAGYQMNERSRRMAEKAAEDYMHKTYGERATLAYPERVDGSHMSKSQSGDF
FT                   DQVWKVKGEDGNETFVVIEAKGGSSRLGTRKTPSGIAQQGSPRYFKAIAENMRKKGATI
FT                   GSELIDKKDLGQVQYLKIQLPIKEQGGASQINSAKIREFDLS"
FT   CDS_pept        234884..235732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0231"
FT                   /note="ORF_ID:glr0231"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88172"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88172"
FT                   /db_xref="InterPro:IPR029074"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP27"
FT                   /protein_id="BAC88172.1"
FT                   /translation="MTKIARHQTDMNFMIKQTIDTKQLVDKIYQRIISDHNVLSLSTLF
FT                   FILPSYPGYLSVTQPESDEICKAIQLIAKLAAGAFALASTSEKELEVYLDNNIKVRLPA
FT                   KIDESEVNCSAWMSGFFAAAICRDLTVLDSLGRIPLELLRRSSTRYDEFMFSFIAALQG
FT                   YWRGERDAARHLMAAMADAKPEKIQCCSEEYLYLKAVPQMEMMFQLMRKDGEAFNRSLY
FT                   TALESHRELCNLDEDTRLDSDFYLAYDLLALSSLAYEQGMAVHVESDYLPLSIVQGKCA
FT                   V"
FT   CDS_pept        235816..236259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0232"
FT                   /note="ORF_ID:glr0232"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88173"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88173"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP26"
FT                   /protein_id="BAC88173.1"
FT                   /translation="MNERSRRLAEQAAQEYMHKTYGENATLAYPKRTDGSEFSKSQSGD
FT                   FDQVWKVKGEDGNETFVVIEAKGGSSRLGARRTERGTAQQGSSEYFKAIAKTMEGKDES
FT                   IGTELLAAKQKGNVQYLKVQLPIKDRNGTSQIGAVQVREFHLK"
FT   CDS_pept        236290..237138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0233"
FT                   /note="ORF_ID:glr0233"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88174"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88174"
FT                   /db_xref="InterPro:IPR029074"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP25"
FT                   /protein_id="BAC88174.1"
FT                   /translation="MEKITRHQTDINFMNKQTIKAKQLVDTIYEGLTVSHNSSSLRMLS
FT                   SLVQGYAGYLSVSFPESVEICESIQLAAKSAAALFALASTSESELEIYLSKDTSIRLPA
FT                   KVDHSGVNCSAWCSGYYLAVICRDLPVLDNLCRIPLELLRRSSTRYDEFTYSYISALQS
FT                   YWQGKDDAADHLIAAMTNAKPDKLHFCSEEYLYLKAISQMELLFNLMRKDEEAFNKSLY
FT                   IALECHHELCDLDDETRLDSRLFLAYDLLALASLAHEQGMTVRVESDYLPLSIVQGKCA
FT                   V"
FT   CDS_pept        complement(237352..240447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0234"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /note="ORF_ID:gll0234"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88175"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88175"
FT                   /db_xref="GOA:Q7NP24"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP24"
FT                   /protein_id="BAC88175.1"
FT                   /translation="MRSNISAWSIRNPVPTIVLFLILTLGGLASFGGLGIDLDPNTDLP
FT                   TVGVTVTQLGAAPTELETQVTRRVEQAVSSIGNIRHIYSTVRDGSSFTRVEFNLGTNLD
FT                   RATNDTRDAITKIRAQLPQGIDEPVIQRFDDGGWPFIGYTISSDRRAPVELSWLAENRI
FT                   ARELLTVPGVSQVLYFGSKREIRIDLNPVRLKALGITADQVHAQIRALNIDLPGGRGEV
FT                   GTTEQAIRTLGSAATVENLRSVRIALPDGRHANLESLGTVTDGTADQRWLAYYDSRPAV
FT                   VFQVVRASGTNLVGVEEAVQAKVKEIQQSLPDDIKLQLLWTTGDFVRESYDASVEAVLL
FT                   GAGLAVVVIWLFLRDWRATLIAGLAIPLSVIPTFAVMRMAGFTLNNMTMLALALVIGIL
FT                   VDDAIVELENISRHIGMGKSPYQAAVEAADEIGLAVVATTMTIVAVFLPVAFMEGIQGQ
FT                   YFRQFGWTVAAAVLFSLVVARMLTPLMAAYLLKPHTHAPGRSLLTRLYEGVLGWSLAHR
FT                   RIALLLAGAFFAGSLALIPLLPTSFIGPIDRGQSSLEVELPPGSSIETTRKAMLQLGSL
FT                   VQGHPAVEHVYARAGSIDSSSTPNTGRLVITLKPRDKRRQTQQQFEAEMRPILNQVPGV
FT                   RLSFSGWGGKNVQIVLSGDNTVELERAARDLTDQMRGLPELVDVNSTAAILRPEIQVRP
FT                   LLDRAAEQGVSVAAIARTAQIATLGDSEANLAKFTLPSRQINIRVQLDPTFRTDFDTIG
FT                   DLQVMGNGGALVPLKSVAQLAMGSGAMQIERYDRARQVTIGANLAPGVNLGPALQKVHE
FT                   LPVLRNLPASVSEKLAGEAENQRDVFNGFGGAIAAAILLIYAVLALLFGGFLHPLTIMM
FT                   SLPLSLGGALVGLLVFQKSLGLYTLIGIVMLMGLVCKNAILLVEYCLVAMQAGRPRTEA
FT                   ILQAGEARMRPILMTTVAMIAGMLPIALGIGAGSEARSPMAVAVVGGLLTSTALTLVVV
FT                   PVVFTFVDDLQSWFWRLVQPRTKIAPVPAALEVPPAMATPQE"
FT   CDS_pept        complement(240748..240888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0235"
FT                   /note="ORF_ID:gsl0235"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88176"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88176"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP23"
FT                   /protein_id="BAC88176.1"
FT                   /translation="MRESVIYQRILREGEIDGMQKLLLRLLTHRFGQISSEVINQTEAI
FT                   F"
FT   CDS_pept        complement(240904..241212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0236"
FT                   /note="ORF_ID:gll0236"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88177"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88177"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP22"
FT                   /protein_id="BAC88177.1"
FT                   /translation="MVVSSPGFYKQGKSAIEEEFRTGRMVHRYQVVRLWEQDPALLLKQ
FT                   PALMPPAALARTDRPEQLLVRVAERIATIEAPGPRANTLAYAKILAGLRFAETVIDE"
FT   CDS_pept        241321..244599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0237"
FT                   /note="ORF_ID:glr0237"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88178"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88178"
FT                   /db_xref="GOA:Q7NP21"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP21"
FT                   /protein_id="BAC88178.1"
FT                   /translation="MTVSSGRAGGRIPRWAIISLAATVGLVGAGVTALALVPLFVDSDG
FT                   LRKPLEEAIAQTLRRRVRLGKLQVQTLGGIGLRADRVELFNLRGSEKQLDARSVFVEVD
FT                   LWPLLSRQVVLKRLEFERLDLALQRNPAGQWNVADLLTAQGPDGPGQTGYSGPAVSLVD
FT                   STVRVTDQTQNPPRQLRLSNVAFDLRPQNPYDLDITFKGDLGEKTPLAVAGTIELPKGD
FT                   PAAAWGGELRLQTQQLAADQVVGLLGQPALAGLKGLFDLDVRWELSQDQLEGKVKAQAL
FT                   AWLWPEVWGKTAWKARSVDLDGDLTFGPQQVAVERLQLKLPELTADAKGTLPRFFNQPG
FT                   QALDLNVKTGEFDPFTARRSLPVAALPTSLLPWIAQSTGSGKIATDLAILGTVAQPLVT
FT                   GRVDLKGLTLRNPRLPQPLESLNGTVLLGANRVQFQALKGSIGPSPFELTGAIDGYRTG
FT                   KTQPQLIFKSPSLDLGVARSILTSELVASRALDNVTSLGGRAAVDLRIRGAQPEGRVEF
FT                   QGARVGLSGLKKPVEDLRGTVQLGPQGNRFENLSGRLAGSDIRVGGSLGPTGALQVAGT
FT                   GTLNFPQVFALLGSPPPIQAKGAVPMEFTAGGTTNKLDFTGNLDLAKLDELKFNNLNLT
FT                   PAQRLVLRGTYTPAQLTFANTRLALAGLVLDGGGTVRQPGTPAQSLDLRARTPQPLNLT
FT                   NITKLVPQVADLGVSAGRAGLDLSLKGPASSAAFQAALKLQGVAIPGLLGGISGLSGPV
FT                   NVAGDQASTPGLTFQTPEGRGQLKGTVRNFKDPNFTFDARLARLNIDRLLASASGGDKK
FT                   EGSSGGADLNSLRGQGQLAIDQGVVSRLTFQQLRTKVQLNRGVLVLNDFGLNTAGGRMG
FT                   GDLRTDLKTQAVQGNLNLRDAEANTLARQLIDFPPNQIFGRTDMDFTFQAKGGNQNQFL
FT                   QSLNGQGSMNVTNGRLATLNLMGPILGVAEGLGSGQGFSLDTLLLSVGRLNTGKFQRLG
FT                   GNFRVQNGVARTDNFVYTGSALNMQADGTLRLVDEVANLQVRGSFTQNPLGAVSMDGDR
FT                   LLGNLLGRILKLPQQQPRNFSFQVRGPINQLGSVRNVRLQPGRG"
FT   CDS_pept        complement(244596..245111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0238"
FT                   /note="ORF_ID:gll0238"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88179"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88179"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP20"
FT                   /protein_id="BAC88179.1"
FT                   /translation="MLFGKTAALAGAVLAGLLFVPPVWAGKIVDGDLSLEFTPPPYFQT
FT                   TKNPPGKPIHYVLTPPDKSVAISTGSQFDRNLRNAPPFDPAPAKAFCARAAAVIPKEVT
FT                   LQKSNRFLLDNQNGVECRFAAPNGRTIHWVAAPVPAQLLMFMADWPKPPSKEQVATFRQ
FT                   FLGGVQIF"
FT   CDS_pept        complement(245157..245561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0239"
FT                   /note="ORF_ID:gll0239"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88180"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88180"
FT                   /db_xref="GOA:Q7NP19"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP19"
FT                   /protein_id="BAC88180.1"
FT                   /translation="MMFEDVAIALPVRPNDLDSFGHVNYATVLEYMEAGRWAWLSHHHK
FT                   MEQASSVLPVVSRLEIAYHREIRMEQVQVNTHLEPGEESPYYVFFKQTVGVVREGRPIT
FT                   AVEARVRMVFMDAVKRTLTTKQAFLDSKDS"
FT   CDS_pept        complement(245577..245942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0240"
FT                   /note="ORF_ID:gll0240"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88181"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88181"
FT                   /db_xref="InterPro:IPR019648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP18"
FT                   /protein_id="BAC88181.1"
FT                   /translation="MSAANHRILCTALAAALSLAACGAPKYQPNNRTLPVSKAEYGERW
FT                   PLAVQSGALDCPLPGAVVLKADGKTYALNGTAESTAKYQLVDGILTANPSGGKVDSQTK
FT                   IALLQPLVDAGLQLCTD"
FT   CDS_pept        complement(246120..246623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0241"
FT                   /note="ORF_ID:gll0241"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88182"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88182"
FT                   /db_xref="GOA:Q7NP17"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP17"
FT                   /protein_id="BAC88182.1"
FT                   /translation="MIDIAVKLLGPGDEVVLEGVALEVFDGPVDPALVRAFLAEPGHYI
FT                   VVAVDGGTVVGFASGVRYLHPDKPWALWVNEVGVSPDWQGRGIGKAVLRCLLEAGAAAG
FT                   CTEAWVGTEAGNAPARALYRAVGGALDSEAFVTFSFPLGCGSADPEQNESAPTRAENPG
FT                   VDCP"
FT   CDS_pept        complement(246745..248469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0242"
FT                   /note="ORF_ID:gll0242"
FT                   /note="cell division control protein CDC48 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88183"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88183"
FT                   /db_xref="GOA:Q7NP16"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP16"
FT                   /protein_id="BAC88183.1"
FT                   /translation="MELSESHGVQPMNSRGFPGIPKEGSWTRKARRQAAGQDQVLVTPP
FT                   PADWRPQPYLEGVGGLGEVLVTLKELVELPLKKPEVLEQLGLEPVRGVLLVGPPGTGKT
FT                   LTARALAEQLGVRFLAIIGPEMMGKYYGEAESRLRGLFAKAARLAPCLLFIDEIDGLAP
FT                   DRASTDHEADRRVVAQLLGLMDGVTKTPGVVVLAATNRPDHLDPALRRPGRFDREVRFG
FT                   VPDRDGRLEILRILTRRMPFDETVDLEAVADRAVGLVGADLKGLCQKAAYRALRRQGGN
FT                   LESAPGMSVSQSDFVAALKEVKPAVLRAVQVEAPAVAWEAVGGLEPVKQTLRESVEGAL
FT                   LYPELYRRAGAKAPRGILLYGPPGTGKTLLARAVASQARANFIAVKGPELLSRWVGASE
FT                   QAVRELFAKARQAAPCVIFVDEIDTLAPERGSGGADSGVSDRVVGQLLTELDGLEEAGA
FT                   VLLIGATNRPEVLDPALLRAGRLDLQLKIDLPDRESRLAILRVHNRERPLAGVDLEFWA
FT                   GSTEGWSGADLALFSNQAALAAVRRHREAGHTDPARIVLGPDDFEAAYRTLKQQRGD"
FT   CDS_pept        248599..249987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0243"
FT                   /note="ORF_ID:glr0243"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88184"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88184"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP15"
FT                   /protein_id="BAC88184.1"
FT                   /translation="MFTDTPQSATMKRAILVGLLILAAASPVRADASLRPFGTMREQAE
FT                   VQQQWLKKRMETVLPPLMRRYGAQMWVIPMREYNEDPVFSALVAPTTFSARRRTIYVFY
FT                   DRGADKGVEMLALGGGSQGGVYTARRSERKVEAAVGGRQAELWGDEQWQMLKEVIEERR
FT                   PRTIAINVSRTFAFADGLSAGEYEGMSEALGPEWTKRFRRAEGLAVDLIAVRLSEEEAF
FT                   YRKLNELTWQMISTAFSSQVIAPGVTRTGDVVWWMRQFIAERGLAAWFQPSVDLQRRGF
FT                   TEEQLGEDPVIQKGDVLHCDTGIVALRLQTDTQHLAYVLKDGESDAPAGLKAALARSNR
FT                   LQDIVLEETRPGRSGNAVLEASQRRMRAENIDGTIYSHPIGLHGHGAGPLIGLWDRQEG
FT                   VPGRGDHAVIPNQWFSIELQATVPVAEWGGQKVRMAQEEDMMIGADGVPRWAFRRQDTF
FT                   WLVR"
FT   CDS_pept        250109..250807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0244"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:glr0244"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88185"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88185"
FT                   /db_xref="GOA:Q7NP14"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP14"
FT                   /protein_id="BAC88185.1"
FT                   /translation="MDPIRVVLVEDHDLTRAGLRMALSQSDHIKLLGDASNGEAGLRLI
FT                   EQMKPDLAIVDVGLPGIDGIEVTRRVKSEHPEILVLILTMRDDSQTVLAAFASGADSYC
FT                   MKDIASKDLLQVVEKTHEGTSFIDPSVAGIVLNEVRSRSVHAAPGTRQTVIQAADPELA
FT                   QILEASPLTERELEVLQLIVQGHSNEGIAQQLYITVGTVKTHVRNILSKLCADDRTQAA
FT                   VLALRSGLVH"
FT   CDS_pept        complement(250862..251446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0245"
FT                   /note="ORF_ID:gll0245"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88186"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88186"
FT                   /db_xref="InterPro:IPR025889"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP13"
FT                   /protein_id="BAC88186.1"
FT                   /translation="MNVTGSGIDPAPANEGLPAGSVLAGTFADETTARQAIDELSRAGY
FT                   ANEQILVAALERHEQDDLVKQTEAEPLNKESVATGGFGGALVEGFARLLPKGRGVANIV
FT                   YSTLVRLGFTEEQARYYERAYEAGRILVVIEAVRDANTVLAVLERHGADIGPGTTTGRT
FT                   VEQRDTTVSTSGSTPPSTGPVGRHPDEPQNL"
FT   CDS_pept        251656..254652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0246"
FT                   /product="glycine cleavage system protein P"
FT                   /note="ORF_ID:glr0246"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88187"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88187"
FT                   /db_xref="GOA:Q7NP12"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP12"
FT                   /protein_id="BAC88187.1"
FT                   /translation="MSEPTIDRELDLHTFWQDASEPAPDTTIPAVALANGKGHLDYTDR
FT                   FAGRHIGPDGREVERMLSTLGFESLDALIERAVPAQIRMERPLRLPKGLSEYEVLARLR
FT                   AIAAQNRVFRSFIGMGYAECITPLVIQRNILENPGWYTQYTPYQAEIAQGRLEALLNFQ
FT                   TMVIDLTGLEIANASLLDEGTAAAEAMAMSFGIKAKGRAKRFFVSEHCHPQTIAIVQTR
FT                   ALPLGIDVIVGDHRAFDFQVQPCFGALVQYPATDGALFDYRAFVEAAHRAGALVTVAAD
FT                   LLSLALLVPPGEFGADIAVGNTQRFGVPMGYGGPHAAYFATRDAYKRQIPGRIVGVSTD
FT                   AHGQRALRLALQTREQHIRRDKATSNICTAQVLLAVMAGMYAVYHGPVGLRRIAARIHR
FT                   LTRTLAAGLVRLGHLLGSAPYFDTLRVELNGIDTRTIVERAEARRLNLRVLDERTIGVS
FT                   LDEATSTRDLEDLLAIFALEGEPDFTIAELAAEVSQVQAPEVFGRQSAYLTHPVFNRYH
FT                   SETELLRYMRRLESRDLSLTTSMIPLGSCTMKLNATAEMLPVSWPEFAKLHPFVPLSQA
FT                   RGYQILFEQLEAALAEITGFTAVSLQPNAGSQGEYSGLLVIRAYHHSRGEAHRDVCLIP
FT                   QSAHGTNPASAVMAGMQVVPVACDEQGNIDVADLEAKATTHAARLAALMVTYPSTHGVF
FT                   EEAIVRICAIVHGRGGQVYMDGANLNAQVGLCRPGDFGADVCHLNLHKTFCIPHGGGGP
FT                   GMGPIGVASHLAAFLPRHPVVSQVGGQAGIGAVAAAPWGSASILTISWVYIFLMGGPGL
FT                   TEATKVAILNANYIAHRLAPHYPVLYKGAGGLVAHECILDLRKLKTTAGIEVDDVAKRL
FT                   MDYGFHAPTVSWPVAGTIMIEPTESESLEELDRFCEALIAIRHEIAAIERGEADRADNP
FT                   LKNAPHTAAVLLADSWEHPYSRAQAAYPAPWLYQHKFWPVVSRIDNVYGDRNLICSCLP
FT                   MEAYAQDGK"
FT   CDS_pept        254760..254987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0247"
FT                   /note="ORF_ID:gsr0247"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88188"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88188"
FT                   /db_xref="GOA:Q7NP11"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP11"
FT                   /protein_id="BAC88188.1"
FT                   /translation="MLAKLTAKNQLTLPRAVTNAVGSAEYFEVEVKDGRIILTPVRIQR
FT                   SDAVRAKLAELGLQEQDIADAVSWARKPRK"
FT   CDS_pept        254984..255406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0248"
FT                   /note="ORF_ID:glr0248"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88189"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88189"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP10"
FT                   /protein_id="BAC88189.1"
FT                   /translation="MTLPPRVVLDTNVVLSALIFVQGRLTPLRQQWQQGRCRPLVCTLT
FT                   TAELIRALGYPKFRLSVQEQHELLADYLPYCTPVKMPAVQPVTLPCRDPLDTPLLALAV
FT                   AGQADFFVTGDKDLLSLADAFAPPIVTAERFLALLI"
FT   CDS_pept        complement(255600..255875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0249"
FT                   /note="ORF_ID:gsl0249"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88190"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88190"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP09"
FT                   /protein_id="BAC88190.1"
FT                   /translation="MHFYRKFHWAAAALLLSGAPAFGQNLPLVDLQAEAACAQKPSPLE
FT                   REARQLRLQAIVAYEQGEREQAFGALTQRRALQQGLHQERSACRGR"
FT   CDS_pept        complement(255908..257182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0250"
FT                   /note="ORF_ID:gll0250"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88191"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88191"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR030392"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP08"
FT                   /protein_id="BAC88191.1"
FT                   /translation="MRYPLFILTSVVVLSAGALPTHAQWNLTGNAGTTPGTNFVGTTDN
FT                   KNLVLKANNTTGLRIFPGGPPSVVGGSYKNSVTSGVKGAAIGGGGSEISPHQITDDYGT
FT                   IGGGVQNQAGDGAGTVADAAYATVSGGFGNDATAYAATVGGGYGNSALQSDASVAGGSF
FT                   NLADGTGAGVAGGLFNDAVDDYAAVGGGYGNLASGYLSTIAGGYFGEATGSYSAILGGY
FT                   FNEATSTGSVALGWRAKAVNAGAFVWSDQSAGDFSSTAAHQFRARASGGVTFFTNSAAT
FT                   VGATLAPGSGSWAVVSDRALKGNFTPVDGVQVLEKLAALPIGTWNYTSQDPAVRHIGPT
FT                   AQDFRAAFAVGEDERHISTVDADGVALAAIQGLHRLLAAKDAQIQHQQQQLAALQRRLE
FT                   AIEYVVQTPQSPSYRAAAHTQSASR"
FT   CDS_pept        257515..259839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0251"
FT                   /note="ORF_ID:glr0251"
FT                   /note="cell division protein FtsY homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88192"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88192"
FT                   /db_xref="GOA:Q7NP07"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP07"
FT                   /protein_id="BAC88192.1"
FT                   /translation="MVFNWFNRFIKKDKKEEPTPEPTQAQEPVEAQPPAPVEEPAAEPD
FT                   YMKWARLAQEKLNQELAAQPAVEPEAPAAFEEAPTAPPIEPPSAPAYDWQAVLYGTKSA
FT                   APVEPPPPSTATPPVTEAVIPPPPPPAVAPTPPAPEPPAAVSPAAFDWQAVLYGTRPAA
FT                   PVEPPPAPQPPVAEAPPASVQAAPAFESPVVEVPEPPVAEPVVEPPVEEFPAAPVAEEE
FT                   ILPVESEPLTVAEVPVEPLPEAEVLPALLVAEEESAPVVEPPEPELPAAVEISPVFEAE
FT                   TVEAPAAEVLPPAEEPPTVEEVVPSVEAPPIFQPAAAESAPVEPPPPAPPAEPPPESPA
FT                   SAPLFDWRRILNRNRPVESPPEPPAPAAPEPPAAEAAPPAAEPPVFDWRRFLNRPRTPE
FT                   APPVQPPVVPEPPPAPEPVVPPPPAAAQTPPAQPKPRFELDPGFLWSAEVLAAQGRRPE
FT                   DVTVEEISWLQKLRAGLGRTRRSLVNNVKALAGRGPIGPDELEELEGLLLQADVGITVS
FT                   ERILAALQERVRREALPGDQVMPFLKSQLRKQLELEGDDPTGFAPKRGQLNVWLIVGVN
FT                   GVGKTTTIGKIAALATRSGYRTLIAAGDTFRAAAVEQLSIWGERSGVTVVANPSPKADP
FT                   AAVVFDAISAAKARDVELLLVDTAGRLQNKKNLMDELAKVRRIIDKQAIDAHIESLLVL
FT                   DATTGQNGLQQAKVFGETAGLTGVVITKLDGSAKAGIALAIVEQLQLPIRFVGVGEKID
FT                   DLRPFNSYEFVEALLSDYDAA"
FT   CDS_pept        complement(260155..260787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0252"
FT                   /note="ORF_ID:gll0252"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88193"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88193"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP06"
FT                   /protein_id="BAC88193.1"
FT                   /translation="MLADCAGRPVARTPRHLDGRIDAFYHLPGPHRAHRLRQHHRHRRH
FT                   LRRPRPGGHRQTLLRPSAVVLGRYRQPACPLWAAVAKYRTVGLQQVPPDRGPALPLRNF
FT                   RHDPLLIQILDDNHPGAHIDWRISREFALRVLYLALDGGFAGGSPTTPGGVPFGGSGLF
FT                   GGSTAAAYRFRLTDRLSLTPEVYCILGANNVNQQGLTIGNVRATFEF"
FT   CDS_pept        complement(260984..261262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0253"
FT                   /note="ORF_ID:gsl0253"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88194"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88194"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP05"
FT                   /protein_id="BAC88194.1"
FT                   /translation="MRSALVLLLIGSLALPGAVQAQTYPYQGSSPYGYANGAYPQTGGT
FT                   NSAARRAQLQQRWAQLSPQQRQQIIRRYQMKQRSQGGAGRPGGFARP"
FT   CDS_pept        complement(261711..262379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0254"
FT                   /note="ORF_ID:gll0254"
FT                   /note="probable hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88195"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88195"
FT                   /db_xref="GOA:Q7NP04"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP04"
FT                   /protein_id="BAC88195.1"
FT                   /translation="MSERLVVFDLDGTLIDSEGGIVLAMERTALALALPGGTVERWRKL
FT                   IGMPLREQMPAILPAERLAEAPRVVECYREVYREIMLPMSRPFAGTDALVRALHRRGVM
FT                   LAICSGKRGRSIREVLAQAGWLEFFETIVSPDEVIRGKPDPESLKLALALTGFGVGEAL
FT                   MVGDTTLDIEMARAAGVACCAVTWGTHGREELVSARPDFWVETVEELAGRLDRWLGWSA
FT                   "
FT   CDS_pept        262472..263524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0255"
FT                   /note="ORF_ID:glr0255"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88196"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88196"
FT                   /db_xref="GOA:Q7NP03"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP03"
FT                   /protein_id="BAC88196.1"
FT                   /translation="MNLLIGSTTPCSGKSAIALGLGLRLRAAGRQVVYAKPLGTIAVEA
FT                   AGQWRDADCVLMNEYLGASVPPPVPLVFLDRASVRRRLSGEDTVDYRERLPDFAPEEPG
FT                   LVRLIEGAGTPQEGAVFELTLQVLAEQLPARVLLVCRYEEDLVIDQLLILRSQLGNRLA
FT                   GVILNDVPVDQQEDVGSVLVPFLERQRIGVFGVLPADTTLKSVSVGELVGTLGAEVLCC
FT                   RERLDQMVESVHIGAMSGSAALKYFRNAVNKAVITGGDRTDIQLAALETSTTCLVLTGY
FT                   LAPSQMVLARAEELQVPVLTVGHDTLATTEIVDRLFGQARFRESAKVDRIQQLLDRHFD
FT                   FERFEKVLGL"
FT   CDS_pept        complement(263635..263973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="ORF_ID:gll0256"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88197"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88197"
FT                   /db_xref="GOA:Q7NP02"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP02"
FT                   /protein_id="BAC88197.1"
FT                   /translation="MKKIEAIIRPFKLDEVKIALVNAGIIGMTVSEVRGFGRQKGQTER
FT                   YRGSEYTVEFLQKLKIEVVVDDGLVDLVMDKIMVAARTGEIGDGKIFVSDVDRVVRIRT
FT                   GERDDEAL"
FT   CDS_pept        264208..265020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0257"
FT                   /note="ORF_ID:glr0257"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88198"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88198"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP01"
FT                   /protein_id="BAC88198.1"
FT                   /translation="MRRAFAAIFSASCLLAPMTVAAREFNFSKPAPNPPSLSSPGPTRI
FT                   IPPPPQVAPRTPVVPASGTPQTAMPAASPAAVPTFEVITSQYDLPKGTQFNASAVRELV
FT                   YNPSDTLAMTLQVADDVRDGSGDVVIPKGSTVWGSFRPVAAKEPEDPATASREPRDNSS
FT                   WPEGSRFVAERVAIGDRIYNFKAQTEALPTQTDPRRNVGAEAGSGALIGAAGGAIVSIF
FT                   TGGLGLIPILAGGGLGAGVGAAVASTPVVFIKGDQPLQLTLLEPLRVR"
FT   CDS_pept        complement(265023..265439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0258"
FT                   /note="ORF_ID:gll0258"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88199"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88199"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NP00"
FT                   /protein_id="BAC88199.1"
FT                   /translation="MEAPLQTTEPIDRQPDSITLPTLIESYVDTFNRHDLTALGKLFHP
FT                   QATLVAPINVQVKGREAIVDYVAFKAKGMSIEVENIAVEADTVILGGRVRCPAFRVRAH
FT                   WHFRIIQGSIARLHLRLVASMQELLPLKDAGYGE"
FT   CDS_pept        complement(265494..266048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0259"
FT                   /note="ORF_ID:gll0259"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88200"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88200"
FT                   /db_xref="GOA:Q7NNZ9"
FT                   /db_xref="InterPro:IPR015233"
FT                   /db_xref="InterPro:IPR036917"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNZ9"
FT                   /protein_id="BAC88200.1"
FT                   /translation="MDEQQKAGTVNEANIGSDLEQLQETDQPLRSEAPEAVRSAQLEHA
FT                   VGQFNALEVDDKLAVLYGVYKLSGQAIDSATPDDANFEMTREFFGEFDALPQGEAQLEA
FT                   MRALLRRDGNAIGHIYSRYTETERLAIWLLLAKRMGSDVIGVPAGYQLSEQAQTILALV
FT                   QPLDFEQQITFLGDTVKDTDR"
FT   CDS_pept        complement(266243..266896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0260"
FT                   /note="ORF_ID:gll0260"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88201"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88201"
FT                   /db_xref="GOA:Q7NNZ8"
FT                   /db_xref="InterPro:IPR015233"
FT                   /db_xref="InterPro:IPR036917"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNZ8"
FT                   /protein_id="BAC88201.1"
FT                   /translation="MDEQQKVSADVEKAFEQGVGMIQPAEGQPAPGAQDGNAGAGVSGE
FT                   ELDTIVEQALDSEAPEAARSVGVRNAVEQFNALEVDDKLAVLYYLYEAMGESVTPAAPG
FT                   AADIELTTAFFGEFNALTDGDTQLEAMRALVRCEDNTLGREYGKLSENNKLVIWYLLAE
FT                   RMGDDVIGMPDDYQLGDLGQQNLVHVKELDFEQQITFLRDVVNPMGHDPIERAV"
FT   CDS_pept        complement(266974..267633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0261"
FT                   /note="ORF_ID:gll0261"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88202"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88202"
FT                   /db_xref="GOA:Q7NNZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNZ7"
FT                   /protein_id="BAC88202.1"
FT                   /translation="MPMVAVRIALAALWLGFVAYAFLGGPPETRSPLQQAASLADLALG
FT                   RGEPLSVALFNLMGLIPLAYLFLLVPDAHGEKLPAWPFAVASFAVGAFALLPYLICRRP
FT                   HGVWPHIPPAGRAARLFDSRWFALAVMAGVAGLFWFGLTQGNWAAFAEQWRTSRFVHVM
FT                   GLDFLVSTALLPLLIGDDLRRRSVKRTWPLWIACALPLFGPLLYLVLRPSLPARAV"
FT   CDS_pept        complement(267652..268176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0262"
FT                   /note="ORF_ID:gll0262"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88203"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88203"
FT                   /db_xref="InterPro:IPR012441"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNZ6"
FT                   /protein_id="BAC88203.1"
FT                   /translation="MGDNRTSATVGDALFDASGLYRYALWRRWDAMGEQVVFILLNPSA
FT                   ADAARDDATIRRCLGFSRRWGFGALAVVNLFAWRTANPRALARVTDPIGPDNDRVLAQV
FT                   CRGAGRVVVGWGNHGALHRRDQAVLALIDGEAHCLGLTRRGQPCHPLYLPGERRPEPLR
FT                   AKSTGRTHNRE"
FT   CDS_pept        268250..268885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0263"
FT                   /note="ORF_ID:glr0263"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88204"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88204"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNZ5"
FT                   /protein_id="BAC88204.1"
FT                   /translation="MQKRHQPGWLAWLGAACLAASYAPAFAQAPEYKGPGSTTQQQPQQ
FT                   PGSEEAAKQEAEQKRKIQEAETRNKAVLANNRGVELQKDGKNAEAVEAFREALLVDPTY
FT                   ELAKQNLAASHFNLASEAIGKQQWAAAIENLEAARTYDKSLREKTTVPLAGSYNNQAAE
FT                   LVEAKRLDEAVGAMEKAAELDSKYEEELRKLKDYRAQVNSQQKPGKSK"
FT   CDS_pept        268988..272074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0264"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /note="ORF_ID:glr0264"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88205"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88205"
FT                   /db_xref="GOA:Q7NNZ4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNZ4"
FT                   /protein_id="BAC88205.1"
FT                   /translation="MRWNISAWSIRNPVPTVVLFLMLTVAGVAAFLNLSIAAEPDIDVP
FT                   AVSVTVTQLGAAPSELETQVTRKIEDAVVGLGNVKRLTSTVNDGSSVTRVEFFLGTNTD
FT                   RAVNDVRDAVTKIRAQLPQSIDPPVVRRNDEAGGPILGYTVYSKQRTNAEISWLVDNTI
FT                   TRAVLTVPGVSRVYRSGGVTREVRIELNPNRLQALGVTADQLNGQIRALNIDLPGGRGE
FT                   VGPGEQAIRTLGSAATVERLAATQILLSDGRYARLDTLGRVLDGTTEPRQIAYLDGKPG
FT                   VAFEVVRSKGSNLVNVEEGVEKKVAELKKILPADIRIDPTWTVGDFVRESYEASVDALL
FT                   LGAALAVVVIWVFLRDWRSTLIAGLAMPLSAIPTFAVMKTLGFTLNSMTLLALALVIGI
FT                   LVDDAIVEIENIVRHIGMGKSPFQAALDAADEIGLAVVATTMTIVAVFVPVAFMGGIQG
FT                   QYYRQFGITVAAAVLFSLVVARMLTPLLAAYLMQPLPEAEGKGALARLYDRFLGWAIDH
FT                   RWVTLAVAGVFFAGSLTLFQTIPTSLIGAVDDNQSTLAVELPPGATFAQTRLAVERVNA
FT                   IVMGREEVSKLETTVGTYDNSGKINEAKFYISLKPKSERKNSKQKFEAAVREELIAIPG
FT                   VRFAFSGGNWDSIKTLQIVLKSDDSVALRRTAAALTDQMRSLPGLTDVSSSAAILRPEI
FT                   QVRPKFDRAAELGVSVQAIARTALIATLGDREADLAKFNLPGRQINIRVQLDAAFRGNL
FT                   EAIRDLRVASATGELVPLKAVAEVNLGSGSAQIDRYDRARQVTVGANLLPGTELGPALS
FT                   QVHQLPALRNLPAGVSEQLTGDAENQRDVFEGFGFAIGAAVLLIYAVLVLLFGGFLHPL
FT                   TIMVSLPLSLGGVVLGLLLFGKSLGLYALIGIIMLMGLVTKNAILLVEYGLMAIEAGQP
FT                   RRTALLQAGESRMRPILMTTIAMIAGMLPIALGLGAGSEVRSPMAVAVVGGLVTSTLLT
FT                   LIVVPVVFTCIDDVQQWLLRLAGGTPKASPAAAAPAQQQ"
FT   CDS_pept        272122..272370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0265"
FT                   /note="ORF_ID:gsr0265"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88206"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88206"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNZ3"
FT                   /protein_id="BAC88206.1"
FT                   /translation="MKGLEFVAIGVALMSERPRLRVDLQTHRQHLEQARENLDALRQWS
FT                   EQLQYYLERLERQHAQSPLGQFQARQRTHQQVVSLSE"
FT   CDS_pept        complement(272408..272959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0266"
FT                   /note="ORF_ID:gll0266"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88207"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88207"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNZ2"
FT                   /protein_id="BAC88207.1"
FT                   /translation="MSIIGSVHLTISGDGRWLEEFRARAEARTPYTRDLHFPNFLPRLK
FT                   ALGAHVLSDEGSRLKVGVGIVTTGITPKGNKWLNFKPDPDWPEPVELPKDANTKLIERS
FT                   ERHLVYTAWQKSFWAPRVIHFLARAHPELEFWYKFRFEAVYGWGRAKGRDVFHNQFSGE
FT                   GQEQHWLDFELWEYNPQCSL"
FT   CDS_pept        complement(273559..274659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0267"
FT                   /note="ORF_ID:gll0267"
FT                   /note="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88208"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88208"
FT                   /db_xref="GOA:Q7NNZ1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNZ1"
FT                   /protein_id="BAC88208.1"
FT                   /translation="MLGERIKLARRKAGYSLRNLADRMGGRVSAQAIGKYERGEMVPGS
FT                   DNLIALSRALEVSVPYLLDSQGIELTGVDFRAQAGITGAERARVQTEVLEWVERYLQIE
FT                   RILELDDGQWEMPFAEPRKLASVQQAESLAEEVRNRWNLGWDPIPNVTELFEEQGFKVL
FT                   VVGLPAKVSGFTCLVHRSQAQSAVPVVVVNEMCSIERRRLTMVHELGHRLIDPEPLCTS
FT                   EEEKAATRFAGAFLMPKEHLIRECGRERHKLSYQELIDLKQLYKVSGAALLVRLRDIGV
FT                   ISDAYLTYAFQSFARTWRSQEPESLERDPTCAKLEPAQRFERLCHRALAEGLISLSKAA
FT                   ELLRRPVKVVESELKGPVASDADHHQ"
FT   CDS_pept        274824..276527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0268"
FT                   /note="ORF_ID:glr0268"
FT                   /note="similar to multidrug-efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88209"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88209"
FT                   /db_xref="GOA:Q7NNZ0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNZ0"
FT                   /protein_id="BAC88209.1"
FT                   /translation="MKTRRPSFGRYHRKCALVTGDSVVQYQRPIDYTTALDERTKRLVM
FT                   GAVLIALFLTSLDQTVVVAALPKIVADLGDLDLLAWTSASYLLVSTTSLPILGKLSDLY
FT                   GRKNILLIGIAIFLLGSFLCGLAPSMLMLVVFRGIQGLGAGAITSVALTIPADLYVPAE
FT                   RAQLQGIIAAVFALSSIVGPLLGGVLTDTLGWHWIFFINLPFGLLALAFIVAFMPRLNS
FT                   GLTRSIDYWGAVLLMLTVVPLLVALSLEKEKYAWDSPLVLGLLAAAAVSFGLFVFAELR
FT                   AKEPILPLSLFRIPIFSLICAMSVMVGATFIVAILFLPVFLVNVMGASATEAGVALIPE
FT                   TLGLLVSSFISGLVVQRTGRYKAAMLVGLVLMSIGIFLLTQLSLTTTIAQVWFSIAIFG
FT                   LGAGATFPQANLALQNAVPFEYVGVATAGRLFFAQLGQTVSAALYGALLVAYLNTALVD
FT                   SLQPVAARLPASLATHLDPGRLRNGGEQAAAELAALGTEMAPRFTPEVRRRTEAQVRTA
FT                   VRRSFAEAVARVYQASLPLPLIALLLGLLVPELPLKRSNSPDTPPAAVHE"
FT   CDS_pept        276568..277215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0269"
FT                   /note="ORF_ID:glr0269"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88210"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88210"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNY9"
FT                   /protein_id="BAC88210.1"
FT                   /translation="MQPQERYTLARRGVLMGGALVPWLWRPASTAAQSAAPSKYAGKIL
FT                   FSREPIVIGSENPAALTHRFSSKDNIYGVAYFAKSIRELGIDKSYAVLIKKTYKNRTST
FT                   VQDNWNFEGNLRGNENNPEILENRTFYLDISPDPADTQIFRRFVAASAYQLWSLGGGVK
FT                   GKPISYTMDVTFVSFDVATSTRTVCATGSFSLDRYTEDTSRYLKLYESNGRQ"
FT   CDS_pept        277262..277684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0270"
FT                   /note="ORF_ID:glr0270"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88211"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88211"
FT                   /db_xref="InterPro:IPR010413"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNY8"
FT                   /protein_id="BAC88211.1"
FT                   /translation="MAMTLKEFLDECGALGLLRFIVTNDTAVLEARGELKNPFYVPHLP
FT                   HYANLHSEHFEFHLNMAEVKLVRFEALPAKRGNFTTYAVRFLKEDGQKAPMSLFLQWGR
FT                   PGEYAPGQVEAFQALKNKYGESWVPEPVAAPAAAPA"
FT   CDS_pept        complement(277718..279418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /product="DNA repair protein"
FT                   /note="ORF_ID:gll0271"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88212"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88212"
FT                   /db_xref="GOA:Q7NNY7"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNY7"
FT                   /protein_id="BAC88212.1"
FT                   /translation="MLTHLRIENFALIDNLALDFAGGLNVLTGETGAGKSIILDALDVV
FT                   LGGRVSGAQVRTGAQRAVIEATFGPSAAIADWLAAQQIDSLEEGLVVVREISGKTNRAR
FT                   VNGVLVNQAVLRELREQLLEITAQGQSLQLEKPEVQLELLDNYGEIAPRRERFRQVYET
FT                   LQRRKGELARKKAARDDRLQQLDLFRFQFEELSRAALDDPQEEEQLLADRSRLAHAVEL
FT                   QHNSLKLYEMLYEGALDQPAVTDLLGQSSELLIQMGEYDASLVPLGEMLENALVQVQEC
FT                   ARAVNRYGETVESDPETLEYTEKRLRQLKNLRQKYGPTLADVIAHYRNLERDLAAIEGS
FT                   GEDLEVEERELAGETRRATELAAELTRARTEAAGRLEGDLVRELAPLGMGKVRFAVRIE
FT                   PSRLASSGADRVGFLWSPNPGEPLQPLTETASGGEMARFLLALKACLGGADRIATLVFD
FT                   EIDVGVSGRVAQAVAEKLLQLGASHQVLCVTHQPLVAALADSHYRVHKAVLAEAGEERT
FT                   VVRVETLNKTEARREELAQLVGGHSAHEALEFAGALLADADRRRSAVRP"
FT   CDS_pept        complement(279529..279870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0272"
FT                   /note="ORF_ID:gll0272"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88213"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88213"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNY6"
FT                   /protein_id="BAC88213.1"
FT                   /translation="MVNNICAFVALIALQGYGRELPLTLRKVLSKFDPRIGSFDIERES
FT                   TKEKFSIFVSNLLRLTKQKSFFGCQTTTEIEDAAIDWIEKPLPSASVRDSAYEDRQKSM
FT                   SGRNDIADR"
FT   CDS_pept        281155..281829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0273"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:glr0273"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88214"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88214"
FT                   /db_xref="GOA:Q7NNY5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNY5"
FT                   /protein_id="BAC88214.1"
FT                   /translation="MKEVFINNAEICILIANCHTVVRRGFCSFLRSTEERFCVHEVEDG
FT                   EQAVQLLGALKPDLVLLDAVLPKMSGVEVIRLFRSKDPSARILMVADDEEQVMLAFHAG
FT                   ANGCLLKSVQGHELLNAVGLVLSGYLVFGQAITRLVAEEQGTGKFGRAAGSVPRLTARE
FT                   HEVLMLIAQELTNNEIAKRLYISPRTVDSHRARLMGKLGTRNTAGLVRIAAECGLLKAK
FT                   VG"
FT   CDS_pept        complement(281893..283740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0274"
FT                   /note="ORF_ID:gll0274"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88215"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88215"
FT                   /db_xref="GOA:Q7NNY4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNY4"
FT                   /protein_id="BAC88215.1"
FT                   /translation="MDSIPSIPSSLADSLARYTEFRTATLAGWHPSKREMLILTRFSDT
FT                   NQVHRVQIPGGDRSQQTFFADRIQGASYPPKPTGEFFVFAKDTGGNEFSQLYRYDPADG
FT                   TVNLLTDGKSRNTGATWSHTGRQIAYTSTRRNGKDTDIYLVDPLKAQSDRKLAAVEGGG
FT                   WGVLDWSPDDKKLLVLEYVSINESYLWLFDAATGEKNLITPKGGTEKVSYGAAQFAADG
FT                   RGIYLTSDRDSEFQRLQYLDPAGNTTKILSGGIPWDIESFELSPDGRLLAFVANEDGIA
FT                   KLHLLETATGKERPVPKLPVGLIGSLEWRPDSRELGMTLTAARSPADVFSWNVATGKVD
FT                   RWTRSETGGLNTATLTEPKPVRWKSFDERSISGFLYRPPARFTGKRPVIINIHGGPEAQ
FT                   FRPGFLGRSNYFIDELGAAMIFPNVRGSAGYGKTFLQLDNGFKREDSVKDIGALLDWIA
FT                   TQPDLDPARVMVTGGSYGGYMTLAVATLYNDRIRCALDVVGISNFVTFLEKTESYRRDL
FT                   RRVEYGDERDPKMREFLQAISPANNAAKISKPLFVVQGQNDPRVPLNESEQMVATVKRG
FT                   GSPVWYLMAKDEGHGFAKKKNADFQFYATVTFVQSYLLN"
FT   CDS_pept        283991..287011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0275"
FT                   /note="ORF_ID:glr0275"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88216"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88216"
FT                   /db_xref="GOA:Q7NNY3"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNY3"
FT                   /protein_id="BAC88216.1"
FT                   /translation="MTSTRSRLLLSAMLATSLTLQPLAAIAQTSLPVGDIGGNASIIPT
FT                   GQVVTPTAAPGSTYARLSTGLRPDGNADAQGAVKTALSPDGKTLLVLTSGYNQYFADPT
FT                   TGEFFSYPVLDPITGLASTVTNPQAEWVFVFDVSSGALVKKQQINIPNTYNGLVWAPDG
FT                   KRFYVSAGIDDRIYVYKFDSGRYVPDAPFILLGHNSNQTDPFPAYDGGILKGTPADAAS
FT                   GGLITTGAVAAGLDISRDGKTLVVANFQNDSISIIDTASRTVIEEIKFFVPGGTVATGE
FT                   LPFDVAIYSDARGAAAKVFVTSQRDDEVLAVDLASKVVTRIPVGGQPNKLVLSANQGRL
FT                   YVANGNSDSLTVIDPVTNNVVRAISLSRPGYKYKGSNPNAIAFSPDGKKLYVTLGGENA
FT                   VAVVDQASGKVEGRIPTGWYPNSVSVIGSKLFVVNAKSNVGPNPSNGRTTAAGEATNTT
FT                   FKEEYNWALEKAGISTIPVPGGASLARLSARVDKNNGFGNQQPDALMAYLRTKIKHVIY
FT                   VVKENRTYDQVLGDLPVGNGDPSLTLFPEPISPNHHKLATDFVILDNFYNPGESSGVGW
FT                   SWSTYARTTDYTEKTQSVLYGNANFRGLTYDYEGTNRNISVGLPQTSPTPNQINTRVTG
FT                   VLDPSGSSSILPGTKDANAPEGDGDLEPGAIGGYLWDAALRAGKTVRNYGFFIDLAYYG
FT                   TSLADPTVPDPANPLYIPITRTPFASGIPQAPGTKPALLDKTDIYFRGYDQKISDIFLY
FT                   EEWKREFDGYVANNNLPNLQLVRIMHDHFGSFDQQAVAGLDTAETQMADNDYALGKLVE
FT                   AVSKSIYWKDTAIVVLEDDSQDGPDHVDGHRSIAYVISPYTKRGALVSTNYTTVSALRT
FT                   IEDLLGLDYLGMLDANTRPMADVFTRVPNFNTYTAVIPGILCAPPVDPTLVPECADAAA
FT                   LKTVAVKPLHDGQWWAKASKGFNFSVEDKLDVVAFNRLLWQGIKGTGVSYPEERNRKDL
FT                   RNNRTQLLNNWTAKQPK"
FT   CDS_pept        287066..290083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0276"
FT                   /note="ORF_ID:glr0276"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88217"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88217"
FT                   /db_xref="GOA:Q7NNY2"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNY2"
FT                   /protein_id="BAC88217.1"
FT                   /translation="METVRMDNNPLDKKTTFPRWRWPLSRPLTIGAVVLGVLGSTALVA
FT                   GSIGSQSVYYRAPAGDLPATRQYTVGGYQGAVLPNGRFITPIGIEVDVTAPKPFGMVLS
FT                   PDGDTLLTVNSGSTPFSVTLIRYVKSANPQATRIDLDATFVGAAFAPDGSRFYVAGGEN
FT                   GNIWVGDTAAAKIVGSVNLNGSERAYTPPVDPKQQPQPYFKGTFPGQMALSGDGRYLYV
FT                   VDQGSFQVFVVDTGKIAVGTDDQGLITEPNNFEAVVRSVKVGRYPFGITLSADSKTLFV
FT                   ANVGVFQYTSLAPASPTGDSNKDYPLCYPGAGYPEETVRSRQIQITKVDPRNLPPTLRD
FT                   PRGIRCGYIPQSQSYTVPGLGSPNAPESSSVYVLDVSTPTEPVLKKVVKPGPLVGEVEE
FT                   GIETYSGSHPNAVAISPSYIYVSNGNNDSVSVLDPRSYRELSRINLSVLQGLDRRVKGI
FT                   QPVALALSPDNQYLYVAQAGINAVAMVRLEGTAGRVMGHIPTGWWPSSVKVSADGRTLY
FT                   VASANGRGAGPNNDTPPDNLGSPKSSTIGTVNIFAVPSGPQLERYTQRVLANNGFVARP
FT                   LTDVENPIPSRVGVASKQIKHVIFLNKENVTHDLLLGDITQTRKGVPVNGEPRYALGAN
FT                   ASPNHHELALAFAFSDNFYLEPNVSSDGHRWLTNTYTTEFEQTHWPASYGGRRNDAGTD
FT                   PEVFGPYPGRLGFTDANGSPDPHDYNQHGGIYLHLARNGKSFVNFGNGYEFAIVAADFG
FT                   TEPTGIRQQVNVPMEKVVRDNSDHLFPEYNTKIPDAPLQEDPTRFNRYARFKQVFESRY
FT                   VDRKTNTCKLPDYVDLFYPNDHGGGANDIFPDGPAWDYTRYVQDNDAALGLTVELISKS
FT                   PCWKDTVIFVTEDDTQNGFDHVDGSRTIFLAISPWVKREYVSKTHTSLASIFKTTHLIL
FT                   GIPPLNQYDAAATDLRDMFTSTPDFTPYTFVPIQYVAKANPAWKALTKDVDFSRPDADE
FT                   LKLRRAILLSSGLPRK"
FT   CDS_pept        complement(290361..290669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0277"
FT                   /note="ORF_ID:gll0277"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88218"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88218"
FT                   /db_xref="GOA:Q7NNY1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNY1"
FT                   /protein_id="BAC88218.1"
FT                   /translation="MKCPACQSDNFSKNGHRRGVQYYICKDCCKQFLEYYTPQGYPEKV
FT                   KRNCLTMYLNGMDFRGIERTTGVCRNTVINWVKQAALALPDLPQTKKISTVAQLDKL"
FT   CDS_pept        290876..291148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0278"
FT                   /note="ORF_ID:gsr0278"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88219"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88219"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNY0"
FT                   /protein_id="BAC88219.1"
FT                   /translation="MISETSAVAFRQNLGEMLNQVQYRHDSILIKKDGKPVAALVDARL
FT                   FERIRRMQARFDALCQRIEAGYAQLPEAEGLAEIDATVAQVRAGR"
FT   CDS_pept        291151..291582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0279"
FT                   /note="ORF_ID:glr0279"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88220"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88220"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNX9"
FT                   /protein_id="BAC88220.1"
FT                   /translation="MPALSVVLDTNVLLSGIAYPASVPGKLIAAWKHGALDIVLSAYIL
FT                   DELRRVLPKLAHRHGLSAGEIDDLIDALAIQAELVEPEASNDPALSDANDQPVLGTLVA
FT                   ALRGGQAQTLITGDRALLALRDRYPIRTPAEFWAVHGGV"
FT   CDS_pept        291854..294058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0280"
FT                   /note="ORF_ID:glr0280"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88221"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88221"
FT                   /db_xref="GOA:Q7NNX8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNX8"
FT                   /protein_id="BAC88221.1"
FT                   /translation="MVLGWSRGVALTVALGSAALAGGAVRAEQASDLLKDQTQAQGLIE
FT                   PRAVGEDLPEVTVTATKSREEQVYKVPLAVTVLSQQRASERDGTTIVDLLKGETGVWVQ
FT                   SSGPGQGTPFVRGVTGREVLLLQDGFRISPAFIRSGPNQYLALLDPYAFERLEVARGPV
FT                   SVLYGSDALGGAVNVVGATPQFTGEATQAKGRVYAGYGTANAERSGRLEVSAGSEGKAF
FT                   SLGLTYRGFDDFHLGGSPNPQLLFPNADPRLVSGSGYEYYAGQLKFAVNFDPTQRLVLG
FT                   LEYNEVPRFAAIDSLIQGYGSAVIDASNFFTPQSRLFTTLTYEVKPRESWLTSGQLKLG
FT                   YQRILDDRLRRSYSTRPSFPSFGSGVADAFYNSERNNSNLFGTQLTLESVAGRHTLTYG
FT                   GEVYSDVIFSDTVRRFDAGSTAVRPSRYVSGSTFEQWGIFLQDYIRWSDRVSTVLGVRY
FT                   SSVTARVPADGLRDSPAFTNNSSDFTYNLSNAFFITPEINYVLNVGRGFRAPNISDLSQ
FT                   AGVEGNFFNSPNPNLRPEQVFSIDTGFKFRTGTFTGELFGFWSKYSDRILTVLTGNTVA
FT                   GLAERRQENAASQIIGGIEFGGQWRVIPELALLGTATWTQGDTTLNTGEVVPADRIPPF
FT                   NGVVGVRYEPPAGKFYVEPLLRYAGAQNRLAPNNRSDNRINPNGTPGFFVFDVRAGLSV
FT                   GESLWLRLVAQNLTNNNYREHGSSLDGLGTNIFFNVDYRY"
FT   CDS_pept        294067..294759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0281"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:glr0281"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88222"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88222"
FT                   /db_xref="GOA:Q7NNX7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNX7"
FT                   /protein_id="BAC88222.1"
FT                   /translation="MVRILLAEDDERIAIPLAEDLTHQHYLVDVAADGKAAWHYATSYH
FT                   YDVLLLDVMLPEIDGFALCRRLREAGYEQPILMLTALDRTTDRVAGLDSGADDYLVKPF
FT                   SLEELGARVRALLRRSGPTRGPVLKAGPLSLDPLMLQATYGGLPVHLTPKEYRLLECLL
FT                   RHPGQIFSREMLLDRLWEPAHAGGDDAVKALVLRLRRKLQEAGAPQDLLKTVHGFGYCF
FT                   NRCAMEHE"
FT   CDS_pept        294756..296066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0282"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="ORF_ID:glr0282"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88223"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88223"
FT                   /db_xref="GOA:Q7NNX6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNX6"
FT                   /protein_id="BAC88223.1"
FT                   /translation="MIEPSLFTRTRLQLLAGFLGVLAAILLLFCAGVGGFFRLALVQRF
FT                   DQQLAAFAHAALNTIDIEEGEFDFRSAPQASSQPLPTDTEVQWFDPEGRLLREVGALPG
FT                   IAAQLAERPATGRFESLPGPLRAWVEPVRAPGGTLAGYLRVTRSFETVEGPFGQLLWGL
FT                   AAGIPAVLLVSAAGGWWLTGLVIRPVEDTLRRLEQFAADASHELRNPLMAIQSNCAVAI
FT                   KYPEQMRPGDRQKFLRIEDAARQLLTLVQELLMLARTGEGIAAPEPVDLAHLVRELAAE
FT                   YRPRTCERDLQLDLAIEASPASWQVSGKAVQLRCLLANLIENAVKFTPEGGSIAIRLSR
FT                   EPREILVQVSDTGVGIVPADLPHVFDRFWRADRSRHRQGGSGLGLAIAHGIAQAHGGTL
FT                   DARSVPEHGSTFTVRLPAVHESRRQGKNGGPGLTATR"
FT   CDS_pept        complement(296050..296946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0283"
FT                   /note="ORF_ID:gll0283"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88224"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88224"
FT                   /db_xref="GOA:Q7NNX5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNX5"
FT                   /protein_id="BAC88224.1"
FT                   /translation="MPPTLRAFWKFTRPHTIYGTAASLVGIFLIASASLGAITAEGLAA
FT                   LLVAQVSCLCANVYIVGLNQLTDIKIDRINKPYLPIASGEISPRTGTALVGILGVAALV
FT                   IALQNLYLFATVAASVLIGTAYSLPPLRLKRFALFASLCIFTVRGLIVNLGLWGYFLDG
FT                   AGQPVQFGPAILCLSLFVTLFTFVIAIFKDIPDMEGDRRFAITTFSLRLGKRFVFDLSC
FT                   WLLAATYLLVSALSTLFLSPAGITFLLVFHTAMLAVFFYRRGQVDLKDNAEITDFYQFI
FT                   WKLYYVEYLVYPLTWWL"
FT   CDS_pept        complement(297002..297259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0284"
FT                   /note="ORF_ID:gsl0284"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88225"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88225"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNX4"
FT                   /protein_id="BAC88225.1"
FT                   /translation="MVQRASRKKMSAAPRILAVFAAFALVAWLVVRCTDEQPPNSVPIC
FT                   IDNPRIDPDNDKNGPRASESAGDATPYAGTPGAAVGKVCR"
FT   CDS_pept        complement(297229..297459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0285"
FT                   /note="ORF_ID:gsl0285"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88226"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88226"
FT                   /db_xref="InterPro:IPR021954"
FT                   /db_xref="InterPro:IPR038150"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNX3"
FT                   /protein_id="BAC88226.1"
FT                   /translation="MDNDAEYYVLLRTGQEEQFLTEVELQAVLADAVRRAEGLEGEALA
FT                   HQVKFLLDTACDYPTLPGEYLQWYSVRLEKK"
FT   CDS_pept        complement(297452..297973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf37"
FT                   /note="ORF_ID:gll0286"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88227"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88227"
FT                   /db_xref="GOA:Q7NNX2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNX2"
FT                   /protein_id="BAC88227.1"
FT                   /translation="MNDNLRIFYLIGLAALLGWLAWQVFRQVRRNVGVEGVINKLQPKV
FT                   KGGQASAQDYYELGCAYLEKRLYMDATENFKKALQAEPEFAEAHNNLGFCHFQQRQYDL
FT                   AIREYKDAVRFKPDYVSALNNLGHALEMKGQALQALEAYDQVLTLQPANATAERRARAL
FT                   RKRVPSTADG"
FT   CDS_pept        298070..298738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0287"
FT                   /note="ORF_ID:glr0287"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88228"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88228"
FT                   /db_xref="GOA:Q7NNX1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNX1"
FT                   /protein_id="BAC88228.1"
FT                   /translation="MYPDEPMMTLPIASRPDEGDDGLFYQQPRLVQHIDLSFIANLQEV
FT                   FRQYLPENATILDTMSSWVSHLPEELKTAKVVGHGMNSVELAANPRLDEFFVQNLNQNP
FT                   KLPLADSTFDAALNTVSIQYLVDAPIVLAEVNRVLKPGGVVIISFSNRMFPTKAVHRWQ
FT                   NSEEEERVDLVQQYLLAAGGYTDLRVHRKLPTGLTFFFSQQRDPFYCVTARKGAPEVRR
FT                   "
FT   CDS_pept        298802..299350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrf"
FT                   /product="ribosome releasing factor"
FT                   /note="ORF_ID:glr0288"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88229"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88229"
FT                   /db_xref="GOA:Q7NNX0"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNX0"
FT                   /protein_id="BAC88229.1"
FT                   /translation="MNVSKTEQDMRKAIEATAGNFATIRTGRASTSLLDRINVEYYGQP
FT                   TPLKTLATITTPDASTVLIQPYDPSSLRLIEKTILESDLGLPPSNDGKTIRLNIPPLTA
FT                   ERRKDLVKVLRNLAEEGRVAVRNIRRHAIDEVRKEEKDAKVSEDEARRLQDEVQKLTDK
FT                   SIQQIEKLFEAKEKEITTV"
FT   CDS_pept        complement(299403..300137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0289"
FT                   /product="cobalt ABC transporter ATP binding protein"
FT                   /note="ORF_ID:gll0289"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88230"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88230"
FT                   /db_xref="GOA:Q7NNW9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNW9"
FT                   /protein_id="BAC88230.1"
FT                   /translation="MIEPLVVEELHYSYPDGTAALRGITLALGTGENVALVGPNGSGKS
FT                   TLLLHLNGLLLPGRGRIEVGGKPLSASTLEFARRFVGLLFQNPEDQLFMPTVGEDVAFG
FT                   PQNLGRKGEKLRECVRTALERVGLEPARFLERQSYNLSIGEKKRVALAGVLAMEPEVLV
FT                   LDEPSAGLDPRSRRRLIRLLTELPQTKLVATHDLDMALETCTRTIIIDRGQVVADGPSD
FT                   QILADRVLLETHGLELPLSLGR"
FT   CDS_pept        complement(300134..300913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0290"
FT                   /note="ORF_ID:gll0290"
FT                   /note="cobalt ABC transporter permease protein CbiQ
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88231"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88231"
FT                   /db_xref="GOA:Q7NNW8"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNW8"
FT                   /protein_id="BAC88231.1"
FT                   /translation="MILLHVPTFSLAAYAQGDSFWHRLQPRVRLAVALLLVLGAVLLPE
FT                   GAWNYWGLYAAVLAILMLLSQVSPVALLRRLAVELVFVGVLLLTILLSGRGTPLWTWGP
FT                   LVIADGSLLTFASVLVRSALSLWVLNLLTLTTAAPSLLQALAGFGCPALLVRVLESMLR
FT                   YVAVLVDELGSMQRAAQARSGARALLRWNILGNLLGALFLRTYGRGERTYLAMQARGFT
FT                   GRFPEADARPWRPDERLVTAAAALFAVSTLTLAWWRL"
FT   CDS_pept        complement(300910..301227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0291"
FT                   /note="ORF_ID:gll0291"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88232"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88232"
FT                   /db_xref="GOA:Q7NNW7"
FT                   /db_xref="InterPro:IPR025937"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNW7"
FT                   /protein_id="BAC88232.1"
FT                   /translation="MGARSRWVLAGLGLALLVAIVSPLASPDPDGLERVATDQGFAHRE
FT                   APSWAEKLPFAEWFAGYELRGLSDPAAAKIAAGIAGTLAVFGLAWGAGAVLARARGAKR
FT                   P"
FT   CDS_pept        complement(301217..301909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0292"
FT                   /note="ORF_ID:gll0292"
FT                   /note="cobalamin biosynthesis protein CbiM homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88233"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88233"
FT                   /db_xref="GOA:Q7NNW6"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNW6"
FT                   /protein_id="BAC88233.1"
FT                   /translation="MHIPDGFLSLPVCLAMGLVSLVILGIALRQVERQFADRLVPLMGV
FT                   SAAFIFAAQMINFPVLGGTSGHLLGGTLAGVLLGPWAGTLAVMVVFGVQALLFQDGGIV
FT                   ALGANLFNMGFVGTFLGYYLYRGLRTLLGGTSWLATATGTAVASWVSVVTASALVAVQL
FT                   ALSGTVNLAVVLPTMVGVHALIGIGEAILTVGVVSFLWRTRPDLIFEPPAPPLLEAVQP
FT                   VKESIRGR"
FT   CDS_pept        302038..302769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0293"
FT                   /note="ORF_ID:glr0293"
FT                   /note="probable carbonyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88234"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88234"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNW5"
FT                   /protein_id="BAC88234.1"
FT                   /translation="MGATFGGTFMDKKLAVVTGGNRGIGFEVSRQLANFGHRVILTSRD
FT                   PEQGKTAAEKLQSEGLDVLFHPLDVTDPASAEALAGFVRERFGRLDILVNNAGILQDGG
FT                   ADAARLLDADLDMLRTTFETNTLGPVLVAHALVPLMQGRGRVVNVSSGAGQLADMGSGY
FT                   PAYRVSKTALNAVTRILANELADTKILVNALCPGWVKTDMGGPGAARTPEQGADTVVWL
FT                   ATLPDNGPTGGFFRDRKPIPW"
FT   CDS_pept        complement(302969..303631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0294"
FT                   /note="ORF_ID:gll0294"
FT                   /note="ThiJ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88235"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88235"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNW4"
FT                   /protein_id="BAC88235.1"
FT                   /translation="MSDLQKYIVGLVMYPGMTALDIVGPQTVLGALPNMRLHRIWKTLD
FT                   PISTDDGMVIVPDTTFENCPPLDVVCVGGGLGQRAVVDDPQVLEFLRRQGSGAKFVTSV
FT                   CGGSEFLAKAGLLQGYRSATHWTARKQLAELGVEVAAERVVIDRNRMSGGGVTAGIDFG
FT                   LVLAAALCGEQTAKIVQLLLEYDPAPPFDAGSPEKAGLDLVNQALLYAEGTLNLKVN"
FT   CDS_pept        303729..304439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0295"
FT                   /product="LuxR family transcriptional regulatory protein"
FT                   /note="ORF_ID:glr0295"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88236"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88236"
FT                   /db_xref="GOA:Q7NNW3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNW3"
FT                   /protein_id="BAC88236.1"
FT                   /translation="MMISLQQLFEEIHQIEGEENLQSHLAPKIGAYFAAQRSGIFLFDR
FT                   LLSDRKLRPVLNVALSIERNPIARYIAERHTPVHEGLVTSPRAWALVCPRPDHWHVMAG
FT                   PVLDRNQLVGAVGCTRARSMPAFDHQNLTDLSAICLHLSVWTTTARASPKPQFQTLAAH
FT                   RLTPRELQIAGLVALGRTNAEIGTELWITENSVKQALKRMYRKLEVTSRTEMITQLLGK
FT                   SSRFPEAIWSQSTL"
FT   CDS_pept        304604..305089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0296"
FT                   /note="ORF_ID:glr0296"
FT                   /note="probable acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88237"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88237"
FT                   /db_xref="GOA:Q7NNW2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNW2"
FT                   /protein_id="BAC88237.1"
FT                   /translation="MISIRPASSTDDLAIITGLFQAYSTSLGLDLSYQDFESELAGLPG
FT                   KYAPPAGALLLARDESNSPLGCVALRPLSIEGVCEMKRLYVASEGRGRGIGKALMLAVI
FT                   GEASKKGYREMRLDTLPAMVTAQAMYRAAGFEPMEAYYATPVAGTMFLRLRLQRPQA"
FT   CDS_pept        complement(305135..306043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0297"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /note="ORF_ID:gll0297"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88238"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88238"
FT                   /db_xref="GOA:Q7NNW1"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNW1"
FT                   /protein_id="BAC88238.1"
FT                   /translation="MRITVLSGSDSPEREVSLVSGRAVQAALETLGHEVTMVDPGPDLP
FT                   VRLLENPPDFVWIALHGDKGENGKLQGLLDWLGLPYNGSGVTASAIAMDKVVSKRLFVA
FT                   EGIPTPAYRVAEAVPQVSECQAWLAALGSPVVVKPADGGSTVGVTIAREAGHLPEAVRL
FT                   ALQYSPQVLIEQYIPGQEITVALLDGLVLPAIEIVPQGRDFYDYEAKYAPGGSRHLIPP
FT                   NLAADVLKASVDAAYRACRAVGSTGLVRADVRVDPEGRPWVLEVNTLPGMTATSLAPEA
FT                   AQAAGIDFEQLIQRIIDRSLD"
FT   CDS_pept        complement(306122..307381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /product="cell division protein"
FT                   /note="ORF_ID:gll0298"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88239"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88239"
FT                   /db_xref="GOA:Q7NNW0"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNW0"
FT                   /protein_id="BAC88239.1"
FT                   /translation="MGIFDSNPDEKIQAAAYFQSKSHVRLNETSAGSYRAMAPQPGMGM
FT                   RIDEIVPSSVALIKVVGVGGGGGNAVNRMIASNVVGVEFWAINTDAQSLTQSSAPQRLQ
FT                   IGQKLTRGLGAGGNPSIGQKAAEESREEIMTALEGADLVFITAGMGGGTGTGAAAIVAE
FT                   AAKEVGALTVAVVTRPFTFEGRRRMQQADSGIEALQGRVDTLIVIPNDKLLSVISEQTP
FT                   VQEAFRIADDILRQGVQGISDIITIPGLINVDFADVRAIMADAGSALMGIGMGSGKSRA
FT                   REAAMTAISSPLLESSIEGANGVVLNVTGGHDLTLHEVNEAAAVIYEVVDPNANIIFGA
FT                   VIDEKLQGELRITVIATGFNGIAPAVKAGKARLSESSAEGLTGKAPSNNGPNPASPNRG
FT                   TAGEDVLDIPEFLRRRRPLV"
FT   CDS_pept        complement(307464..308279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0299"
FT                   /note="ORF_ID:gll0299"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88240"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88240"
FT                   /db_xref="GOA:Q7NNV9"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNV9"
FT                   /protein_id="BAC88240.1"
FT                   /translation="MNRSKIIHIAPQGTFVTTVLSKAVLVARRQEFRRRRWLWRLLGLW
FT                   RVLLAAGLAAGLVWLAREPFWQIRSAGAVRIVGYERLQLDQLQRVLKLDYPQPILSVRP
FT                   EQLQQRLLEALPLEAVRVERQLLPPSLSIEVQEREPVASAPLPNRPGIIDRSGVWIDSH
FT                   QYRDFRPPQLTVWGYSAEKASVWKELYPQVARSPLVIRVIDLRNPADVILRSELGEVHL
FT                   GAFGPQFSTQLRRLDQMREALKRYPPGEVTFIDLRSSQSPVLRLRNPIP"
FT   CDS_pept        complement(308371..309408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0300"
FT                   /note="ORF_ID:gll0300"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88241"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88241"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNV8"
FT                   /protein_id="BAC88241.1"
FT                   /translation="MIQLGRFTGAWDGDAFLFRIVWAQQRRYICGPDPMNQSFLQSETF
FT                   KKIQSQLTSPTLSKLQRQFSGPQYKGVGRVVLVFAGLTLLTLWVIQPPASTTASTPQAE
FT                   PARTPPTSVRPSASLRRSRPEIADSSEEASTPAPTRARTIGSESAERPEPSAPPAPAPI
FT                   PQSAPAAPVAAAPPALVPPQAPPTQAPPPAPPQLVSIATGGESRFAVLRYDNRTQTVAA
FT                   SDRIGPWQVSQIRPEQVILKQGSKQLILSFSRTGNLPPPPPANASGSESGSSGRRPLTP
FT                   GAFPPGANTPTPSPPEEEVQQQVIPPQPAPEPGNPEQPQQQPGQQPGQQPQEQETDAVR
FT                   PDSNR"
FT   CDS_pept        309386..309877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0301"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /note="ORF_ID:glr0301"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88242"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88242"
FT                   /db_xref="GOA:Q7NNV7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNV7"
FT                   /protein_id="BAC88242.1"
FT                   /translation="MNLPNWITFSRLLAVPALLVILAPVPGPGQRIAAAVIFALAAATD
FT                   WLDGYLARRLGQVTELGKFLDPLVDKLLVLAPMLMLVELGQLPGWGVFLILARELAVAG
FT                   WRVGQSKISGANNWGKAKTVVQILAVIFLIMLWPGGEVLFWAAVALTLISGGIYLWPRR
FT                   "
FT   CDS_pept        complement(309882..312275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0302"
FT                   /note="ORF_ID:gll0302"
FT                   /note="probable ferric aerobactin receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88243"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88243"
FT                   /db_xref="GOA:Q7NNV6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNV6"
FT                   /protein_id="BAC88243.1"
FT                   /translation="MDKSGGPLCGGRFALLNLALFAACGSQLTAMPADTGNGTDAAVAH
FT                   KSDLAGVHTEVRWLAQQAPSAPVSAEPSGSSEAPNAASTVGQSPANNGEVGDLLDETVV
FT                   TATRTRERVQDVPRTVTVVSRRQVEQQSLLTTNLGDILGFTVPGYSAPSDGPARGTYRG
FT                   RDVQTLIDGIPQTGNYAYSNQLRFIVPVSIEQIEAVGGPSALYGDGATGGTINILTRRG
FT                   TETPQAKTRIGFNLGLSNLSGGPGYLFEQFASGKAGAFDYAITASYTGLGSVYDARGAQ
FT                   IPNEWFGTLGNTNTYNLYGKFGLDLGADQRLQFTAGYANDLTDPNSISDPAVTTSGGLQ
FT                   FAGAKNGRIQIQNSPYSPQPTKRNLQLALEYNHNKFLGGSKLLAQASHRNSFELTTVND
FT                   SRFTADGSGGPFDSINRGVWGEYITTARVQVETPFSDNFKLLWGSDFKNDPVEAWQLET
FT                   FDPKIYDESGGFIQRRSGNFLFNPAYTLTNIAGFLQANWNISDQWIINGGLRYENVSFS
FT                   VGDFVASNTGQSVTGGSLNFNSTVFNLGVVYKPSNEISLFANFGQGFSLPVFANPLTNA
FT                   SSGFAVSNSLTALQPKLVDSYELGVRGRWRSIQSSLSAYYTFSSLDVGFVQVSPTQFQS
FT                   VRSPQRTYGLEATLYAQPGPGWTLGTTAAWVQGEQDPFNTGDYYPLNSYSVNPLKATFY
FT                   LENQTAPGWRNRLQVLFSGYRDVAYNAILPTGFRVEQAPVGSYATVDYLSSIQMGAGTL
FT                   EVGVRNLLNNQYSPVYSQYLSGFNDRNNFAARGATLNVAYNFGW"
FT   CDS_pept        312678..313169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0303"
FT                   /note="ORF_ID:glr0303"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88244"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88244"
FT                   /db_xref="GOA:Q7NNV5"
FT                   /db_xref="InterPro:IPR005297"
FT                   /db_xref="InterPro:IPR014558"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNV5"
FT                   /protein_id="BAC88244.1"
FT                   /translation="MSVLIALGRIELDPDRARTLFKRICRRTDMLKVRRMLCGLLIASV
FT                   WAGGASAQMAEPAQPASVKTIQAAGGAVLTDSEGKTLYVFDRDGAGKSNCNDKCAQNWP
FT                   PLSAQADAKSVGKYTVVTRDDGSRQWAYDGKPLYRWVKDQKPGDATGDGIGGVWHTARP
FT                   "
FT   CDS_pept        complement(313212..313934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0304"
FT                   /note="ORF_ID:gll0304"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88245"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88245"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNV4"
FT                   /protein_id="BAC88245.1"
FT                   /translation="MYQPNQPADVIWPPTDLWSDEPPMESDWHRKQMQVLIDSLESHWH
FT                   DRQDFYCSGNLTIYYSLTQRKSEDFRGPDFFVVLGCERRERRSWTVWQEGGRLPNVIAE
FT                   ILSDSTADIDRGLKKQIYQDVLRVPEYFWFDPQRFELCGFHLLEGRYVPLEATEAGWLW
FT                   SGQLGLFFGALQGCLRLLTAAGAVIPTPAERAEAAQQRAEQAEQRAQVEKQRAGQERQR
FT                   AERLAQRLREQGLDPDAP"
FT   CDS_pept        complement(314032..315057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0305"
FT                   /note="ORF_ID:gll0305"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88246"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88246"
FT                   /db_xref="GOA:Q7NNV3"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNV3"
FT                   /protein_id="BAC88246.1"
FT                   /translation="MQLTVAPENIFESFALTNGQISRSLALSILGVGVSKAVLAADRTG
FT                   VFKQLTDAPRTAVELARATNCSLHGMQVLLESLEGFGFVHRKSERYRLTKEVAGWIDSD
FT                   GGLAKSLMQLVGDNLQLLQPEDVAEGTPPISRGEPRSPACWADYLAMIKNGGHQSSPQL
FT                   VQWAKLDPAPRHLLDVAGGTADNSLAFCGRYPGLRADILELPEAARQGRRKIAAAGLDG
FT                   HIRYIEGNLFETDWGKGYDLVVLSNVLHVLSARQCEAILAKAFRTLQPGGRVIIHDLFH
FT                   PGSRGRISPGIGLFSLIYFVTCGGRTWPKPVLLEWLAGAGFGNIRAARRRLALLICAQR
FT                   L"
FT   CDS_pept        complement(315094..315360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0306"
FT                   /note="ORF_ID:gsl0306"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88247"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88247"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNV2"
FT                   /protein_id="BAC88247.1"
FT                   /translation="MNETQVIGGYVWSYLSDFDVVPQVFPFVRCGDCWCVHFARHPGQT
FT                   AFWLERGWAKAFEIPYSRRPGCLRVDLDLPESGFWKALRLPPV"
FT   CDS_pept        complement(315439..315951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isiB"
FT                   /product="flavodoxin"
FT                   /note="ORF_ID:gll0307"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88248"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88248"
FT                   /db_xref="GOA:Q7NNV1"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNV1"
FT                   /protein_id="BAC88248.1"
FT                   /translation="MPEKIRLFYGTTTGKTLDAASMIKDAFGGDTVTLYDISETDKEDL
FT                   TGAALLIIGCPTWDIGQLQSDWDAFFPVLGDIDFTGKKIAYFGTGDQVGYSENFQDAMG
FT                   ILEAKISERGGTTLGRWPADGYDFNASLAVKNGKFVGLALDDDNQSRLTDKRIKDWVAQ
FT                   LKKEFGV"
FT   CDS_pept        complement(315987..316658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0308"
FT                   /product="Crp family transcriptional regulatory protein"
FT                   /note="ORF_ID:gll0308"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88249"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88249"
FT                   /db_xref="GOA:Q7MBD1"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MBD1"
FT                   /protein_id="BAC88249.1"
FT                   /translation="MFQAKLLLRSADHRPPARRMNAPPGRAACRQCPGGTPQHHAAGRT
FT                   FALSGDAFWVVQSGALWIMKLDYCGRQTPLALLGPQMVFSRRLVSPSGYYFAQAETDVE
FT                   SLVLDWPQIQRSDALTAQVNGKLVDLLLHMEAWLALRCRGSTVERLRDFLLLLAEQFGR
FT                   PGPRGVRLNLHLTHAQIGMAIGKERVTVSGAMGRLRADGWIREEADGHLLLTWDLAAAR
FT                   Y"
FT   CDS_pept        316963..317526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0309"
FT                   /note="ORF_ID:glr0309"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88250"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88250"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNV0"
FT                   /protein_id="BAC88250.1"
FT                   /translation="MHAAGERVRWTAADLELLPDNGNRYEIIDGELFVSRAPHWRHQNI
FT                   CGRIFAALTAWSDSSGQGQAAVLPGILFSDADNVIPDVVWAGNESLDALLDAAGHLTGA
FT                   PELVVEVLSPGEQNERRDRELKLKLYSVQGVQEYWIVDGQQRRVSVYRRLEGVLKLAVT
FT                   LLAADALSSPLLPGFRCPVASLFA"
FT   CDS_pept        317622..318503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0310"
FT                   /note="ORF_ID:glr0310"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88251"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88251"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNU9"
FT                   /protein_id="BAC88251.1"
FT                   /translation="MMVSIGSQVNAMVVSTEPVVYPDSDGLPMSENTEQFRWIVYIKEG
FT                   LEWLFVDAPDVFVAGDLLWYPLEGDNKTRQAPDALVAFGRPKGKRGSYRQWQEAGVPPQ
FT                   VVFEVLSPGNSVREMMRKFAFYQRFGVEEYYIYDPEAGTLDGYRRQGEVLEDIESPAGW
FT                   VSPRLRVRFDLDAEGQLQMWRPDGAPFESYVEIAARAEQERQRAEQERQRAEQAEQRAE
FT                   QERQRAEQAERRRALSLVLRLLTRQVGTLEPGVSERVGGLPDEGLDALAEALLDFGSAA
FT                   DLQSWLDGRAAG"
FT   CDS_pept        complement(318519..320795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0311"
FT                   /product="ferrichrome-iron receptor"
FT                   /note="ORF_ID:gll0311"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88252"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88252"
FT                   /db_xref="GOA:Q7NNU8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNU8"
FT                   /protein_id="BAC88252.1"
FT                   /translation="MDLLDPVPRHLQCRRSRQKSFARGGSLSMIDRNTLLLLAGGLLLL
FT                   CAAPTPAQQVAAVPLEVPRLDQIPTASTSAAHLAQQPAEPSQAQAPAQPDAEELDEVTV
FT                   TGTGTYRRSRSSTATKTDTPILDTPQSIQVIPRQVIEDQGTVRLRDALRNVSGVYLQST
FT                   DGNIGEYFNIRGFSARSYTNAFLSSGTDSLLSLDTANIERVEVLKGPSSVLFGRAEPSG
FT                   VVNYVTKRPLPAPYAAVAFTAGSYNFYRTTADLSGPLTSDGALAYRLNVAYEDANSFRG
FT                   VQGRRVFFAPVLEWKIGPDTKLNFEIEHNRDNRVFDPGLFAVGTGVAPVPYSRLYADPR
FT                   GLIFGYATRATAVLEHRFAENLTMRTGGRYANYLESFPLQFTPGELLADNRTLVLAYLE
FT                   GNQFYENVAFQNDLVWRAQTGSVDHTVLFGLELSKFATGFAGTFGSANSIDIFQPPPYT
FT                   YEFPPASERFPFMGNTTTSGFGVYLQDQISFSDNLKLVLGGRYDTVSAPFTDLLAGTVN
FT                   PSEGQAFSPRVGLLYKPAANVSLFANFNQSFAPSFGRSATGTPFLPTRGTGYELGAKAE
FT                   LLGGRLFANLALYKIAKANVVTRDPANPGFSIQVGEQESQGIELDLTGEILPGWNLIAS
FT                   YAYTDAKISRDNTFPVGNRLPTAPLHGGSLWSAYRVSEGALAGWGVGAGVFAVGERFGD
FT                   LDNSFSVPGYTRVDAALYYRRGWLNAAINFKNLLGTQYIEAATFRYAVHPGAPFTVQGT
FT                   FEVRF"
FT   CDS_pept        complement(320875..321987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0312"
FT                   /note="ORF_ID:gll0312"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88253"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88253"
FT                   /db_xref="GOA:Q7NNU7"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNU7"
FT                   /protein_id="BAC88253.1"
FT                   /translation="MNFKVRPVVFALHQWTGVVLGLLLVVICVSGSVLVFSEEINRTLH
FT                   PQWTRSRLQGEPISPAAAIGKLRTAYADSRLLSLRVPPEPDGTYMGVLLSGERLQVSFV
FT                   DPRGGALIGGRIDVLSVPVGFLLLLHTSLLAGAAGGIVVGIAGVLLTVLGLSGLVLWPG
FT                   WRRWQSGLRVRWRSPSRLLHYDLHKVSGVFSAALLVLIALTGSALVFHDPVEGWVYQAF
FT                   GQKPPEHPVSTVRPGIRPLDIERVLDRARAVVPQATVTNIALPTRSNGVVYVTLRWPPS
FT                   AGAGLGTVALDQYSASVLRVDNPRRFTPPEQVMQWLYPLHVGNFAGLPLRVLYALVGLA
FT                   PALLFWTGLVLWLDRLKKRLNRRAAPAPGG"
FT   CDS_pept        complement(321991..324255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0313"
FT                   /product="ferrichrome-iron receptor"
FT                   /note="ORF_ID:gll0313"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88254"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88254"
FT                   /db_xref="GOA:Q7NNU6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNU6"
FT                   /protein_id="BAC88254.1"
FT                   /translation="MEPHMRSFSGYFFLGSVALAALPSLVAVAPAFALPVAGSEVVLVR
FT                   KADLEHSALGARGLLGGGLAQAPPAATPAAPSQDLPGSDPSELDEVTVVGRYLRKDATT
FT                   ATKTDTPLIDIPQSIQVVPRQLLEDQKIIQFNDALKTVSGVFNANPTFASFSTFNVRGF
FT                   NTNNIYRNGFRDGVNSLAGFDVASIERIEVLKGPGSVLYGQGELSGIINVETKRPQPKA
FT                   AYAATFDAGNYGLFRSSLDFTGPLTADKALSYRLNAVYQNSKSFLDFFQAERWLVAPAF
FT                   TWRIGSNTTLDIDGEFYNARQPSTFGLPAVGTVLPNPNGKISTGRFVGEPLLDNYGSSA
FT                   YRFSYRLEHRFSPNWSLRHGFSSSHQRLLFTQTVPVELFPDGRTLLRVITGTTVPDGYT
FT                   FWRDSNIVDTYLIGNFRTGPVEHKLVFGFDASWFYNATRQFNGALIAPLDLFNPVYSPT
FT                   RGPTILEANSFNSPSSYGIYIQDQLSFSENLKLLLGLRYDNATQRTADLLTATRTSEDF
FT                   DAFSPRVGLVWRPILPLALYGSFSRSFLPTLGTNQAGLPFVPERGEQFEAGLKADLLEG
FT                   KLFTTLAYFDLTRQNVLTPDPSNPFFSLQTGEQNSRGVEFDLTGEPVPGWNLTAAYAYI
FT                   DARITRDTQFAVGNRLGAVPHHSASLWSTYQLQEGSLKGLGFGLGLFYVGERTGDLANT
FT                   FTLPGYLRTDAGVYYRADNVRYAFNFRNLFNVEYYESAGSALDVIVGTPFTVIGSVSVE
FT                   F"
FT   CDS_pept        324692..325204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="isiB"
FT                   /product="flavodoxin"
FT                   /note="ORF_ID:glr0314"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88255"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88255"
FT                   /db_xref="GOA:Q7NNU5"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNU5"
FT                   /protein_id="BAC88255.1"
FT                   /translation="MPAKIGLFFGTTTGKTGDAAEVIQQELGKTQVDLRDIGRASKADL
FT                   TAYEYLIIGCPTWNIGDLQDDWDSFYPDLDQINFAGKKVAYFGTGDQRGYGDNFQDAMG
FT                   ILEEKISQRGGTTVGYWPADNYDFNASKAYKNGKFVGLALDDDNQPEQTERRIKQWVAQ
FT                   LKREFGI"
FT   CDS_pept        325296..325646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0315"
FT                   /note="ORF_ID:glr0315"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88256"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88256"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNU4"
FT                   /protein_id="BAC88256.1"
FT                   /translation="MPETQLLSGYLWGYLCVSDVIPQVLPCVRCADRWVVHFARHPGEE
FT                   ALWRQRGWARAQPIPYRRQPEGLSVERDLPEAGFGRAEPVAATQSAACVRCGDCLDCPC
FT                   GAGCATPPLKGG"
FT   CDS_pept        325650..326435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0316"
FT                   /note="ORF_ID:glr0316"
FT                   /note="tetracenomycin C synthesis protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88257"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88257"
FT                   /db_xref="GOA:Q7NNU3"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR016874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNU3"
FT                   /protein_id="BAC88257.1"
FT                   /translation="MRALPGVSEGLLFSLCARYLETQRQDGIVFDQKAIEIVHRLNLDC
FT                   TALARRNSVWPTQVAVAIRTEILDRAVQRFLQVHPEAVVVNLGAGLCTRYFRVDNGRVR
FT                   WYELDLPALKRPWSHLFGESDRHRHLGCSVMDFAWMDILQPLRRSPFLFIAEGLLMYLT
FT                   ECEARQLVACLGAAFPCAELLAEAVSPVVVERHDRTEAASFRWGIDRGSHLEGWSGGVE
FT                   FLQEWYYLDYHPHRWGWLRLLRRLPAVRRSMKIIHIRYR"
FT   CDS_pept        326615..327463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0317"
FT                   /note="ORF_ID:glr0317"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88258"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88258"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNU2"
FT                   /protein_id="BAC88258.1"
FT                   /translation="MVVSTEPVVYPDCDGLPMSDNTEQFRWIVYIKEGLEWLFAGEPDV
FT                   FVAGDLLWYPIEGDNKTRQAPDALVAFGRPKGKRGSYRQWLEAGIAPQVVFEVLSPGNS
FT                   VREMTRKFAFYQRFGVEEYYLYDPEAGALDGYVRRGGVLEGIESMSGWVSPRLGVRFDV
FT                   DAGGQLQMWRPDGTPFESYGEIAARAEQERQRAEQERQRAEQAEQRADEERQRAEQAER
FT                   RRALSLVLRLLTRRVGTLEPGVSERVGGLPDEGLNALAEALLDFGCAADLQSWLDGRPT
FT                   G"
FT   CDS_pept        327661..328575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0318"
FT                   /note="ORF_ID:glr0318"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88259"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNU1"
FT                   /protein_id="BAC88259.1"
FT                   /translation="MAEQERRPFDTSLQGLAALYSRHFLAWLKGPEVTWEQELNSVIVA
FT                   QQRRADFLIRYRDEQAEARLLHVEFQTLVQKGEPREELPVRMATYALFVLNRYGLLPNQ
FT                   VLVLLKDSAATRQVPERFEQGRVRVEYDLVRLWEQDPEPVLASGLVGLMPLVPLMRGQE
FT                   LGALLEACTGVIEAEIESSQQRTEVLTVTGLLASLRDTQVVTEFFRRRSQMSLLTETPL
FT                   FQELTRELVQQAVQQAVHETEQRTRLQFLLHQLEHKFGPLPEDMLTALQAIADTDALDT
FT                   LGLALLDAPDIEAFRRQLPPSVS"
FT   CDS_pept        complement(328649..330973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0319"
FT                   /product="ferrichrome-iron receptor"
FT                   /note="ORF_ID:gll0319"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88260"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88260"
FT                   /db_xref="GOA:Q7NNU0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNU0"
FT                   /protein_id="BAC88260.1"
FT                   /translation="MGVGLRNARMAAGGWSVAAAALARAAEPVIAIRRARLATSVRRVK
FT                   ACLPNRNASLLVAGGLSLLCAGPAAAQPLATEVSRLGELPSVSTSAAHLAQQPAEPSQA
FT                   QAPAPPDGEELDEVTVTGTGTYRRSNASTATKTDTPILDTPQSVQVIPRQIIEDQGSVR
FT                   MREVLRNVSGVYLNNNYSNYSESFNIRGFTASQFTNAFATSKFDSFNAVDTTNIERIEV
FT                   LKGPSSVLFGQAEPAGVINYVTKRPLLTPYTAIGFTAGSYDFYRTTLDLSGPLTAGGTL
FT                   AYRLNVAYEDANTFRGTQGRRTFFSPVLEWRVTPDTTLSFEVIHSRDNRPFELGLPAVG
FT                   TGVAPVPYNRLFADPKGLLLTNSTRAIAVLEHRFAENLTMRSAGRYASYIENYPRLIYS
FT                   AGLLEDNRSLQLADDRGEYYFESFGFQNDLIWKAKTGSIDHTVLFGLELGKSLQSGYGI
FT                   FGLANVIDIYQPPPYVLEPAAESSRSPYGFRNAISFFGVYLQDQISFSDNLKLVLGGRY
FT                   DTASAPSTDPITGAINPSEGQAFSPRVGLLYKPAPDVSLFANFNQSFTPTSGRSAAGTP
FT                   FLPTRGTGYELGAKADLLAGRLFANLALFKIAKTNVVTFDPTNPRFSIQVGEQESQGVE
FT                   FDLTGEILPGWNVVATYAYTDAKISRDNTYPVGNRLPTAPLHGGSLWSAYRVSEGALAG
FT                   WGIGAGVFSVGERFGDLANSFSVPGYTRFDVALYYRRGGLNAALNFKNLFNAQYIESAV
FT                   SRGGITPGAPFTVQGTLEVRF"
FT   CDS_pept        complement(331223..332194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0320"
FT                   /product="AraC family transcriptional regulatory protein"
FT                   /note="ORF_ID:gll0320"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88261"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88261"
FT                   /db_xref="GOA:Q7NNT9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNT9"
FT                   /protein_id="BAC88261.1"
FT                   /translation="MTISMSEQVLADLGQELNAHTQYPDPQDELDLLWRLPSWLAEGCF
FT                   REIALREGLALCIENFRLRDRWELALPEREECLCFHFHLSGEHRDGSTEVGNLEYALYG
FT                   SGLAPKQTMAGPDHFPILEVHIWMQPEVLVAFVGHNGELPTEFAHLVRPADQKYYTRVG
FT                   TVSPALQQILRQIVRCPYSGLAKRLYLEAKALEAAALVLEHEQEVRQGRCLQHALQSDC
FT                   VERICRAREIVLQNLDRPLALAELARRVGLNECALKRGFRQVFGTTVFGYLRDYRLEQA
FT                   RQLLLSGEANVSGVMQAVGFADRGHFAAAFRKKFGVAPKDYR"
FT   CDS_pept        complement(332307..334064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0321"
FT                   /product="HlyB/MsbA family ABC transporter"
FT                   /note="ORF_ID:gll0321"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88262"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88262"
FT                   /db_xref="GOA:Q7NNT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNT8"
FT                   /protein_id="BAC88262.1"
FT                   /translation="MLVDFGFDLAGRTDARLWRGLTLSILQALLGVVPYLVLYFALEAV
FT                   FAGRATDALAWGAAAILGVCLLLLWVVRAHAMLDNFAATYALVCDMRLRLADHLGRLPM
FT                   GFFTRRRTGALADVLTGDFAIYTEVVTHTWGLVIANLALPVCIAGVLFLADWRLALLAV
FT                   ATIPFALLAVIWSQWLLVRAGEKLMDAKADTVGRLVEYIQGIAVLRAFGRTGAKHAALA
FT                   ASLARLEKQSLYTELAPAPALLMYGFTVELGFTIAAVVGAWLMTGGALSPAVYLLFLVL
FT                   SLRFYKSLAELGIYLAELRFASATIARIRGYFGESAQPEPAAASLPTGCDVVFDNVSFA
FT                   YEEQTVLKRVWAVMRPGTLTALVGPSGSGKSTVAHLLTRLWDVDSGAIRIGGVDVRAMA
FT                   MAALQAHIGIVFQDVYLFRDSVLNNIRLGCPDADAEQVLAAAKAARAHDFIVQLPQGYE
FT                   TILGEGGYDLSGGQRQRLSIARALLKDAPILILDEATASVDLDNERLIQQAIAALTRGR
FT                   TVIVIAHRLWTIQHADQILYFEHGRIVERGTHAELLAVENGRYRRQWQAQQQAGGWRIG
FT                   GATGVRSVG"
FT   CDS_pept        complement(334054..335901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0322"
FT                   /product="HlyB/MsbA family ABC transporter"
FT                   /note="ORF_ID:gll0322"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88263"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88263"
FT                   /db_xref="GOA:Q7NNT7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNT7"
FT                   /protein_id="BAC88263.1"
FT                   /translation="MTQIASQGSQSLKPAAESLPSAAEGTMVGNGLGLIFRLARRQWPA
FT                   LAAAAAFAVLAVAFELVPYLAVYRIAVEVFSEAPRPEAMVRLAWLAFGAVVLQFVCIAV
FT                   SNTVAHAAAFRLLRQVRTELTEKMARLPLGFFDRRESGDLKKALVEDVGSLEGVLAHNI
FT                   PDIVSGILVPLAAGVALFWVDWRMALASLALLPVGIAAQMWAFRDMDAQYRLWHRTEAA
FT                   ANAGVLEYLRGIAVLKAFNRTAGSLERLRSAVYGVRDVATAMTRRSMYPYALFFIALGS
FT                   NLLVVLPVGIALHLHGGLGLPQLCLFLVLGAGLTAPLIKLMFVFGSTSRTIMGAGRIQA
FT                   ILDAPPLPEADGPVQPADYGVRFVDVHFSYDGAKSALQQVSFTAQPGRVTALVGPSGAG
FT                   KSTVARLIARFWDVDAGRVEVGGVDVRALGLEALMGHIGFVFQEVFLLHDSVRENIRLG
FT                   CAGASDAEVEAAAQAANAHTFIQALPDGYDTQLGDRGARLSGGEKQRLAIARAILKNAP
FT                   ILLLDEATAFADPENELAIQQALAELIQGKTVIVIAHRLASVADADHIVVFNGGTVEDQ
FT                   GTHGELLGRSGTYRRLWAAQQQAVGWTMTTATGEEAHAG"
FT   CDS_pept        complement(335898..336332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0323"
FT                   /note="ORF_ID:gll0323"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88264"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88264"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNT6"
FT                   /protein_id="BAC88264.1"
FT                   /translation="MLTVDEQKHPIYYLLFDGTPTAQDTEAHLASWERWLSEGESFGVI
FT                   QRQVGVEAGEGKPPKEGHKLEVDFFRRNRPRIAGLCFGVAVVLDSEAMLDKWQPLAAKA
FT                   IENMVGCTGRAFGTVAEAVQWLEERQIAAPPIEAAPGEHR"
FT   CDS_pept        complement(336517..337542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0324"
FT                   /product="AraC family transcriptional regulatory protein"
FT                   /note="ORF_ID:gll0324"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88265"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88265"
FT                   /db_xref="GOA:Q7NNT5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNT5"
FT                   /protein_id="BAC88265.1"
FT                   /translation="MAPWGWAVKITISAGNFAQFVTAFQELTGCTGRCNGAELTLHWPQ
FT                   QAGEGYYRWLRLRGGIELFICDYQLHQSVTVDLEILEFPSLSVGFIVSGHFRGTLPGAA
FT                   EKLEGRPGQSGLFLLPAHREISELPAAERLRFVGMSFEPSLIESVFEGQSLPVAPALRP
FT                   WMAGREAPPFFRLGAITPAMATALDQVLHCPFEGATRQLFLEGKALELVALQLEQTLTD
FT                   GPSPAARHRLHGDDIDRIHQARDILIANLEHPPTLIALAHQVGLNDYKLKLGFRQVFGT
FT                   TAFGYLHAHRLEQARVMLAARQINVSTAARAVGYTNLSAFSLAFKRRFGVLPSTWQSRR
FT                   S"
FT   CDS_pept        337790..338506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0325"
FT                   /product="Crp family transcriptional regulatory protein"
FT                   /note="ORF_ID:glr0325"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88266"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88266"
FT                   /db_xref="GOA:Q7MBD0"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MBD0"
FT                   /protein_id="BAC88266.1"
FT                   /translation="MSKHAIPLQDVESPGAVFDTGDLHEVGWAAGQAAGDCYKAGQSIP
FT                   LAWDSLWLVQQGLVWVRTVQWSGNETLVALVGPRMPIGAMLVPEKAACAVHALTDVQLT
FT                   RVAWREVHQQPQLAWQLNQGLVRLLLQLEALNAIKGLRRVIDRLQEMLVLLVRQCGQES
FT                   VEGVRLQGRLTHEQLAVAIGCQRVAVTKCFTELKRAGLVTVGADRRLCVSRELVHRTAL
FT                   FAVAADTHAQRAMGPA"
FT   CDS_pept        338503..339495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0326"
FT                   /product="AraC family transcriptional regulatory protein"
FT                   /note="ORF_ID:glr0326"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88267"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88267"
FT                   /db_xref="GOA:Q7NNT4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNT4"
FT                   /protein_id="BAC88267.1"
FT                   /translation="MKLHFSVRDIDELFEQLQRQTGAAVRLEDGETVLQLPPPIGEGTI
FT                   RRIALRPGLLLTLDNYAYPEAVSCELSAHGTPSLALSFCTAGHAQGRLAGVRTPFDGCP
FT                   GQVNLGFVRGLPGVLTYQPRQPLAFVELFIEPEAIFQLSGAQFEQLPAPLRRLIELPDR
FT                   EGYFAQSRQTTIAMQSAIHQILHCPYRGLTRRLYLESKAIELVALAFEPPAPCGPSPKL
FT                   RPEHIERIRLAKEILLLRLDEPPSLMDLARQVGLNDCTLKRGFRQVFATTVFGCLHQQR
FT                   MERARELLVLGRLNVTEVALSVGYASLSAFNAAFKRRFGVNPGAYRKLP"
FT   CDS_pept        339653..342181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0327"
FT                   /note="ORF_ID:glr0327"
FT                   /note="similar to TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88268"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88268"
FT                   /db_xref="GOA:Q7NNT3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNT3"
FT                   /protein_id="BAC88268.1"
FT                   /translation="MQRLCLVNRYAVGWAGAALLWLARAAGAEPTPVARLDELAHPLTR
FT                   ADALLAQSAIDFPPAAADAAVQITGVQLTPTDGGIEILLETNGKRPLRGQKAGEGNRLS
FT                   VDVPNAQLRLPDGRIERRADPAPGVTAVTVAPFGAVGVRIIVETEGPLPLSELRQTERG
FT                   LLLSLLGGLEEEVVVTAQKTPQKPQDVPISLTVLPRQLIEDADITSLRGIAQNTPNFTI
FT                   FDPGGTRSFFFYSIRGLSNFNFASQDGAAFYIDDVPYDYGSFITQELTDLERVEVLRGP
FT                   QNTLYGRSSQAGVVNIVTRKPANRYAFTGLAGYGSNNNLDLRASVNVPAVADQLFLRLS
FT                   GNYGRRDGFFTNTFLGTNLGGVAGGTGRGQLLWTPSPNWEVSFHANVDDYRDRGYAGLI
FT                   RINPDPFRLEQNFDGFNQLNANTQALRVFYRDENLRVSSITARRFSRQESATDADFSIL
FT                   DGATFTNVFSSTVWSQEIRLQSPESAKDFQWLFGAYYESREFQTAKDGFNFNSQAPLVF
FT                   GEAGIAGASLLRSADTGAQTYAVFGQASYKPGAAWTLTAGLRYETNRSLLRAAEQVFAI
FT                   PGFPATALTAFSNVEKNGDALLPRFTAEYRFAANAMIYGSIARGYKPPGVNIRPETADN
FT                   TAFEAEFSWNYEIGLKSAWFDDRLGVNLALFHNPVSNYQVNPLDAFGIPRGVTNADVAI
FT                   TGGELEVRAKLSQGLDLVAGFGLADAWFADYTDRATGQSFNGKRLPFAPALTYNVAVQY
FT                   RGWGGVFARAELVGRGSTYFDEGNRFRQDPYALVNARLGYEFGDYGIYLYGNNLFDTRY
FT                   VTLAADGPSGSILGTVGSPATFGAQFKFKL"
FT   CDS_pept        342183..342866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0328"
FT                   /note="ORF_ID:glr0328"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88269"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88269"
FT                   /db_xref="GOA:Q7NNT2"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNT2"
FT                   /protein_id="BAC88269.1"
FT                   /translation="MPVGVLGNPKAEAVLDRLHAEADRQLAALWLHYLPKLPGLLLGGG
FT                   IAWDRANTDFYRDKYIPIDRDQGEWLYLLARSTHARTIVEFGTSFGISTIYLAAAVQDN
FT                   GGGRVIGTEIVPEKVVQARKHIAQAGLGSSVEIREGDALVTLQNLNPAIDMVLMDGWVH
FT                   LALDVLKLLDPLIRKGGIVVADNVGTFKAALRPYVEFLRDPVNGYRSTTLNLKGGTEFS
FT                   VKIRP"
FT   CDS_pept        342983..343300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0329"
FT                   /note="ORF_ID:glr0329"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88270"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88270"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNT1"
FT                   /protein_id="BAC88270.1"
FT                   /translation="MEDRIERRLDQHGELIAELRAATLANSQRIGELQEATAANSRNLD
FT                   RLAGITERFVGVVTDAIVRFDQAVEELRASNRRQEALNDFLIRRLGGEGNGGNPPAAPA
FT                   N"
FT   CDS_pept        343427..344263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0330"
FT                   /note="ORF_ID:glr0330"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88271"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88271"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNT0"
FT                   /protein_id="BAC88271.1"
FT                   /translation="MVSTGSQVYAMILSTEPLVYPDCDGLPMSDNTEQFRWIVYIKEGL
FT                   EWLFADAPDVFVAGDLLWYPLEGDNKTRQAPDALVAFGRPKGRRGSYRQWLEAGIAPQV
FT                   VFEVLSPGNSVREMTRKFAFYQRFGVEEYYLYDPEAGALDGYVRRGGVLEGIESMSGWV
FT                   SPRLGVRFDVDAGGQLQMWRPDGTPFESYGEIAARAEQERQRAEQAEQRAEQAEWRKAL
FT                   SLVLRLLARQVGPLEPGVNERIGGLSDEGLDALAEALLDFGSAAELHNWLDGRVPG"
FT   CDS_pept        complement(344279..346114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0331"
FT                   /note="ORF_ID:gll0331"
FT                   /note="similar to ferrichrome-iron receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88272"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88272"
FT                   /db_xref="GOA:Q7NNS9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNS9"
FT                   /protein_id="BAC88272.1"
FT                   /translation="MRVRDALRNVSGVYLSDTGGNFGEQFNIRGFRSNNYTNAFLSSIV
FT                   DSFVFVDSANIERIDVLKGPSSVLFGRAEPSGIINYVTKRPLPTPYAAVGFTAGSYDFY
FT                   RTTVDLSGPLTSDGNLAYRLNVAYEDANSFRGTQGRRVFFAPVLEWKVGPETKLTFEVE
FT                   HTRDNRPFDQGLFAVGNGVAPVPYNRLFADPKGLISGNVTRVTALLEHRFAENLTMRSG
FT                   GRYTSYLESYPSLFSAGELLPDNRSLLLANQRGYGYTESVTFQNDLIWKPRTGSIDHTV
FT                   LFGLELGKFAQSFDAFFGFANVIDIYQPPPYVFESPPGSSVFVGIITTSSFGVYLQDQI
FT                   SFSDNLKLVLGGRYDTVSAPFTDLQTGDVSPSEGQAFSPRVGLLYKPASNVSLFANFNQ
FT                   SFAPSSGLSTTGTPFLPTRGTGFELGAKADLLANRLFANLALFKIAKTNVVTADPANPR
FT                   FSIQVGEQESQGVELDVSGELLPGWNVVASYAYTDARISRDNTFPVGNRLPTTPLHGGS
FT                   FWTAYRIGEGALEGWGAGAGVFMVGERLGDLDNSYSVPGYTRVDAALYYRRGSLNAAIN
FT                   FKNLLNAQYIEAANFRTAIYPGAPFTVQGTLEVRF"
FT   CDS_pept        complement(346125..346490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0332"
FT                   /note="ORF_ID:gll0332"
FT                   /note="similar to ferrichrome-iron receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88273"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88273"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNS8"
FT                   /protein_id="BAC88273.1"
FT                   /translation="MKICMLNRKTCLLVASSFLLLGARPIPAQQVAAMSPEATVHRLGE
FT                   LPSVSTSAAHLAQQPATPPQTQAQAAPQPDTEDLDEVTVFGTGTYRRSNSSTATKTDTP
FT                   ILDTPQSIQVIPRQLYR"
FT   mobile_element  346509..347831
FT                   /mobile_element_type="insertion sequence:ISGL5a"
FT   CDS_pept        346581..347798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0333"
FT                   /note="ORF_ID:glr0333"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88274"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88274"
FT                   /db_xref="GOA:Q7NNS7"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNS7"
FT                   /protein_id="BAC88274.1"
FT                   /translation="MTIRKEILDELLKDYDGTDPQTILGEGGLLKQLTKAVIERALEAE
FT                   LETHLGYKKHEAAGKGTGNSRNGKSQKTLQAECGAVELAVPRDRNAEFEPVVVRKGQTR
FT                   LAGLDEKILALYARGMTTRDIQAQLLEMYGVDVSSTLISNVTDAVMDEVRQWQNRPLEA
FT                   VYPIAYFDCLHVKVRDNGRVVNKAVYLALGVDIEGQKELLGIWLSAHEGAKFWLGILTE
FT                   LSNRGLKDILIACVDGLTGLPEAIESVYPGCLVQLCMVHMVRNSCKYVSWKDRKALCAD
FT                   LRSIYSAATEDEAELHLELLREKWDKPYPSVGRMWRENWSRVIPIFRFGEDIRKVIYTT
FT                   NAIESLNMTIRKVSRNHRIMPNDESVMKMVYLAIQNQMKKWTMPIRAWRPALNRLMIEF
FT                   EGRLKV"
FT   CDS_pept        complement(348049..348213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0334"
FT                   /note="ORF_ID:gsl0334"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88275"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88275"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNS6"
FT                   /protein_id="BAC88275.1"
FT                   /translation="MLGRVAGLPVTNGFQSTCFALKKIRPALKKIRSTIALCFTKASAF
FT                   RYFAKNDSQ"
FT   CDS_pept        complement(348289..349272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0335"
FT                   /product="AraC family transcriptional regulatory protein"
FT                   /note="ORF_ID:gll0335"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88276"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88276"
FT                   /db_xref="GOA:Q7NNS5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNS5"
FT                   /protein_id="BAC88276.1"
FT                   /translation="MTISMSEQASADLDEELLAQSQCPDPQDELDLSLHYPPWLANGFY
FT                   RNIELREGLELTLLDCRLCDRWEFAYAEQESWLSCHFHLSGEHQDACTEVGNLEYALYG
FT                   SGLAPKGTTICPDRYHILEVYISMQSEVLMSFVGRNGELPPEFKHLICKPDQQYYTRVG
FT                   TISPAMQRVLWQIVRCPYLGLAKRMYLEGKALEVAALVLEQECEVQRGRRALHNLEPDY
FT                   VDRICRAREIVLQNLDRPLSLVELARQVELNDFLLKGGFRRVFGKTVFGYLRDYRLEQA
FT                   RQLLLSGKTSVAEVMRAVGFADRGYFAEAFRKRFGVNPKDYTKEPM"
FT   CDS_pept        complement(349528..351063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0336"
FT                   /note="ORF_ID:gll0336"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88277"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88277"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017549"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNS4"
FT                   /protein_id="BAC88277.1"
FT                   /translation="MTLRPLYHWRCPDLPPWHWMRRRRRPFVRTCTLAIPVRQMAQGSQ
FT                   SKYPGRLRTIGPTIVIDKDMQVIYSAIASLGPPPAGDRQNGWMPAGRFCAGHFYIDSVW
FT                   RRTMGSLMDRLSQSGRTCIWPWVVLGVGLMSGPALAGPTDASCYAQRNLVSNSSAFAPQ
FT                   IVDPLVRNAWGLSLRPAGLGGHFWVANTETGTATTYVGDTDSTPLYQDDLKFVTVAPPP
FT                   LAAEGTTATPTGQVFSGSDTDFVVSGEGITAPSRFLWVTEDGTLSGWAERTNPDGSVER
FT                   MTRSVLVVDKSQQGAIYKGLAVTPYPRGNRLYAANFAQGRIEVYDGAFRPVPLIRTTTQ
FT                   GWIEPFAHPEAVPAEYAPFNVQFLGERVYVTYAKTTEDPNTEEQGPGLGYVAVFTPRGQ
FT                   YLRTLEHSERLNAPWGLAIAPEDFGSLSGALLVGNFGDGTIVAFDRQSGQQVGYLSGPD
FT                   RQSIKVDGLWGLTFGNGESLGRANYLYFAAGPNDEQDGLFGSLNAVSCTAGGA"
FT   CDS_pept        complement(351486..352049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0337"
FT                   /note="ORF_ID:gll0337"
FT                   /note="nutrient-stress induced DNA binding protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88278"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88278"
FT                   /db_xref="GOA:Q7NNS3"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNS3"
FT                   /protein_id="BAC88278.1"
FT                   /translation="MVTLRNQLRHAFGQVQDNPVGLDRSVTEPVTEGLNHLLASFYTLY
FT                   HQYQKHHWVVEGTEFGQLHRIFDEYADQVRGHAEELGERVDGLGGVPVSTPVRLQELSC
FT                   FQPEGDDVFDCRTMIVHDLQAEQAIIEQLRRQIAAVASLGDYASEYHLKKVLLETEERA
FT                   FHLAHYLADDSLVLDLKLSTAHAG"
FT   CDS_pept        complement(352332..353153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0338"
FT                   /note="ORF_ID:gll0338"
FT                   /note="tetracenomycin C synthesis protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88279"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88279"
FT                   /db_xref="GOA:Q7NNS2"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR016874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNS2"
FT                   /protein_id="BAC88279.1"
FT                   /translation="MPTTKVQLGAVQETLLIPLWARAAENNQPDPILRDPKSAEILGQI
FT                   DYDFSKLAKAEGTQMGCCMRGWLFDRWVSAFLAGHPDGIVVEIGCGLNTRFERVDNGRV
FT                   LWFDLDLPDAMALRGRFFEPTDRRRFIAASALDPAWVEIVNSAGPRPVLFVAEAVLIYL
FT                   SEAQVRQFLALVAEHFAGALLAFDSMAPSAVKNQHRHEVMRYYNARFQWGIRDIRAIES
FT                   WDSRYRVLESCTFWDVPKRYHRRVPLLMRLLYSLPPLNNAYRLSLVRLGRE"
FT   CDS_pept        complement(353372..353794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0339"
FT                   /note="ORF_ID:gll0339"
FT                   /note="similar to ferrichrome-iron receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88280"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88280"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNS1"
FT                   /protein_id="BAC88280.1"
FT                   /translation="MNDPRPFVLGGCLGLVLAPVACAEEAQEARRLQQLDWPATHAAPL
FT                   AQVEPQAQVQTVPQPDDGEELDEVTVFGSGGYRRKNATSGTKTDTPLLLTPQSIQVIPR
FT                   LHPLEKQCCCLFCLRCRSWSNRLGLSRLTPSVIDII"
FT   CDS_pept        complement(353791..353952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0340"
FT                   /note="ORF_ID:gsl0340"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88281"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88281"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNS0"
FT                   /protein_id="BAC88281.1"
FT                   /translation="MPWFQKSTFRCGFARGGHLPGRLRWQLEAGLVESILDWLASHGPR
FT                   YSTHRGEL"
FT   CDS_pept        354153..354923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0341"
FT                   /note="ORF_ID:glr0341"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88282"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88282"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR021793"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNR9"
FT                   /protein_id="BAC88282.1"
FT                   /translation="MSTGSQVYAMVVSTEPVVYPDCDGLPMSDNTEQFRWIVYIKEGLE
FT                   WLFVEDPDVFVAGDLLWYPLEGDNKTRQAPDTLVVFGRPKGRRGSYRQWLEAGVPPQVV
FT                   FEVLSPGNTVREMTRKFAFYQRFDVEEYYIYDPEAGALDGYVRRGGVLEAVEPMAGWVS
FT                   PGLGVRFGVDAEGQLQMWRPDGAPFESYVEIAARAEQERQRAEQAEQRAEQAEQRADQA
FT                   EQRAEQAEQRAEQERLKAERLAEKLRKLGIEPPA"
FT   CDS_pept        complement(354981..356081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0342"
FT                   /note="ORF_ID:gll0342"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88283"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88283"
FT                   /db_xref="GOA:Q7NNR8"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNR8"
FT                   /protein_id="BAC88283.1"
FT                   /translation="MKRHRLLFHLHRVTGLLAGILIAILGLTGSSIVFWKELDHALYAP
FT                   LFHVVPQGQKVPLDRVVATVKQAHPKSDLESVQLPQQPHDPYMMNLKRGEEYYEVHANP
FT                   YTGELLGARRWDQTPIGYLYQMHNTLLLGETGELVVGLCGLWLLLLGGSGLLLWPGWKK
FT                   PATGFRVRWRSPSPLLQYDLHKITGIFSAALLMISGLTGALIILLHLVPSLFFAMIGYA
FT                   PQPAEATSRAGSNRPPMPLEALLDRADAALPEGRALSIALLEGGSVQVRKHIPPAPFPE
FT                   EGLSTVDLDGYTGRVLAVQKVAEPTPGIQVLALITTLHFGSFGGLPTRILYVLLGLTPS
FT                   LLLATGLLRRLHKLRLERVKSRSAPH"
FT   CDS_pept        complement(356086..358464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0343"
FT                   /note="ORF_ID:gll0343"
FT                   /note="probable ferrichrome-iron receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88284"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88284"
FT                   /db_xref="GOA:Q7NNR7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNR7"
FT                   /protein_id="BAC88284.1"
FT                   /translation="MMIRRNGAWRHGRFALSLLMSSAAFHSQVNALPIGMEAADAAPLL
FT                   IERKADLRPFRTEASALLGEHIAQGPPAEPDPTPQSAPTVEDDGSEADLEEVVVTATRT
FT                   RERLSDVARTVYVVPRRTIEQQSILTGSVVDILGNTVPGFGPPKENRVGNTLRGRDPQV
FT                   LIDGIPVISNYASFYELSYIAPIAIEQIEVVGGPTAIYGDGATGGTINILTRRSTEKPQ
FT                   ATTRAGFDLGLSNTAGGAGKFVEQFFSSQAGPVDFTIAASYRGSGNFYDAAGNRTPSLS
FT                   DTLDTKNAYSAYGRFGFKLTPEQKLQLVASYSADTRYVNSFASPAVNSCCGVQQSRAIA
FT                   RNVVLESGYGQPVLQNFLAALDYTHENLWGSKLFAQVSYRDAFEVGIPYDFRFTPDGSG
FT                   GIFDSFLRFLKGSEQVTTARAQVETPLADNLKILWGTDFKNDPVGAGIFELFDSKVFDE
FT                   SNQSILRTSGLVTIAPAYRVASLGAFLQTQWNISEQWVASGGLRFENVTIEAKDFFSEF
FT                   AGGLVRGGSLDDSATVFNLGIVYKPTTETSIYANFAQGFSVPNFGSALFGVPSGFVLSD
FT                   SLRALQPQIVDNYEIGFRGRWRSVQATLAAFFNYSALGTSTVQTGATTYENSRSPQRNY
FT                   GVEATLDYQPAPGWRLGTLFGWSEGEQDFFGDGNFYPLNSFAVPPLKATAYIEHQTAPG
FT                   WSNRLQLLYSGNRDRAYNALVDGFRVEGAPIYDYATVDYIGNIKFGSGTLEVGIKNLLN
FT                   NLYSPVYSQAYSSFGFGPTDRFNVAARGVTLNVAYTIDY"
FT   CDS_pept        complement(358626..359420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0344"
FT                   /note="ORF_ID:gll0344"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88285"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88285"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNR6"
FT                   /protein_id="BAC88285.1"
FT                   /translation="MVHFDASLHLPTALELPDSDETPVDNELQDSVPAVLKAVLALLWQ
FT                   NRSDWFFGIDMGIYANTEAPGTAIVPDGFLSLGVPRFRPKYGKRGRPSYVLWEEEGIVP
FT                   VFVLEVVSQTYRGEYTKKLKEYQDLEVLYYAVYDPEGFQPEHERLEVHHLVGGAYVRMV
FT                   GEPVWLPEIGLGLGRAEAALGGWEREWLFWFNAAGERYPVPEEYQRYRAEVAEREAQRE
FT                   QQTRLEAEQQARREQQARLEAEKRAQTLAERLRTLGIDPDSL"
FT   CDS_pept        complement(359542..360747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0345"
FT                   /note="ORF_ID:gll0345"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88286"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88286"
FT                   /db_xref="GOA:Q7NNR5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNR5"
FT                   /protein_id="BAC88286.1"
FT                   /translation="MLLIESLRMAVATLGANKLRSGLTMLGIVIGNASVIAMVGIGQGS
FT                   QNFIAGKLEAYGTNRITVFTQSEDPDGYVFPDSKLVLSDAEAVRTQVPAVRAVAPIIEV
FT                   RLPIFLGSRRTATNVRGTTPDFARVQNFAVERGRLFSPDELQRESQVVILGATTANKLF
FT                   GRAAPIGREVTINNLPFRVVGLLKPKGSFAGDNPDETAVVPVTTMANRVVGRRSAYGTP
FT                   ITYLEAMAVDSTQIRSAGFQMLNVLERLHGRKDIILSANKSFIDLANQVSGALSLLLSL
FT                   VAAVSLLVGGIGIMNMMLVSVGERTQEIGLRKAIGAKQRDILSQFLFEAVLLSAAGGLA
FT                   GIAVGIGATLPLAWFTPIRPLIPWSAVLLAVGVSGTIGLVFGVFPARQAARLDPIAALR
FT                   SS"
FT   CDS_pept        complement(360751..362079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0346"
FT                   /note="ORF_ID:gll0346"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88287"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88287"
FT                   /db_xref="GOA:Q7NNR4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNR4"
FT                   /protein_id="BAC88287.1"
FT                   /translation="MLLKWKRPLPWLIGLAIFGTGAAAVIYVLGAQSGLSQAQVAAMTI
FT                   PVATTNLGQQVQASGLVQPIRKTNLSPRQAGRIGRLLVDEGRQVKQGELVAQMESRLPE
FT                   AQVRQAEASLARAQAELLQKRRGARPEEIREAQARLLSAEAAVRQGAARLERTGEELAR
FT                   YRRLAGEGATSQNALSDYVNREREAAANLAGQRSQLEAQAQVLARLRKGTRIEEIRQAE
FT                   AGVALAQAQLDYFRTQLEETRVYAPFAGVISRRFAQQGDYVTPSTAASTSDGASSTSIV
FT                   ELVSGLEVEAKVPEASLAQIYPGQAVQIRTDAYPGAVFKGRVRLVTPRAVREENVTTIR
FT                   VKVTLLSGQGQLRPGLNVKVNFTAATLAGVSTIPLAAVISKQDGQTGVLVPTAGNRAQF
FT                   RPVRLGTSAGSKVQILEGLRPGERVFLQPPPEVVVEGVDTLVW"
FT   CDS_pept        362228..363436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0347"
FT                   /note="ORF_ID:glr0347"
FT                   /note="similar to two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88288"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88288"
FT                   /db_xref="GOA:Q7NNR3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNR3"
FT                   /protein_id="BAC88288.1"
FT                   /translation="MTIVTGSGVYTDRYSSLYHKFCMLRLPALPQPSLRWTVLCAEWTL
FT                   LAMITVLELLNNNSLAAVPMMAALLGFTGIFWALSFYFPLEAPAWKKKLYIAAELMLAF
FT                   AAMWIGIGYDTLIYLILIKSCLFLGRGEVILTVVITAVFYLLTTWRQQFADDSETLNIG
FT                   FDMLNASIYHLGISTFVILLGFVIVAERRSRARAEELAEELEGLAANLERARIARDIHD
FT                   SLGHTLTALDVKLEVAQELYCRDPDRARQAVHTAKQLSGQCLQDVRLAVQAMRRPPLHL
FT                   DAALEGLAEQVRQNRALAVEVHIDLPQLPLQTSHQLYCIVQEGLTNIQRHARAARVSLR
FT                   ACHTPQSVTLELWDDGQGFDPQATHGGFGLRGMHERMQVLGGSLAIASAPGRGTRIRLS
FT                   VPR"
FT   CDS_pept        363433..364065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0348"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:glr0348"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88289"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88289"
FT                   /db_xref="GOA:Q7NNR2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNR2"
FT                   /protein_id="BAC88289.1"
FT                   /translation="MIRLLLVDDQPLFREGLADLLLLEEDMQIVGQAGHGQEAITLAMQ
FT                   LLPDVILMDVRMPVCDGVEATRQIHQRYPWIRILVLTTFDEDEYILQSLQAGALGYLLK
FT                   STPARQVASAIRTLHQGHSQLGPTIAARVFSQLQNPPARKPESFQQFSERELEVLGLIG
FT                   QGKNNREIAQALHLTEGTVKNHVTRILAQLGLRDRTQLALWTHRHLG"
FT   CDS_pept        364135..366495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0349"
FT                   /product="ferrichrome-iron receptor"
FT                   /note="ORF_ID:glr0349"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88290"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88290"
FT                   /db_xref="GOA:Q7NNR1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNR1"
FT                   /protein_id="BAC88290.1"
FT                   /translation="MSAQTVHGKGFGPFSPAVSTPAFTTLLSRSRKMERALSNVRRGSL
FT                   AVLIGVLCVSGRSLAAPVAPPAGSDAVMRRAELPPVATEARFLAQQEPLVPVTPTAQTP
FT                   DPEKPAPSPQQEEELEEVTVQGTRSYRVKRSSTATKTDTDVMDVPQSIQIVPQQVLLDQ
FT                   NVNTLTEALRNVASVTTEFRDGTGADFYAARGFQIGADNIRLDGFRTSTRTELYNVGIE
FT                   QVEVLKGPSAVLYGDMEPGGLINLVSKKPQPVPFGTVALNVGSYGNVWTTLDTTGPLNA
FT                   AKTLTYRLSTRQESANSFRDLVNGNKFFVAPALSWQISERLRWDLRVGYQYLFRVSEFG
FT                   LIAPTREFSSVNTLPLNRFYGEPSDNVTSYQTNVTSTLEYKFGDDWTLRNLLGYSGYRV
FT                   IWQPTQPLAVLEDGRTLERNQFVFDETTERYNAELNLTGRFATGAVRHQLFAGIDYTRS
FT                   SRPSVFLDGPTTPIDLYNPVYTNPPRSLQPTSGSASDSSEFNNRFGISLQDQIDLGDNF
FT                   KLLLGGRYSFYDAGRYQELPPQAPTFNNAQRFSPRVGAVWRPTDWLSLYASYSDAFTPA
FT                   SGRSATGQLFKPITGTQYEVGAKAELFGGGLLATVALYELTKQNVLTRDPDNPQFSIQT
FT                   GEVQSKGFEVDLSGRPLPGWDIYASYAYVDARFTRDNVIAPGTEVGGVPRNTLSLWSKY
FT                   EFGGDLRGLSVGAGLYWSDNRWNVFSTANLFQVPGYTTFDAMVAYRFDPRWKVQVNLKN
FT                   LFNRRYYTDSDDSLVFIPPGAPTTVDVSLSYTF"
FT   CDS_pept        complement(366686..367477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0350"
FT                   /note="ORF_ID:gll0350"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88291"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88291"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNR0"
FT                   /protein_id="BAC88291.1"
FT                   /translation="MNAFKPGLPIRSADLSLLTMYDLPSENPEEPGLPDQFHDWQPQLL
FT                   SQTFRPLAVPPDQVLTAADLNVYYDPRNPRYYKRPDWFAVVGVPRFIEGGRLSYVRWQE
FT                   GRSPVIVVELLSPNTIEEDQGLTLRGRQPPSKWEVYEQMLQVPYYVLFDRVGDTLQLFR
FT                   LEDGLYKQQQDSRLWIAELGIGLGLWTGTFADWERRWLRWYDSEGRWIPSEPEKIAQEQ
FT                   QRADQERQRAELAEQRAREAEQRLQELNERLKAAGIDPEGL"
FT   CDS_pept        complement(367719..367898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0351"
FT                   /note="ORF_ID:gsl0351"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88292"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88292"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNQ9"
FT                   /protein_id="BAC88292.1"
FT                   /translation="MPSVGVSASRCLPMNSRIRWVEEQFLEPEEVREILLKLRQAALPI
FT                   VLVGGQAVHFWAMH"
FT   CDS_pept        367920..368240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0352"
FT                   /note="ORF_ID:glr0352"
FT                   /note="probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88293"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88293"
FT                   /db_xref="GOA:Q7NNQ8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNQ8"
FT                   /protein_id="BAC88293.1"
FT                   /translation="MKDRLGLSVRNSRIAPVASKALLLFFTGQPLELTGLRHSDGHDFR
FT                   STTTVRLNIPRQLPQTAAPGEIAQALHLTEGTVKNHVTRILAQLGLRDRTQLALWTYKH
FT                   LG"
FT   CDS_pept        368398..370635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0353"
FT                   /product="ferrichrome-iron receptor"
FT                   /note="ORF_ID:glr0353"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88294"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88294"
FT                   /db_xref="GOA:Q7NNQ7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNQ7"
FT                   /protein_id="BAC88294.1"
FT                   /translation="MRSGLQGIRCGSLVTLAWAVFVGCSSQLFAASVATAGGVVSIPRK
FT                   ADLQPVRTEARELLASPLAQAVPAASAPEPTAQRPPDDAEDLDEVTVTGERRRRYLVPD
FT                   TSTATKIDTPIRDLPLSIQVVPQQVLEDRKVRNVTEAVETVSGVVDGGDLFGAPSGARI
FT                   IRGFEQSGNFRNGYRDVGYYALTGVGTIEQVEVLKGPASVLFGAVEPGGLINVVTKRPL
FT                   SEPYYNVAIQAGNLGYYQPSIDLSGPLNSDKTLLYRVNANYQGLDGFQNFVTTNLTTIS
FT                   PTVTWKLGDKTVLNLHYEYIRFFANPPESYAVLLSDGRMTPRNLYLSYPSLAFNDIVTQ
FT                   KYGYSLSHQFNDDWQIRNSFSVAASNTKEAQVYGTSLVSDRFVDIDAYDLKYAQDNYFG
FT                   QIDLIGKFKTGSISHQLLLGFDFNRFVDVYNGYFNTDLPALDILNPNYNIPKPDYVPFF
FT                   DFYQPIQSYGVYLQDQVTFLDNLKLLVGGRLDWVSQKFATGTPDAPIQNDSAFSPRIGL
FT                   VYQPSESVSLYTSYSQSFNPTQGFNPDGAAFKPTKGAQYEAGIKVDFLDRRLSTTLAAY
FT                   QIIKENVRTVDPNNPLFSIQVGEQRSQGIELDFAGQVLPGWKIIGSYAYTDGEVTGDNL
FT                   IPAGNKLRNVPEHQASLWTTYEIPQGNLKGLGFGLGLFYVGSRAGDLPNTFTLPDYLRT
FT                   DAKLYYRNSGLNAAINIRNLFDMDYVRSSFNNIFLQRGAPLTITCSIGWEL"
FT   CDS_pept        370758..371231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0354"
FT                   /note="ORF_ID:glr0354"
FT                   /note="similar to ferrichrome-iron receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88295"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88295"
FT                   /db_xref="GOA:Q7NNQ6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNQ6"
FT                   /protein_id="BAC88295.1"
FT                   /translation="MPTCPIIRRSATGQLFRPVTGVQYEVGAKAELAGGRSLATAALYE
FT                   LTKQNALTTDPDNPLFSIQTGEVQSKGFEVDLSGRPLPGWDIYASYAYIDARYTRDNDI
FT                   AVGTEVGGVPGTSLYRSVGGQTTSAGHCGWCMGRARCCDGAIVAVAPGAGWTR"
FT   CDS_pept        complement(371347..371613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0355"
FT                   /note="ORF_ID:gsl0355"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88296"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88296"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNQ5"
FT                   /protein_id="BAC88296.1"
FT                   /translation="MQSAAGERVRWTTADGEQNARRDRELKLKLYSVRGVLEYWIVDWQ
FT                   LKHIEIYRREQQALRLTATLLETDTISSPLLPGFACALGPLFA"
FT   CDS_pept        371990..372250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0356"
FT                   /note="ORF_ID:gsr0356"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88297"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88297"
FT                   /db_xref="GOA:Q7NNQ4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNQ4"
FT                   /protein_id="BAC88297.1"
FT                   /translation="MQSMNISLPEPLKQFVDGQIAQGRYSSASEYVRELIRADEKRKAE
FT                   EQLEAKLLEGLNSPASELTAADWSSIRKEALARLEARKKQR"
FT   CDS_pept        372250..372570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0357"
FT                   /note="ORF_ID:glr0357"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88298"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88298"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNQ3"
FT                   /protein_id="BAC88298.1"
FT                   /translation="MPQVTQHAAARNDLIEHFVYLAENAGLDIAERFLLNAEASFNALA
FT                   EQPMLGVALTLRHFELAGLRKWRVKDFDNVLIFYQPHPDGVSIVRVLHAARDWRNLLEI
FT                   EA"
FT   CDS_pept        372702..372821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0358"
FT                   /note="ORF_ID:gsr0358"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88299"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88299"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNQ2"
FT                   /protein_id="BAC88299.1"
FT                   /translation="MVERIGGLADGQIDALAEVLLDFGSAADLQHWLDSRVPS"
FT   CDS_pept        373032..373874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0359"
FT                   /note="ORF_ID:glr0359"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88300"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88300"
FT                   /db_xref="InterPro:IPR022573"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNQ1"
FT                   /protein_id="BAC88300.1"
FT                   /translation="MRTDHIFYKLFQAFPETLFELIGIEQTPLPGSYAFDAVEVKETAL
FT                   RIDGVFVPAVSGQPHYFAEVQFQKDTDIYWRLFTELLLYLRGSAPQGDWRAVLIFAGRN
FT                   LDVDVPTALLDLAGGPRFERVYLDELAVAEDGPLGLSLVGLVVEDVRTFPGRARQLLER
FT                   TREQLPPGEARRRALEFIETIIVYKLRYGPEEIRAMFTLDELEQTPYVQGIKAEAGHEA
FT                   RLSLVLRQLHRRVGALEPGVVERIGGLADGQIDALAEALLEFRCAADLQSWLDSRVPD"
FT   CDS_pept        complement(373890..374273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0360"
FT                   /note="ORF_ID:gll0360"
FT                   /note="similar to ferrichrome-iron receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88301"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88301"
FT                   /db_xref="GOA:Q7NNQ0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNQ0"
FT                   /protein_id="BAC88301.1"
FT                   /translation="MIASYAYTDAKITRDNSFAVGNRLPIAPLHGASFWSAYRIGEGPL
FT                   EGWGVGAGLFAVGERFEDLDNSFILPGYTRVDAALYYRRGWLNAAINFKNLLGAQYIES
FT                   AIGRTAIYPGAPFTVQGTLEVRF"
FT   CDS_pept        complement(374437..376647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0361"
FT                   /note="ORF_ID:gll0361"
FT                   /note="similar to ferrichrome-iron receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88302"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88302"
FT                   /db_xref="GOA:Q7NNP9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNP9"
FT                   /protein_id="BAC88302.1"
FT                   /translation="MSRPDRLPLQARLSLLTTCCLLGVSTAHAAPDGAARKSDLQGDGS
FT                   KAAGLLADAPPVLPDGEELEEVTVSGERIYRRRNAGSATRTDTALRDTPASVQVVPQQV
FT                   IEDQQVTRLDEALRNVSGVTFNGLDTGTDGRFSIRGFENVPLLQDGFRQYNLVGLPETA
FT                   NLERVEVLKGPASVLYGEAQPGGVINAVTKQPTATPLYSAELQAGSFGLVRPRLDLGGP
FT                   VSADGTLRYRLNTVFESKASFRNYTQQYRKFFVAPVFAWQLDERTRLNLELQYQYSERP
FT                   WDGGTVALGTGVVRVPRERTFNEPDDFIRRNFLNTGLTLSHRFSDNWSLKSAFRFTENR
FT                   IYSDKLTIPIFFDEASGTLGRVFAFDDFRSRDYSLQNALTGKFSTGTIDHTLLLAVDLN
FT                   RNDFTQVATGDLFNPTLINVFNPVYRAVPRPDKAQMGLLFDQQAQTDRLGVVVQDQLSF
FT                   SPDWKLLASLRYDSVRQKVEDVPALFTPTGLGSFQYNDAFTPRLGTLYRPLPQLGIFVS
FT                   YARSFNPSVNAFAFDGLPLPPERGEGYEAGLKADLGANLSATLAFYDLTRRNVPTPDPA
FT                   FPGLGFVLATGEQRSRGVELDLAGQILPGWNVIGFYSYIDAQVSRDSIVPVGNRLPGVP
FT                   EHSASLWSTYQLQSGAAQGLGFGLGFNYVGERAGDLDNTFYLNSHFLTNAAVFYGRGDW
FT                   RLAVNFKNLFDVDYIDGTPIGRVSAGVPGEPFTVIGSVSARF"
FT   CDS_pept        complement(376670..377746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0362"
FT                   /note="ORF_ID:gll0362"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88303"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88303"
FT                   /db_xref="GOA:Q7NNP8"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNP8"
FT                   /protein_id="BAC88303.1"
FT                   /translation="MRSVLLAVHRFSGLAVGLVLLVIGLTGSAIVFIQPLDRALHPHLY
FT                   GSTTAKSVSVERVVAAARAEYAQTPPLAVGFFDHSPPLVFFVPSGGKSVHAFVDPATYR
FT                   VRGVRIWEQSPLGFLYQLHTQLLAGEVGKAIVGAIGLLMVAMVLTGLVLWPGWNKWRAG
FT                   FSLRLGSDGRLAAYDLHKILGITTAALLGLSAATGAALAFRPAVESVAHTVEGTPAPKP
FT                   PQSAPNGRPAIGADAAVEKALPALAGAGLYGVFFPAGPQGTYEVMGRFEGEAPARELIH
FT                   AYVDQYSGRVLRVEDDRRAGGADALLHWLAPLHYGTFGGPATQVLYVLVGVAPGALFLS
FT                   GFWWWLGKLRRTRAVAKT"
FT   CDS_pept        complement(378002..379483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0363"
FT                   /note="ORF_ID:gll0363"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88304"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88304"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNP7"
FT                   /protein_id="BAC88304.1"
FT                   /translation="MWGLPPSTGVDPLLRKKGVHSIVRLSSGSRRGDLCAFQVLRTIGQ
FT                   MVALRSKIALTCLAHGEIRVYGRRSVLQGLAYGFLVAGGAARPTRAAVSLAAGPMPGCL
FT                   RPDGATLWLQGNAPAKLRVEYWDVLAPQKRMLSGEYALTAVEDYIAYLRIGGLGPSRRY
FT                   AYRVLLDGVVQVIPEPLLFRTSGAGGIYAPFKMLAGSCAYTKDAPIFESMARQRPDGML
FT                   WLGDNVYFQRSALLITGEWASAEAMHNRYRLDRQAAALQPLLRCTHHYAVWDDHDYGPN
FT                   DADGGYTLKRESLDLFKRFWDNPGYGLPDTPGVFTRFEHNGVDFFLLDDRYHRTGDQML
FT                   GEKQTAWLKDGLLRSRGVFKVVAGGNQMFNDDNRFEGWNRFVREREDFVRWLSANRIRG
FT                   VLFLSGDRHFTELLRYERPGTYPLYELTCSPLTSKAYKEAQKASATVPGTFVTENNFAS
FT                   LEFGGGATDARLLLRCWNIQGKQLWEQKILAANLQ"
FT   CDS_pept        379482..379907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0364"
FT                   /note="ORF_ID:glr0364"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88305"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88305"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNP6"
FT                   /protein_id="BAC88305.1"
FT                   /translation="MHRGRSLYARHQGAFMTFSLYSRLLPVVGGLVLALVPPALAQLER
FT                   TSPVASPNSPATPNGTLPEIVPCDKDGKPIGSKDDKIVAVPTPPGTPRDEGAVIAPPPG
FT                   TPEDKGAVIAPEKAAGTPSNLPRCTPQPAGSTPDQPR"
FT   CDS_pept        complement(379904..380419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0365"
FT                   /note="ORF_ID:gll0365"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88306"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88306"
FT                   /db_xref="InterPro:IPR021256"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNP5"
FT                   /protein_id="BAC88306.1"
FT                   /translation="MLKAFAVGLVGVMLVLPGAVVAGVANGETFFERFPALARAATDNN
FT                   SSTYNFARYSFDVVVPTDSGEGLGSLLIGIPNGIRPPTPDMVQAFNGNGDPVAVQSNVQ
FT                   GNAVQVTFAQPVGPGNRVSVQFYPMRNPRRGGTFLFDVNAAPAGPSPRAQFLSYGRITF
FT                   YTPGGRGH"
FT   CDS_pept        complement(380413..380745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0366"
FT                   /note="ORF_ID:gll0366"
FT                   /note="similar to ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88307"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88307"
FT                   /db_xref="GOA:Q7NNP4"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNP4"
FT                   /protein_id="BAC88307.1"
FT                   /translation="MNATGMQNKVRAGSAARVTPETPMVFEWQDRQIAVFNIEGRFCAL
FT                   DNLCPHKEAPLVDGKPVFEAGQMWVSCPWHRFLFDPATGRCDRSGFDTRAYPVTIEAGE
FT                   LYVWVC"
FT   CDS_pept        complement(380846..381592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0367"
FT                   /product="aquaporin Z"
FT                   /note="ORF_ID:gll0367"
FT                   /note="transmembrane water channel"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88308"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88308"
FT                   /db_xref="GOA:Q7NNP3"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023743"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNP3"
FT                   /protein_id="BAC88308.1"
FT                   /translation="MSLVKRSVAEFIGTFWLVLGGCGAAVLAAAFPNLGIGFAGVSLAF
FT                   GLTLLTMAFAIGHISGCHINPAVSIGLWAAKRFPATELLPYIAAQVLGGIAGAGVLYLI
FT                   AGGKAGFSLSGGFASNGYGLHSPGGYTLLACLVCEVVMTFMFLMIILGSTDRRAPKGFA
FT                   PIAIGLSLTLIHLISIPVTNTSVNPARSTGPALFVGDWAIAELWLFWLAPIVGAALAGL
FT                   FYHAFLDEPGEETEGTPASAQLRTEA"
FT   CDS_pept        complement(381736..382809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0368"
FT                   /note="ORF_ID:gll0368"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88309"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88309"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029132"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNP2"
FT                   /protein_id="BAC88309.1"
FT                   /translation="MMKNIKFNRGLLGTLAALVIGPIAVQAAHACTRAVYIGPQDTIIT
FT                   VRSMDWFADIGTNLWAFPRGLQRDGAAGAKTIRWTSKYGSVVAAGFDAGTADGMNEKGL
FT                   VANLLYLTESEYVKATNADKRLPLSISAWAQYVLDNYATVAEAVEDLRKEPFYVVPTMT
FT                   PDGKPGQLHLSISDSTGDSAIFQYIGGKLNIHHGRQFQVMTNSPIYDQQLALNEYWKEI
FT                   GGTTMLPGTNRAADRFVRASFYIKAIPQTANNTEAVASAFSVIRNVSVPLGFSTPGQPN
FT                   ISSTIWRTVADQKNKRYFFESARSPNVFWVNLTDLDFAAGKPTKKLTLTNGTTFAGNTA
FT                   GQFQPAEPFKFLPAEVK"
FT   CDS_pept        383159..384193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0369"
FT                   /note="ORF_ID:glr0369"
FT                   /note="probable dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88310"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88310"
FT                   /db_xref="GOA:Q7NNP1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNP1"
FT                   /protein_id="BAC88310.1"
FT                   /translation="MHSAMLYGVEDVRLEEVPCPEPGPGEVLVRVAVAPTCGTDLKVWL
FT                   RGGHARMLVPPTPFGHEFAGEIAALGEGVSGWRSGERVVANNSAPCFDCFYCRRERFSL
FT                   CENLLFNNGTFAEYLRIPAAIVRHNLLAVPPGLPLELAAMSEPLACVLHGVEEAGVRAG
FT                   DTVVVMGDGAIGLMLVAVCAVRGAAVILAGGQSARLAVAEQLGAQVTLNYRQAGDPVGR
FT                   LRALTEGGRGADIVIEATGKPAAWEAAIATARPGATVLLFGGCPRGTAVSVDTENLHYN
FT                   ELTLKGVFHNTPRHVREALALIACRRIAFELLVSDSLPLGKLDEALARMRDRTAIKVAM
FT                   LPGS"
FT   CDS_pept        384452..385057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0370"
FT                   /note="ORF_ID:glr0370"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88311"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88311"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNP0"
FT                   /protein_id="BAC88311.1"
FT                   /translation="MEEEMEQGQPGFFEGLGEQADDFAGGVSEGIAGLWGGITQGAEDA
FT                   WNATTDIVGEGMANVAGFADGVTDYLQEGTVEAGEFLAEAGADVVGTTVGVASEGSEFV
FT                   NEGLAEVGELAQDGGAELSAWGEERSAADPEGSPLGEAAELTGGVLQAGGEWTEETGEF
FT                   GDNLYEQIGETGDDIVAYDPEFDAPQDDYVDQLDETLN"
FT   mobile_element  complement(385225..386711)
FT                   /mobile_element_type="insertion sequence:ISGL1b"
FT   CDS_pept        complement(385225..386628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0371"
FT                   /note="ORF_ID:gll0371"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88312"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88312"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M7G3"
FT                   /protein_id="BAC88312.1"
FT                   /translation="MPTIDPWTEHELQHLDLGDARRHTRLKQLLSSLARQPHASLPQAC
FT                   EDAAALKAAYRFLDNPQCHPADIRQAHASATAGRLAALPLVLLIQDTTELNFTAHPHTT
FT                   GLGHLSKPESQGLLVHSLLAVRPDAVALGLCWQKVWTRAAQVEHLAARRQKRPQQHKES
FT                   QRWLDGLAAAKGYVPPGGEAVLIGDRESDMFGLFAAPRPPQLHLLVRAARQRRLATPKT
FT                   LLFEVFAGASAQGHYRCDLARRPGRAARQARLQVYWQAVQLQPGRNDQTHKGQPPVSVW
FT                   VVRAWEVDPPAGEEGIDWWLLSSQPVTTLEQALACVHRYTLRWLIERYHYILKSGCAVE
FT                   QLQLETAQRLERALAVYCIVAWRLLQLTYQSRSEPELPCTVALAQHEWQALYCRMTQSR
FT                   QLPEEAPSLRQAVRWIAQLGGFVGRKGDGEPGVKTLWRGWQRLEDLAAGWLIARSAMAG
FT                   DGNEDVGNG"
FT   CDS_pept        complement(386920..387561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0372"
FT                   /note="ORF_ID:gll0372"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88313"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88313"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNN9"
FT                   /protein_id="BAC88313.1"
FT                   /translation="MVFGFAMDGSARTQPVLTELLAEAGFASLSAFCRTAKIGRRTARH
FT                   LQEGNLAAIRLETLRRIAVAFGVDVADLIERFEPAVPLAAPATTDWQLEYERLRAQFNE
FT                   LETHLREAWDLAFFRRVELLLLQLPTLRKAADQNPDLSAQTVLDLMLPFEEFVHDVGFE
FT                   TLGTPGEQVPFDPTLHQGAGLSPGEPAKIKTVGYRYRGQLLARARVNAVG"
FT   CDS_pept        387592..389520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0373"
FT                   /product="cyclomaltodextrin glucanotransferase"
FT                   /note="ORF_ID:glr0373"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88314"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88314"
FT                   /db_xref="GOA:Q7NNN8"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNN8"
FT                   /protein_id="BAC88314.1"
FT                   /translation="MFRGYALSLYSRGIKGDPMDTQKIGEVEPHSQIEVQEKEDEFVNL
FT                   LQLSDIEFRGETIYFIVVDRFFNGDPDNDDGPDPSLYDPERQDWGKYWGGDLQGIIEKL
FT                   DYLQQLGVTAVWVTPLFEQVEAMAWEAAPIHGYWTRDFKRINPRWVAGEHEVRLFERND
FT                   TTFDRLIEALHKRGMKLVLDIVCNHSSPDAGGIKGQLFDDGKLIADYNDDKDHWYHHYG
FT                   EVNNWDDEWQVQNCDLAGLATFNENNVRYRNYIKGAIKLWLDKGVDALRVDTVKHMPIW
FT                   FWQEFNSDIQAHKPDVFVFGEWIYSHPLGERPVEFANYSGMTILDFGLCVAIRKALGQG
FT                   GVGGFHLIEDVFKEDWRYRGATELVTFVDNHDMPRFQSLGADGEALRLAVDLIMTCRGI
FT                   PCLYYGTEQYLHDDTDGGNDPYNRPMMDRWDTDTPLFQDIRVLSEVRRRNPAVKWGGQW
FT                   TRYITPDVFAYVRKYRDSRCFVAMNRSHEAVRLEAVLTELPDGAHRCVLSEAAFTIQDG
FT                   RLEKLELAPRQVVVISFVGRPVRGREIVRIQVNGFRTQPGEVVAVIGDCPELGDWDLSR
FT                   AFRLEYINDNTWFGEIPFNKSANQIVAYKYVIFRENGPPINENRTSRRRFVPDKSIAKW
FT                   RDVWEEG"
FT   CDS_pept        389550..390773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0374"
FT                   /product="N-acyl-L-amino acid amidohydrolase"
FT                   /note="ORF_ID:glr0374"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88315"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88315"
FT                   /db_xref="GOA:Q7NNN7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNN7"
FT                   /protein_id="BAC88315.1"
FT                   /translation="MLLRRPRRTVMSDTPRPRPSIGALQPQLVQWRRHLHRFPELGFQE
FT                   QATSRFIAQKLASWGIDVQTGVAKTGVVATIAGRGDGPVVAVRADMDALPILEGNRVEY
FT                   ASENTGIMHACGHDGHVAIALGTARWLAEHRDALPATVKILFQPAEEGPGGAKPMIEAG
FT                   ALASPDVAAIVGLHLWNNMPLGQVGVKGGPSFANAAKFKATILGRGGHGAIPQQTVDAV
FT                   VVGAQVVNALQTIVARNVDPFEPAVVTVGKFQSGTNFNVIAQSAYLEGTVRCFSPELET
FT                   RLPERIEQVIAGICQAHGASYEFEYDRHYPVLMNDPAVAELVRSVAEEFLGRGRVRPET
FT                   TLGGEDMAFFLQKVPGCYFFLGSANPERGLDKPHHHPCFDFDETALGLGVELFVRCLER
FT                   FWERSMAE"
FT   CDS_pept        390875..392623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0375"
FT                   /note="ORF_ID:glr0375"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88316"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88316"
FT                   /db_xref="GOA:Q7NNN6"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNN6"
FT                   /protein_id="BAC88316.1"
FT                   /translation="MPIWYAMAVLLLCLGALPARAAEVADLVLTNGRVWTGVPQQPWVE
FT                   AMAVAKGRILKTGSREAIGKLTGRKTQIIDLGGRMAAPGFNDAHIHFLGGALDLAIVDL
FT                   NGTTSLAQIQRRVAEYARAHPERAWIEGVGWQYSALPGGRLPTRADLDAIEAKRPVFLR
FT                   SYDGHTVWVNSRALEIAKITPQTRAEGFGEIVRDPVSGEATGVLKESAVGLVRRHIPEP
FT                   TREEQLVALRAGMKLAASLGITSIQNAGGSAESFALYEELLRRGELTVRTSVALSVGPQ
FT                   TTDAELTEFARIHERYKNHPMLRAGAAKLLIDGVIETHTAAMLTPYSDKPDTRGEPAYS
FT                   AEVFNQLALRAHKAGLQLYTHAIGDRAVRIALDGYEYVKNIAQPADPRFRIEHIEVVAP
FT                   QDIPRFARLGVIASMEPIHADPGTVEVWSRAVGPERTERAFAWADLAAGGARLVFSSDW
FT                   PAAISLDPLRGLHSAVNRRTLEGTPPGGWVARQRVDLQRALRAYTAEGAYASFEENFKG
FT                   RIAPGMAADLVVFSQDLFTIDPLQIGSTKVVLTVFDGKVIYRDAERFANGGEASRNPKE
FT                   RLLQSM"
FT   CDS_pept        392640..394373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0376"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="ORF_ID:glr0376"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88317"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88317"
FT                   /db_xref="GOA:Q7NNN5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNN5"
FT                   /protein_id="BAC88317.1"
FT                   /translation="MRRRGPDGHFVRNYAQPKQSRTLRLTETAWAALVELARQRGISTS
FT                   DLIEQWARGQFAFPSGPIGDDGEARPVGVGAALAVRPCDEQAEGEQVSKILESITDAFF
FT                   ALDEHWCFTYLNRQAERLLSRSREELIGKNIWVEFPEALGTTFDREYHRAVERQVRVGF
FT                   EEFYAPLDIWLAVRAYPTAKGLAVYFLDIAERKRAEQALLASEQNFRFLADTIPQMVWT
FT                   TRPDGYHDFFNRRWFEYTGMNLEQTQGWGWSHLLHPHDLDKCLHLWKYSLATGEPYDIE
FT                   YRFRRASDGVYRWQLGRALPLRDPQGNILRWFGTCTDIDDQKRAEQERTHLLERERQAR
FT                   AEAEAANRAKDEFLAMLSHELRTPLNPIIGWTQMLRRGNLTPEMQAKALETIERNGKLQ
FT                   NQLIEDLLDISRIIRGKFSIAPIPIELPPVLHSAIEAVRNLAEQKEVLLDCRCEPSALN
FT                   RQVSADPTRLQQVIWNLLTNAIKFTPKGGRVEVDLAGDSANLYVAVRDNGMGIAPEFLP
FT                   YMFERFRQADSRSTRKEGGLGLGLFIVRHIVELHGGMVQAESEGEGKGAVFTVELPALG
FT                   G"
FT   CDS_pept        complement(394342..395061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobI"
FT                   /product="precorrin-2 methyltransferase"
FT                   /note="ORF_ID:gll0377"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88318"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88318"
FT                   /db_xref="GOA:Q7NNN4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNN4"
FT                   /protein_id="BAC88318.1"
FT                   /translation="MNLGTLYGIGVGPGDPELLTLKGLRVLRSAAVVACPADRTGRPGL
FT                   AARIAAPHLRREQRLTPLYLPFVSDEAVLAAAWSAAADTLYADLALGLDVAFISEGDVS
FT                   LFSTFTYILREFQERYAQVAVRIIPGIASPLAAAAALQLPLAIGDETLTILPAMHRIEE
FT                   LEAACAPGRIVVLLKVAPVYEQVYTWLKASDRLEQAHLLCWVSAKEERIYRRLPAAAER
FT                   LPYFSLLIIRPEPAARR"
FT   CDS_pept        complement(395058..396287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobL"
FT                   /product="precorrin-6Y methylase"
FT                   /note="ORF_ID:gll0378"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88319"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88319"
FT                   /db_xref="GOA:Q7NNN3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNN3"
FT                   /protein_id="BAC88319.1"
FT                   /translation="MHLLSIVGIGADGPRGLSADTQALIAQSPVIAGSAEQLRWWPGRS
FT                   GRIEMGADLAAFFAQLEQALTEAPVVLVATGDPLYFGIGRLVLERFGREQVRFMPHLSS
FT                   VQLACSRAKLPWQEAAVVSAHGRSLEKLGEALRPLPELVAVLTDPVNTPARIARFVLDL
FT                   APVTPYRLWVCARLGAEDEQVECLGCEQACERDFGEPNVVLLERAPARTPASLPAVGIF
FT                   DDHFVTFSDKPGLMTKYEVRVLAIAYLQLERGQVCWDIGSGTGSVAIEMARLIGGGSVY
FT                   AIEKTEAGCLLIEANCARLGVCNVRVRRARAPEVLAELPAPDRIFLGGGGRQLVAILEA
FT                   CTAGLRPGGILVASFAGLEQLVSAQAYLLKQGWSVQYTHLQIARSASLASGSRLVPLNP
FT                   VFLLRSTRPL"
FT   CDS_pept        complement(396342..396980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0379"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:gll0379"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88320"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88320"
FT                   /db_xref="GOA:Q7NNN2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNN2"
FT                   /protein_id="BAC88320.1"
FT                   /translation="MTRKTRVLLIEDDPVFRVGLRVIFEQSGVAELVGEAGEGEIALAL
FT                   CLQMQPDVVLLDLGLPGAMGAREIVTSLKERHPGIKILALTSHADGPSVQQLLQAGIDG
FT                   YCVKGIEPEQLLQAILQVRSGHVWWDGRVAAYLRSGPEPERRDYQLTPRERQVLGLLAN
FT                   GLSNQQIGRQLFISVGTVQVHVHTILRKLGARDRTQAAILALQEGLMDR"
FT   CDS_pept        complement(396973..398040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0380"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="ORF_ID:gll0380"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88321"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88321"
FT                   /db_xref="GOA:Q7NNN1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNN1"
FT                   /protein_id="BAC88321.1"
FT                   /translation="MYTAFKLQEPRRRALYGIVALILFVETVEYFAPTGYIFSYLYAVP
FT                   ILIAANHFSERQTQWITFLSLVSTILGLFVPTFELNSLTLVNRLIICSALWTVGTLSLR
FT                   YRQAQREAQEQRFRVQSQQQLLRAYENFTAALTHDLKTPLQGMAQTLRFFAQGQFGRLT
FT                   DAQRQVVQLFERSLGTLLELTDTLLTIYRNEREPLGLRCRSADLDALAAEVVTQWIDPA
FT                   GARQVTLVYEGLEGAQVEADPLQLGRAITNLVANAVRYTRLGSTVQVRVESRTAEYQIQ
FT                   VSDCGPGIPEGDLDRIFEQFYQSPLTRQSLGTGLGLYLSRQIVEAHSGRIWAVNNRDEG
FT                   CTFVMALPKTDQGHD"
FT   CDS_pept        398341..399660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0381"
FT                   /note="ORF_ID:glr0381"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88322"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88322"
FT                   /db_xref="GOA:Q7NNN0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNN0"
FT                   /protein_id="BAC88322.1"
FT                   /translation="MPSVIFEILIVLVLVVANGVFAMSEMAVVSSRKARLQQMAGEGNT
FT                   GARVAVELADAPNRFLSTVQIGITLIGIFAGAYGGATIAGTLAPQLARVSWLAAYSEAL
FT                   AFVLVVGTITYLSLVLGELLPKRLALSNPERIAARIAVPMSVLSRVAAPLVKLLSLSTD
FT                   LALKALGVKPSAALAVTEEEIRLLIEQGTETGAIAHSEQDLLERVFSFGDRQVAALMTP
FT                   RPDIVWLDLKDSEAENRRKLAAFHHSQFPVCLGELDKFLGVVRVKDLFERLLAARPLTL
FT                   EEALLQPLVVPETAPALVVLEQFKKSGIHMALVVDEFGGVQGLVTLTDILEALVGDLPV
FT                   DGTTDEAQAVRREDGSWLVDGSLSLDELEHLVEPLPELPRVGYRTVGGLVMAQLGRIPK
FT                   ATDHFNLGPCRFEVVDMDGNRVDRVLITTLGAGAERDSPP"
FT   CDS_pept        399707..402934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0382"
FT                   /note="ORF_ID:glr0382"
FT                   /note="cation efflux system membrane protein CzcA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88323"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88323"
FT                   /db_xref="GOA:Q7NNM9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNM9"
FT                   /protein_id="BAC88323.1"
FT                   /translation="MTSVLKPEEEQAQKKPGLLKKWIYGALKARLLAALLLVTVVGLGI
FT                   NSLTRFPIDGLPDISNVQVQVITEAPALGPQEVEQLITFPVEIALTGMPRLTQMRSISK
FT                   YGLSQITVVFEDGTDVYFARQLVNERLKGIEALLPGGSESPVLGPVSTGLGEIFIFELQ
FT                   GESRSPMELRTLMDWTVIPRLKSVPGVAEINPMGGFVKQYQVRLDPLRLLGYGITPQQV
FT                   FDALATNNANSGGGYLSSQRGEQTIIRGEGLVITTDDISRVIVDRSGGTPIYVRDIATV
FT                   EIGNQLRQGVVTRDSTDGAVIATVLMRAGQNANGVVKDVKTRVAEIQKELPEGVQIVPH
FT                   YDRTQLITAAIKTVALNLTEGALLVTAILLIMLGNVRASIITALIIPLSMLLAITGMVI
FT                   GGVSGNLMSLGAIDFGLLVDGAVFMVENIILRLSEQRPETPKERMAVIGAASAEVAKPV
FT                   AFAITIVTVVYIPIFGLSGVEGKLFQPMAFTVILALVASLVLTLTLVPLACYFAFAKKP
FT                   PEERETLVLGWVRPPYEWVLGRLMGRWLPVSLASFAIFAASLTLVPLLGSEFVPNLAEG
FT                   SLVINVRRPPAASLDEGARQTKIIERVVGEFPEVRTIFSTTGHPELATDTNKSENSDVF
FT                   VMLKPQKDWKTAKTQEELVAKIEKRLEGVIPGITIAYTQPIQQRVNELLSGDRLDVALR
FT                   IYGPELDVLNNAATQAAKAIKAVPGAADVRAETITGLPVLNIKVDRERLAQYGINVREV
FT                   LDTIEATRAGKVVGTVYEGRQRYALAVKFDEGAIADVDAVRRLPVSTKDGGIVPLETVV
FT                   DVTVGDGLAQVSHREGERVITVGMNVRGRDLGSFVAAAQAAVEQTAQLPKGYRLVWGGQ
FT                   FENYQSALSRLQILVPLALALIFVLLYSSFGNLRPGILIFLNVPFSLVGGLVALYLRGF
FT                   PLSVSAGVGFITLFGVAVLNGIVLVSTIRDIEEAEGIGPREAALKGAKERLRPILSAAL
FT                   LASIGFIPMAIASSAGAEVQRPLATVVIGGLVTCTLFTLFALPVLYPLICGPSGSSGGN
FT                   SLWARLRKLLPGGSSKRTNQPEAPQSG"
FT   CDS_pept        complement(403202..405469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0383"
FT                   /note="ORF_ID:gll0383"
FT                   /note="probable potassium efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88324"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88324"
FT                   /db_xref="GOA:Q7NNM8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNM8"
FT                   /protein_id="BAC88324.1"
FT                   /translation="MASELQLIVDIVTVLGAAAAGGFLASRLRQPVLLGYLLGGMVVGP
FT                   AGLSLVGDEGAIKALAEVGVALLLFALGVEFSIKELNKVRNIALGGGSLQVLLTIFLGG
FT                   GLAYLTGWVDTIPKAIFLGAVLSLSSTAVVLKILIERNEVQTAHGQAMLAILIVQDLGL
FT                   GLMLAVLPALTQPPEALGGALLWALLKSVLFIAGAVVSGIWLIPPLMRQVARTGSQELF
FT                   VLTVFALCLGVALVTSTIGLGIEMGAFVAGLMISEVEYADQALDRVLPMRDIFATVFFA
FT                   SIGSLIDPIFLWNNAPTLLGLVAAVMVGKALIVTPVVMIFGYPFKTALTVGLGLNQIGE
FT                   FSFVLAGVAQGLGLFSQELYGLTVGTTAVTLVVTPFVLKSSPMIFNALESLPVVGKALR
FT                   ASEAPKAIAVEEGIRDHIVVAGYGRVGETLVRMLRSQGHTVLVIDNNEATTESLRKQQI
FT                   PYLYGDSSSELVLEKAHLEQARAMAIALPDPMATRLTLKRVLSVAPEIDITVRAHANSE
FT                   IDALYQLGAREVVQPEFESALAMGSHMLIGLGLGVRDVQQEVVACRETRYRSILPDRPD
FT                   FMVANELEAAVEGLEGNWFTVKANSPLVGLTLAQADIRRLTGVSVMAIRNGSETNRYPG
FT                   PQTVLQAGDRVLAVGNVEEDKAFEELLEGRAEASIGRPERWVEVPKNSFLDGQTLADVD
FT                   LRRRHGVLVQAVQRTGKMVRFPNADTVVQAGDRLMVCGSAESIEQLRGLLQQVPTVTSQ
FT                   EE"
FT   CDS_pept        complement(405587..406183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobH"
FT                   /product="precorrin isomerase"
FT                   /note="ORF_ID:gll0384"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88325"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88325"
FT                   /db_xref="GOA:Q7NNM7"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNM7"
FT                   /protein_id="BAC88325.1"
FT                   /translation="MDLHPITAESFAIIDAEIGEHAFPPAEYQIVRRVIHATADFEYQH
FT                   LLRFEHGAIPAALAAIRAQTPVIVDVQMVKVGVAGSLGDHPLICALEAGIIPQAGQTRT
FT                   EAGLLGLSARYPEAIYVIGNAPTALLALVEAIRAGRAHPALVVGVPVGFVQVIPAKKAL
FT                   ASLAIPQIRVEGRKGGSPVAAAIVNALMALSTAAS"
FT   CDS_pept        406192..406854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobO"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /note="ORF_ID:glr0385"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88326"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88326"
FT                   /db_xref="GOA:Q7NNM6"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR025826"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNM6"
FT                   /protein_id="BAC88326.1"
FT                   /translation="MIPRPPDWWHDGLVARGPTMTDADTAHKLKMERRKQVQEQRLAER
FT                   DRKKGLLIVYTGDGKGKSSAAFGMIFRSLGHGLPVAVIQFIKGAWEPGEAKLLGRFPEL
FT                   VVFRAMGEGFTWETQDRGRDIAKAGEAWEAGLELILAGRHHIVLLDEINVAMKLGYLDP
FT                   NQVLAGLARKPEMVHVVLTGRGAPESIIEAADLVTEMKLVKHPFRSQGIKAQLGIEY"
FT   CDS_pept        407182..408318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0386"
FT                   /note="ORF_ID:glr0386"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88327"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88327"
FT                   /db_xref="GOA:Q7NNM5"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNM5"
FT                   /protein_id="BAC88327.1"
FT                   /translation="MATTNIDDYLNVLPLEKLAGKQDFWSFYDSEADTLYFNFKKPSVA
FT                   TDSELTDDDVIIRYEGDQVVGFTVLHASKRGGSLPVQIVFAQQLKLLETYLLILRKMKF
FT                   LPTLIWWRVNGINWMFWLGYPVFRPLLFLLITSHIRRILVPLERVYKLNASASPSEAVK
FT                   IQWVALHERVKLMREEIGVVIVSPLMLTILGPFGSAGLAVIISWETIKSLMQEGIRENV
FT                   QDITINLLSTYIFYVVNLISIALGLLSIVLVITFYVKRRLFNEPYVQLDELFLTPVLKK
FT                   IVDPATGKSLYLEEQKLFKAVEEPYPNENPVDQLLLGFTYLYLCLITASGFGILAWFIY
FT                   SRNHIVAYIYGFLCLIPILAGFLLIRGIWREIRERRAT"
FT   CDS_pept        complement(408371..410005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0387"
FT                   /note="ORF_ID:gll0387"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88328"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88328"
FT                   /db_xref="GOA:Q7NNM4"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNM4"
FT                   /protein_id="BAC88328.1"
FT                   /translation="MPVCTVEYRPPAIRSPPVQPGTIAPPVSHAESVPMGTAVSSKTPR
FT                   VRAPELPPKFHWLNTDRPLRLKELRGRVVLLDFWTYCCINCLHILPDLKYLEDKYRDSL
FT                   TVIGVHTAKFANEQDLDNIRRAILRHDIEHPVIVDESHTIWQSYTVRAWPTLVLIDPDG
FT                   YYVGHASGEGNRDLLDQLIGELVLRQTNQGRPLPGGLRTRLEKASAPPTPLAFPGKLTV
FT                   YGDRLFVSDSGHHRIVTSSLDGSSHESIGSGIPGWRDGNFEEAEFWAPQGLALSADGRT
FT                   LFVCDTENHLLRKIDLVRRQVSTFAGTGEQSLGYGQVEGPGLEIPLNSPWDAVVADGAL
FT                   YVAMAGSHQIWKCDPHSGRISTFAGNGHESTLNGTRDGSAFAQPSGITTNDHRLFVADS
FT                   ESSSVRTVGIAEDITALLCGSGDLFGFGDQDGLGEAVLLQHPLGVHWDGGTLWLTDTYN
FT                   HKIKRIDPESGRCETLTGHIDSGYLDGDLAEARFWEPAGLWRNGDRIYIADTNNHAIRV
FT                   IDLVSRRVSTLKIRNLCAPGYCFPDSA"
FT   CDS_pept        410021..411436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0388"
FT                   /product="phosphoglucomutase/phosphomannomutase"
FT                   /note="ORF_ID:glr0388"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88329"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88329"
FT                   /db_xref="GOA:Q7NNM3"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNM3"
FT                   /protein_id="BAC88329.1"
FT                   /translation="MAGTAIRFGTDGWRSIIAREFTFENVTRVARASAEILAETFEGEG
FT                   IVIGYDRRFLADEFARTAAEAVRSLGLSVLLADRPAPTPAFSWAVKKRGAKGALVLTAS
FT                   HNPASYCGIKIKGAFAGSVSPEFTRAVEERLEGPVPADRPRGSLALFDPWMDYLAQLRT
FT                   RVDVAALQEANLAIFIDVMHGVGAGGLPHLLGPNVVEVRERHDPLFGGTPPEPIGRYLM
FT                   PLFQAVRDYRGNRPVVGLALDGDADRIAAADRHGHFLSCQVLIPLLVDHLARRRGLAGK
FT                   VVKTISGSDLIAKVARARGLPVEETAIGFKYIADVMLREPVLVGGEESGGIGYLGHMPE
FT                   RDGLLCALYLVEIVAQTGKDLGALFAQLQEELGFRSHYDRQDLRLADEAFKQRLLGELE
FT                   NSPPKTVAGQAVIEHSAIDGHKFRLADGHWLLVRFSGTEPLLRLYCEGPDPARVTETLQ
FT                   WAERWATGPGVLC"
FT   CDS_pept        complement(411428..411676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0389"
FT                   /note="ORF_ID:gsl0389"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88330"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88330"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNM2"
FT                   /protein_id="BAC88330.1"
FT                   /translation="MALLRGDGGGRGVGEFFDAQPGREAGGATVDVFALRLGLGGMVAG
FT                   AQFGEFGFAVAAAIDFFGPLDFFEGHGYFAFRHSYSA"
FT   CDS_pept        411716..411979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0390"
FT                   /note="ORF_ID:gsr0390"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88331"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88331"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNM1"
FT                   /protein_id="BAC88331.1"
FT                   /translation="MMAVVAGGTPRVCPSIANVYSRSITAMYQAIESYRNFWLLTSGII
FT                   DGATRAVGLHRTVPPLYKGVKIAGILNIAAATVVMAVIEESK"
FT   CDS_pept        complement(411984..412772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0391"
FT                   /note="ORF_ID:gll0391"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88332"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88332"
FT                   /db_xref="GOA:Q7NNM0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR017506"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR040591"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNM0"
FT                   /protein_id="BAC88332.1"
FT                   /translation="MPSTLPREELLKRAEHRDALARVLDLAETALRDWSVVTSDFYSPP
FT                   EVGECLDVFSRLVEVHAAAWGGYSQAERQRIAVSRDNIAIETAAIPLAAVDIRGNFLFD
FT                   AASHRDFLGAILGTGIVRGKVGDILVLGDRGAQTLVAPELVPFLQTSLTSVRTVPVQVV
FT                   PIGFEELRIRPPQTKEITSVEASLRIDAIGSAGFGLSRNKMVESIEAGEVTLNWKTVTQ
FT                   PSKNVQTGDRITLRGRGRLEVGPVDTTKKGRYRVQMIRYQ"
FT   CDS_pept        412876..413154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0392"
FT                   /note="ORF_ID:gsr0392"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88333"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88333"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNL9"
FT                   /protein_id="BAC88333.1"
FT                   /translation="MALEFRPKIAGEAGTLYITKGSTGSTRNHRLVLLPAAKLKVKPQH
FT                   WKRTASPDSFLISSCTRKQSVRDAFQSSKPFAKTLGSFSAYLRRSIT"
FT   CDS_pept        413184..413864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0393"
FT                   /note="ORF_ID:glr0393"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88334"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88334"
FT                   /db_xref="GOA:Q7NNL8"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNL8"
FT                   /protein_id="BAC88334.1"
FT                   /translation="MTAIAIRAYWTFNRQDLSEVDLAEAQIHFDRRLGASGYGWIFPVA
FT                   TQGECVKLNVGVGAWLDELQKINTNVIQLFKQFIQSNQQTRHLLSKAVRQDAPKVYPLA
FT                   TAQKGNRVADGNILKIGDAANLTDLLTGEGIANAVLSGLYVAQAINMSRSSEVAAANWQ
FT                   YLYESHFEADLRAGLQIKAFRKFSWMNTLLIWSMKQNPRVATQVSHAVAGLVPYHQVLP
FT                   SLKY"
FT   CDS_pept        complement(414059..415780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtO"
FT                   /product="beta-carotene ketolase"
FT                   /note="ORF_ID:gll0394"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88335"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88335"
FT                   /db_xref="GOA:Q7NNL7"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNL7"
FT                   /protein_id="BAC88335.1"
FT                   /translation="MPGSSDVDTYDVVIIGAGHNGLVCAAYLLKAGYSVLLLEKREIPG
FT                   GAATTEEVMPDEAPGFRFNLCAIDHEFIHLGPVVEELELEKFGLEYLYCDPVVFCPHPD
FT                   GRYFLAHRSVDKTCGEIARYSERDARKYREFIDFWQRAMGVFIPIFNAPPKSLLDIAGN
FT                   FDGAKLADLFSVIGGPNKTLDFAQSLLTSPRDMLEEWFDLELVRAPLARLAAELGAPPS
FT                   QKALAFGAVMMAMRHNPGMARPRGGTGALVAALVRLVESLGGEILCNQSVRRILVEENR
FT                   AVGVETADGRAYRARHGVVSNIDAKRVFLHLIDPADVDRADDKLRERVERKIGNSNETI
FT                   LKIDLALSEPLRFEHHQHRDEYLIGSILIADSVDQVEIAHSDPAVGKIPLEDPSMYVVV
FT                   PSVLDPSLAPEGKHTAWIEFFAPYQIAGAEGTGQMGTGWTDELKNKVADQVIDKLAQYA
FT                   PNVHKATIARNVESPAELADRLGALKGNYYHLDMTIDYLMFFRPLPEIANYKTPIDGLY
FT                   LSGAGTHPGGSVSGMPGRNAARVFLHEQRPIAETAKDAVKSLSETAKSVYRSLTGS"
FT   CDS_pept        415943..416869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0395"
FT                   /note="ORF_ID:glr0395"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88336"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88336"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNL6"
FT                   /protein_id="BAC88336.1"
FT                   /translation="MAGAIRILLQTTIPETDDDWDIRRFSLLTECLRSLKDENGAPLCE
FT                   VTARNRAAAGGDDPVLSGLGESDFDELWLFAVDVGDGLSAADCAGINGFHRRGGGLMVT
FT                   RDHMDLGCSVCSLGAVGAAHNFHTHNPEHDPERQCIDDIYTTDISWPNYHSGRNGDYQK
FT                   IVPVEPMHELLCRPDAPGDPIEYLPAHPHEGAVGIPEVDGIDARVVARGASLVSGRLFN
FT                   LAVAIERTAHSGRAVAESTFHHFSDVNWDGRYPCPSFVCELPGDTMQTHPRALEDTKAY
FT                   VRNLALWLAPEGVSCQSFQSLEERSAV"
FT   CDS_pept        complement(416900..417700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0396"
FT                   /note="ORF_ID:gll0396"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88337"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88337"
FT                   /db_xref="GOA:Q7NNL5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNL5"
FT                   /protein_id="BAC88337.1"
FT                   /translation="MSTHMDNEDTAKRLPDNHDRLFPGKDLPLLLHLELQNRLEEAITW
FT                   KALGDLEKQNHNLKEAHEYYEKALAHYKENSYQIENFKKRQLSENFHSDEVDIISRYKL
FT                   VTNISELKGRSRSLRILSLMVLLLTIIHAFFPTYTLLAASSSLKIGWPASTMLFYEVYV
FT                   LTLVILAIFLHRGGSRQGKKQYQSISDGLEYYASRLHTKDSNSLLLESESSKQKYSLAD
FT                   VQSILREYLESNSLLLLPEGYGAAVYFVANLLMVVLNVYFVFQR"
FT   CDS_pept        complement(418932..420098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /product="7-keto-8-aminopelargonic acid synthetase"
FT                   /note="ORF_ID:gll0397"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88338"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88338"
FT                   /db_xref="GOA:Q7NNL4"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNL4"
FT                   /protein_id="BAC88338.1"
FT                   /translation="MADPYGWIRADLESLHRVGWYRTTRTHNGLAGPQMDVDGKPVLQF
FT                   ASNDYLGLSGDERLIEAACRAVRLYGAGATGSRLLSGERDVHRELEQALAGWKGCDDCL
FT                   VFSSGYLANLGTIPALVGKRDLVVGDEYNHACLRGGAELSGAVHRLYPHGDCSALESLL
FT                   IEQRERHRRCLICTDSVFSMDGDLIDLARIADLARRYGCMLLVDEAHATGVLGPTGAGA
FT                   VEQLGLTRSLVQMGTLSKALGSQGGYVCGSAELVDYLRNRARSFVYTTGLAPAAAAAAL
FT                   EAVHIARTETPRRALLRQNIARLRAGIDEIGIAQLPSDAAILCLWVGDIEATHCFAGEL
FT                   FEEGIFAPAVRPPTVPTSRIRLSLMATHTEAMIDSLIAALTQVSSRFS"
FT   CDS_pept        420221..420976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0398"
FT                   /note="ORF_ID:glr0398"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88339"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88339"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNL3"
FT                   /protein_id="BAC88339.1"
FT                   /translation="MAPSQQPDLHSPLKHLRITSRFGMRIHPIRRTRRLHKGVDLRAPT
FT                   GTPVYAAADGAVEAAGRQGGYGNAVLIDHGGGWKTRYAHLDSVRVQAGAPVEAGKPIGR
FT                   AGNTGLSKGPHLHFELLHNGRPVDPMPYLQAAAKPSRAASVAAAAKTILERRGYTDAQG
FT                   TRSYRGHTYNFDKEGSRLTVSEPDGRGAILEVDGGRVLTDRVTARDATILGEVRRRLLA
FT                   PPAPERQPSRVPLAVPDRPRPQALEHQPE"
FT   CDS_pept        complement(420977..421612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl25"
FT                   /product="50S ribosomal protein L25"
FT                   /note="ORF_ID:gll0399"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88340"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88340"
FT                   /db_xref="GOA:Q7NNL2"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNL2"
FT                   /protein_id="BAC88340.1"
FT                   /translation="MTIPLTLKQRATGAQPRAMRREGRIPAVLYGHRGTQSLALELEQR
FT                   TAEDLLKRVTINNTILPLKVERGWSGDVLLREVQHDAVGGKLLHLSFFAVAGHGSITLD
FT                   LPLVFTGEAVGVKMDGGLLEKVLTQLTVNTPPTDVPEAIEVDISTMQVGDMLYVKDLVL
FT                   PPGIEVVNTPDLVVAHLTPSPTGRALQSMDAAESAVEQPGEQPATAAG"
FT   CDS_pept        421800..422150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0400"
FT                   /note="ORF_ID:glr0400"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88341"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88341"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNL1"
FT                   /protein_id="BAC88341.1"
FT                   /translation="METETAATDVEKHLEIIDKMIDLRLRLAAIESEIQAVQPEFHLAC
FT                   AAISDGKIETPRATISRRLTAGRWEYSPPIVQMEEDLKRLKKDFQKKHEPTEGREVIWA
FT                   VRLTGGDDLRNF"
FT   CDS_pept        complement(422163..422999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf62"
FT                   /note="ORF_ID:gll0401"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88342"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88342"
FT                   /db_xref="GOA:Q7NNL0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNL0"
FT                   /protein_id="BAC88342.1"
FT                   /translation="MDLAPERGLHLHVGHLDHRWRPGSERDAQRVAVLCNVWGVPFHLE
FT                   IARTPPASEAAARAWRYCWLEQIARGLALERVVTGHTLSDRAETVLFNLLRGSGGAGLG
FT                   SLDWERPLGGGVRLVRPLLGITRAETGAYCLAHHLPICIDESNANLTFRRNRIRLELMP
FT                   YLREHFNPLVEQTLARTGDILHAESELLESLLDEHWHSLVQEGRLHRNTLAALPLALQR
FT                   RAVRRWLSVGLGRQPNFEHIAAVLGCLSAPNRTRTSPLAHSLLVEVQGEWLGLVGG"
FT   CDS_pept        complement(423115..423321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf40"
FT                   /note="ORF_ID:gsl0402"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88343"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88343"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNK9"
FT                   /protein_id="BAC88343.1"
FT                   /translation="MVETVRVNGEERTFAPGTTVSAMLAQLALEPRLLVIERNGDILHR
FT                   QDWEQTTVAPGDRFEIVTVVGGG"
FT   CDS_pept        complement(423314..424414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /note="ORF_ID:gll0403"
FT                   /note="probable thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88344"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88344"
FT                   /db_xref="GOA:Q7NNK8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016229"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="InterPro:IPR041397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNK8"
FT                   /protein_id="BAC88344.1"
FT                   /translation="MAPPAMRWQRVVFGGPGQGSIGGASMAVVEEQVVLRILDANLDRA
FT                   REGVRVVEEWLRFGGGPGESLAECKALRQQLGRFHTERLRAARDTPHDPGTGLEHPDEG
FT                   VRSSPLDVVRVNFARIQEALRVLEEYAKLVQPDLAAAAKEWRYRVYTLESTATGGDLRT
FT                   RLAAARLYLVTSPHPELIEIVEHALAVGLPLVQLREKEAPARAVLDIALRLRDVTLRHG
FT                   ALFIVNDRVDLALACGADGVHLGQEDLPLARARALMGPRLLIGQSTHAPAEAQQAVADG
FT                   ADYLGVGPVYATPTKQGRTPVGLEYVRHCRESIERPGFAIGGIDRSNLEAVIAAGAERI
FT                   AVVRAIMAAEDPGRTTAWFLERLNRG"
FT   CDS_pept        424535..426457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0404"
FT                   /note="ORF_ID:glr0404"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88345"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88345"
FT                   /db_xref="GOA:Q7NNK7"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011459"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNK7"
FT                   /protein_id="BAC88345.1"
FT                   /translation="MTMKFSDTVVRRLVGWTLALSLLGTASASVVQAQADLERDLSMTY
FT                   VDAVNGDDSTADGSKQKPFKTITRAILGSPPGVTLQLAEGEYSEATGEQFPIQLAMRNL
FT                   VGNEATKGQGIKIVGGGKHVSPTFASQDATIVVGKEVTIRGVTITNPRNRGKGLWIESV
FT                   SPVIAHNSFIGSLHDGIFITGASSAKVADNYFSGNIADGLTAADQSTPLIENNIFEKTG
FT                   FAINVTGRSRPQIVGNTVRDNVDGIVIEGRSFPKLRNNTITGNRRSGVVVVLLASADMG
FT                   TESEAGNNTFGGNGRADINNVTRPALPLVALGNKWDKPRLEGQVTAEAEIVALATRNVA
FT                   PNVGFWVLVSNGKPAQLRAIKGLALKPKSQTHEGKPYQQVGTFGSQASADKLVEQLSKK
FT                   GFNAIAVPAGQPTGSNLATSKPTKPTISQAPAKPPAAAATAAKPASAPQVTAKPVAPAV
FT                   VAVKASPTTPPETPITKPGPLSPGAPAVKASPATPEAPVAAQVSPLPPIAPKASPVSAT
FT                   PVPAATTPAASATALASPVLRAPAAKPAADTAAAAGPTTATPGETVAAKPATGLAYRVL
FT                   VTDSGSADLDLLKELVARVIQQMYEGKPVLQVGVFSSEDNANRLVQTLSDKGFRAILVP
FT                   VNQPG"
FT   CDS_pept        complement(426531..426827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0405"
FT                   /note="ORF_ID:gsl0405"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88346"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNK6"
FT                   /protein_id="BAC88346.1"
FT                   /translation="MESLQEKVDGLYGRLEQLQAALETLPEQMIIALKSNNTPGPVAIK
FT                   DVLPEEEMTSRPPSANGKTLSPEAQIQRLTAQLTAAYNRIAALEDQLMARRSL"
FT   CDS_pept        427048..427881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /product="prephenate dehydrogenase"
FT                   /note="ORF_ID:glr0406"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88347"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88347"
FT                   /db_xref="GOA:Q7NNK5"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNK5"
FT                   /protein_id="BAC88347.1"
FT                   /translation="MKIGIVGLGLIGGSLAHDLGRHHEITGVSRSSATVAEALSQGLIR
FT                   QGGESLGLLGSCELVFVCTPIGLTLETIRALAAVLPPETILTDVASVKAAIVPAAEALW
FT                   PNFVGGHPMAGGEAQGLSAARAGLFRGRPYVLTPTPRTPAAACTALEDLVGELGARLVR
FT                   TDPETHDRAVARISHLPVFVGAALLLNLAASGDPTASTLASSGFFDTTRVGGGNPQLGA
FT                   AMAEWNRAALLAELCSYRDHLGRLEQAIAAGDWQAVEQRLGECRKTRREVCEGGI"
FT   CDS_pept        427910..428590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /product="amidotransferase"
FT                   /note="ORF_ID:glr0407"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88348"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88348"
FT                   /db_xref="GOA:Q7NNK4"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNK4"
FT                   /protein_id="BAC88348.1"
FT                   /translation="MARTPNIALVDYGVGNLHSARKGLEAMGARVTLSGQPLTLSAADG
FT                   VVLPGVGSFDTAITRLNDRGLGDAIIQLVRAGQPMLGICLGLQVLFDSSEEGRLPGLGL
FT                   LPGRVRRFRSEPGLTIPHVGWNQLHFDNVDCPLWRDLAAGGWVYFVHSYYVDPARAEDR
FT                   AASAVHGSQHFTAAVCRDNLMAVQFHPEKSADTGLRILKNFVERAASRSAAEVAARCAT
FT                   RPPA"
FT   CDS_pept        complement(428571..429029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0408"
FT                   /note="ORF_ID:gll0408"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88349"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88349"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNK3"
FT                   /protein_id="BAC88349.1"
FT                   /translation="MPRKWFATAVLAATALAGCQSSADGPTATLGNQNIGTPMAPGGER
FT                   RLTLPPTQYERVHFLGRPGQKVQVVVEGPGAAPLSLSIFPVVATGEAGRFANAPKDFAL
FT                   KPFQRTAPLPLSAEVVLPAGWKSTDAVVVELKNIGGTVAEPTLKLEGE"
FT   CDS_pept        complement(429019..429627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0409"
FT                   /note="ORF_ID:gll0409"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88350"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88350"
FT                   /db_xref="GOA:Q7NNK2"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNK2"
FT                   /protein_id="BAC88350.1"
FT                   /translation="MVRANTPWLTTLAVLVAAYIVAALLETVTLILFRGHLQGQRLGEY
FT                   YGYASLACLGLVLSAPALGRQLLLSWRRGLGLSALGFAAAHTYLTFEHVLGGHWEALDF
FT                   LGGEERLVAWLGVAALGLMLPLALTSTNGWIRRLGRHWRTLHLLVFPVAGLALVHAVWL
FT                   GASGWPLKVLTLLAAAVVLLLRIRPRPKRLARKEHIDAS"
FT   CDS_pept        complement(429655..430371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ho1"
FT                   /product="heme oxygenase"
FT                   /note="ORF_ID:gll0410"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88351"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88351"
FT                   /db_xref="GOA:Q7NNK1"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNK1"
FT                   /protein_id="BAC88351.1"
FT                   /translation="MEPLSIMLREGTRQAHTMAENVGFVKCFLKGTVERSSYRQLMANF
FT                   YFIYGALEDALEAHRDHPVLRGLYYPELYRRASIETDLRYYYGPGWADQVRPSAAAERY
FT                   VERIRTVARTEPALLVSHSYTRYLGDLSGGQVLKEIAQRSMGLGDGTGTAFYDFETIAD
FT                   ARTFKAGYRAALDTLPVDGPLAGRITEEAIEAFRYNMRLFEELEGSLIRAIGQMVFNSL
FT                   TRRRSRQNREVVTASE"
FT   CDS_pept        430659..431042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0411"
FT                   /note="ORF_ID:glr0411"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88352"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88352"
FT                   /db_xref="GOA:Q7NNK0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNK0"
FT                   /protein_id="BAC88352.1"
FT                   /translation="MGAVAGKELLQLIKQNPGRSAKQLAEMAGYTTTTKTGQQRVKMLA
FT                   FQNAVLQANNINLRPVEEEQTNGVRGGRKATYRIQVQQNGNLLIGAAYTRQMGLTPGTT
FT                   FEIQIGRKHIKLVQVDTDGAPLE"
FT   CDS_pept        431172..431939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0412"
FT                   /product="methionine aminopeptidase"
FT                   /note="ORF_ID:glr0412"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88353"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88353"
FT                   /db_xref="GOA:Q7NNJ9"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNJ9"
FT                   /protein_id="BAC88353.1"
FT                   /translation="MALLEIKSTREIAKMREAGRIVATVLKEIMALAEPGLTTGDLDAH
FT                   AERRCADFGVIPAFKGYHGFPACICTSINHEVVHGIPSAKRRLKPGDVLKVDFGAIYDG
FT                   WHGDSCVTIGLEPLAEEARTLIRVAEEALLKGIREVRQGVHLQQVSGAIQDYVEGYGFS
FT                   VVRQYVGHGVGRNLHEEPQVPNFRTREIPDPKLKSGMTLAIEPMVNLGHHATRTLADRW
FT                   TVVTLDNSLSAQFEHTVLVTRDGYEILTDRSKV"
FT   CDS_pept        431960..432181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /product="translation initiation factor IF-1"
FT                   /note="ORF_ID:gsr0413"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88354"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88354"
FT                   /db_xref="GOA:Q7NNJ8"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNJ8"
FT                   /protein_id="BAC88354.1"
FT                   /translation="MAKQDVIEMEGTVVESLPNAMFRVELDNSFNILAHISGKIRRNYI
FT                   KILPGDRVKVELTPYDLTKGRITYRLRK"
FT   CDS_pept        complement(432198..435017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /note="ORF_ID:gll0414"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88355"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88355"
FT                   /db_xref="GOA:Q7NNJ7"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNJ7"
FT                   /protein_id="BAC88355.1"
FT                   /translation="MNWDTPIDLAAAGSPSALSHQSLRDNIELVEQLLRQVAAQEGGGD
FT                   LVELLDRLWASHQDRTGEGLALIRELSLEKSVLAIRAFSIYFQLINIVEQHHERKRLRL
FT                   QASFSADTAQPGSFCWLFDEMKSLGVSTPEIERVLQQLDVRLVFTAHPTEIVRRTIRTK
FT                   HRRIVHLLDDLDNALSEWQQQQVHTTMLEEIRIWWRTDELHQVRPTVLDEVAHTVHYFE
FT                   EVLFEAMPRVRSELVRCLDMFHPSLTRSLGTFCRFGSWVGSDRDGNPSVNALVTWKTAC
FT                   HQRSRVLAKYIKSVERLRDLLSLAEGNPPQDLLLALEQDQRDLGEVYERYSVVYLQEPY
FT                   RLKLSYILERLEHTRERNAWLEVHGPQRLSQPDEPGWLHYYRHAHELLAELHLLRQCLR
FT                   TTGIGCRPLETLIDQVEVFGFHLAGLDVRQDSTRHEDTLTEVSAKLRLTATPYAELDEQ
FT                   ARLEWLVRELQTLRPLIPAELPFSARTEETIQTFRMIRRLQKEFGSEICHTYIISMSKQ
FT                   ASDLLEVLLLAEEAGLFDPATGTGTLMVVPLFETVEDLRNAPHVLEQLFSLPLYRCYLT
FT                   CHQNLQEVMLGYSDSNKDSGFLSSSWEIFLAQQHIQQVARRHGVQLRIFHGRGGTVGRG
FT                   GGPSYQAILAQPDGTVSGRIKITEQGEVLASKYSLFELAAFNIETVTAAVIQASVLPTS
FT                   PPGSRNWELRLQELSDVARRTYRQLVYEQEGFIDFFCHVTPIDEISQLQISSRPSRREG
FT                   RRDLASLRAIPWVFSWTQSRFLLQAWYGLGTALDGFIRCNRERNLAELRSMYRQWPFFR
FT                   TLISKVEMTLAKVDLQVAANYVQELLPKEHEHTGECIFALIAAELERTRECVLAITEHR
FT                   QLLEDNPPLQRSIALRNATIAPLGYLQATLLKYLRYENRQPRSYSRNELLRGALLTING
FT                   IAAGMRNTG"
FT   CDS_pept        complement(435150..437000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0415"
FT                   /note="ORF_ID:gll0415"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88356"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88356"
FT                   /db_xref="GOA:Q7NNJ6"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNJ6"
FT                   /protein_id="BAC88356.1"
FT                   /translation="MLTMRHAYVSLGLAGVLGLLAVVAQPASAEMPTTSVNDLSSPSLF
FT                   GQRGRSTAQVNSVSELTDVDPNSWAFQALKSVVERYGCLEGYPDKTYRGNRPLTRYEFA
FT                   AGLNACLEKVNELITASTANLATKEDLATLQRLQEEFRNELAALRGRVDALEAKTKEIE
FT                   SKLFSTTAKLDAEVIMAANIQGGDVNYNYVDGAGNSQGFGGQANANFITRTRLNIRANS
FT                   LITRGDQLRVRLNGRAGESTPFTSRQGRVARVDYAESTGGPLDGRSAVDFDKVYYDFPL
FT                   SLFGGTNNLRIRFGPRIENIDLLGRNKFTQNEGQQFSFRNFRKDPLLIQIQESSHPGAH
FT                   IDLRFSRQFALRIFYAARDGGSAGGIADEPGNVPFGGSGLFGGSTQIAAEIGFQPTPSI
FT                   DIGIGYSYVNVSSAGGSTGFIFGDASGSGGGDGRLRYDAGNVSNVGHNIFNAHVDWDIL
FT                   PQVAIFGRYTFANSNFYGYANGGANGVNVGGSLDSNTWMAGLAFPDLFGRGNALQVAYL
FT                   QPIQISNNGVIAFPTEGSNPSDDPRGAQNVFEGSVNPITGVVSGLPFNRTGTEGNVAVA
FT                   YRFRVSDRLSLTPEVLFVINPNNVNQNGLTVGNVRATFEF"
FT   CDS_pept        complement(437071..437958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtE"
FT                   /product="geranylgeranyl pyrophosphate synthase"
FT                   /note="ORF_ID:gll0416"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88357"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88357"
FT                   /db_xref="GOA:Q7NNJ5"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNJ5"
FT                   /protein_id="BAC88357.1"
FT                   /translation="MSQFDLDAYLRQCRSQVEAALDRYLPQQYPDKLYEAMRYSLLAGG
FT                   KRLRPILCLTSCRMSGGSADLAMPTACALEMVHTMSLIHDDLPAMDDDDYRRGKLTNHK
FT                   VYGEDMAILAGDALLAYAFQLIAEKTVGAQPERVVEVLGRLGKAASGAGLVGGQVVDLE
FT                   SEGRTITLETLEYIHTHKTGALLEVSVISGAILAGADGGVVERLTRYSRCIGLAFQIRD
FT                   DLLDITATQAELGKTAGKDLRDRKATYPSLLGYDGARDRAEQLREQAVAELADFGASAR
FT                   PLTALAEFIVQRRH"
FT   CDS_pept        complement(437995..439530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0417"
FT                   /note="ORF_ID:gll0417"
FT                   /note="probable sugar hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88358"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88358"
FT                   /db_xref="GOA:Q7NNJ4"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNJ4"
FT                   /protein_id="BAC88358.1"
FT                   /translation="MANLPGAAQLNLKEAIGQLLVPRISGFLLDHQRLYPQWELDAARL
FT                   EAAIVTHGVGGVLVYGGSLGDTFLKIQALQQQAALPLLVAADLEAGCGQHIRGATVLPV
FT                   ARALGAAAEADYAYHCGAITAREARSVGINWVLAPCLDVMSNPRNPVIGLRSFGEDPRE
FT                   VARLGVAFAAGLRDGGVLSAIKHFPGHGDVEVDSHLALPVLGRGRDRLEAEDWLPFRAV
FT                   LAAGADSLMSAHLRVPALDPEWPATLSRRILTEIVREGWGYTGIIVTDALNMGAIAGWP
FT                   APAVRALQAGADVIMMPESVPDTVDLIVSAVRRGLLSEERLYASVERVLAAKARLAPPS
FT                   ASPLAIEQRSGQALERMIAKAAVTVERDRAGLLPVPCLKPTLNILVVDRCLDGAVAADS
FT                   PILERRELGPHYETHWLEAASGEEYLAFLGERAAAHRRTLVQVLTPVRAYRGTAGVHPA
FT                   AEHFLQSLAGERTILVSYTNPYLGRQFEQLSTVLNAFNNGPASHAAVLERLES"
FT   CDS_pept        439564..440721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0418"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="ORF_ID:glr0418"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88359"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88359"
FT                   /db_xref="GOA:Q7NNJ3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNJ3"
FT                   /protein_id="BAC88359.1"
FT                   /translation="MSQGERCHNRGGRHARGEGAVWPWLAVGIASGALLGALGTWLALR
FT                   GSIAIYRALLEAAPVAYVLLDSQNRLIAASSLAGRYLELPAIGLPVVELDATLMDLVLQ
FT                   ARRGMTVQQRNVGLKTVRGDWMVGALAVPLPGLRVGLYLDDQSAVAQLLQQRDRWVGDA
FT                   AHELKTPLTSIRLVAEMVLPRVGPDQQRWLERLLGEVQRLNLLVQDLLEFSRWQAGRTQ
FT                   LNFKEGVDLVQLVEQTWATLEPLAERRQVRIEIDSPASVNVCADEERLYRALLNLLDNA
FT                   VRYSPKGEAFWVRMRSQPDWVTIEIIDGGPGFPRQDLDRVFERFYRADPARARQTGGTG
FT                   LGLAIVRQIVEAHQGIVKADNHPETGGAWLSVRLPVRPVPTATVR"
FT   CDS_pept        440830..441216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0419"
FT                   /note="ORF_ID:glr0419"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88360"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88360"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNJ2"
FT                   /protein_id="BAC88360.1"
FT                   /translation="MDGSYSAESNVQDQMQQCIDLCLKAHDLCLASAMRRIELGGEAAG
FT                   LAPVRLLLDCAELCQTHANLMSRRSEYHARLSPICAAVCEQVAAHSEMAGDDPQFQACA
FT                   EACRRAGESCQKMTYADSSLGATV"
FT   CDS_pept        441240..442100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0420"
FT                   /note="ORF_ID:glr0420"
FT                   /note="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88361"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88361"
FT                   /db_xref="GOA:Q7NNJ1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNJ1"
FT                   /protein_id="BAC88361.1"
FT                   /translation="MSQSQQLQPPQQQERQPGLESEMTPKPQADDPKYRGSGKLQDKVA
FT                   LITGGDSGIGRAVAIFYAKEGADVAVLYLDEHDDAKETCRLVREIGQRCLTIAGDIGDE
FT                   SFCRQAVAQVVDEFGRLDILVNNAAEQHPQKSIEDISAEQLERTFRTNIFSFFYMTKAA
FT                   LPHLKPGSAIINSTSVTAYKGSPQLLDYSSTKGAIVAFTRSLSQALLEKGIRVNGVAPG
FT                   PIWTPLIPASMSPERTASHGSSAPMGRVGQPEEVAPSYVFLASDDSSYITGQILHPNGG
FT                   EVVNG"
FT   CDS_pept        complement(442090..443661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="ORF_ID:gll0421"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88362"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88362"
FT                   /db_xref="GOA:Q7NNJ0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNJ0"
FT                   /protein_id="BAC88362.1"
FT                   /translation="MERIYLYDTTLRDGAQREGMSLSVEDKLRIAHKLDELGVPFIEGG
FT                   WPGANPKDDQFFERLHSTRFKHSAVVPFCSTRRPQVRASEDAGLRKILAAGTEWVTTFG
FT                   KCWELHVHEGLRTSLEENLAMIEDTVAFFRTQDRRVIFDCEHWFDGYYKNPEYALAALR
FT                   AAAHAGAQWVVLCDTNGGMLPQQIRTSVEAVRDYCREHNLEVQLGIHTHNDSETAVANA
FT                   LAAVEAGARMVHGTVNGYGERCGNANLCALIPNLQLKMNYALIAPEQLARLTEVSHFVS
FT                   EVANLAPNDHAAYVGASAFAHKGGIHVSAVQRNPQTYEHIVPESVGNRRRIVISDQAGL
FT                   SNVLTKLTEMGFSFERHDPAVGRILQQIKLLESEGYQFEAAEASFELLVRECLEIRKSL
FT                   FSLEGLYTACQTFPDGTVRSEATVRVRVGEVLQHTAADGNGPVSALDAALRKALVGCYP
FT                   QVAGMHLVDYKVRILDSAHGTSARTRVLVESSDGLGRWTTIGVSANIIEASCRAVIEGI
FT                   EYGLSR"
FT   CDS_pept        443837..445105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0422"
FT                   /product="serine/threonine kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="ORF_ID:glr0422"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88363"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88363"
FT                   /db_xref="GOA:Q7NNI9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNI9"
FT                   /protein_id="BAC88363.1"
FT                   /translation="MPFTSGALVQDRYLLERQLGSTGARQTWLVQNSATGQALTLKALY
FT                   FGTGMDWRNLALFEREAQTLKSLDHPRIPRYHEFFQWQQPEGDYFCLVQDYIPGVSLAE
FT                   QVHSGKRWSEAQIEQAALEILEILDYLHSLAPPVVHRDIKPSNVICGEDGRLYLVDFGS
FT                   VQAEQVSGRTVTVVGTYGYMAPEQFGGRAVPGSDLYSLGATLVHLATGMNPADLVDGGF
FT                   HIRIPEQLPLSPGLRHWVEKLVDSDPERRFKNAREAISGLRCKDSLAHPSETTYQGRIA
FT                   LRPGRERFCVEVAAREPAFEDILTGFACFILFVIATASTHTLKVLEPGDGLTVWIFMVL
FT                   LTVGFWGVLVFTASNTLLRLLCCTCLEVDRELFTLSHWILGKRIFNKSGRVMALLGKQR
FT                   LSFDLTTAEHHLILAHVQRWLNR"
FT   CDS_pept        445483..446085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0423"
FT                   /note="ORF_ID:glr0423"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88364"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88364"
FT                   /db_xref="GOA:Q7NNI8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNI8"
FT                   /protein_id="BAC88364.1"
FT                   /translation="MRMSSMQKASFVLAIAVLLMPPARHWSIWPQADFLTVLLFPSVFF
FT                   VPLLFLIWAFGWFGPLRQSSPGGAFLVIWLACTLLLYVFCFLFPWASSIAPLSSTAACL
FT                   RVATTVAAANGALILVLRLLGAPLNVLTVSVPAFLITATGLLFVPLSVSETYLRSHIAG
FT                   NLWPAAFGGALISYMLTVQSAAHEHEKRHHPNIKLPG"
FT   CDS_pept        complement(446288..446455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0424"
FT                   /note="ORF_ID:gsl0424"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88365"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88365"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNI7"
FT                   /protein_id="BAC88365.1"
FT                   /translation="MRDQFIPIDTCVQSHLLFIAALRRALAIEQPLPLRPPARMHDRRP
FT                   RQPSPRAVEH"
FT   CDS_pept        complement(446649..448322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0425"
FT                   /note="ORF_ID:gll0425"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88366"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88366"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNI6"
FT                   /protein_id="BAC88366.1"
FT                   /translation="MPKYNSKPNITLDGMSAEDTDQLVISTQQICVEESLHLPDAFTLI
FT                   LHNPFTPGRMRDIHHWINHPALKVGAKITFGFRAATTTAPEFMADNALPKLLVGEITGI
FT                   ETHFTEDPSAPMVLRGYDMSHRLHKGRFNRSFVNMTDSDIVRKIVAEVGLQAGGEIEES
FT                   GIPHDYVFQENQTNMAFLRERAARIGFEFFVQDEQVHFHRPRQIEPVQLRWGVRLNAFR
FT                   VRMSTAEQVSSVEVRSWDYIEKKTIVATAQSEQVVTKTGYEPGSSSNSQFDLQPKLVVV
FT                   DHPVFNAQEADTMAQAICDEMGGEYIFADARAEGEPKVRPGRLVQLTGLGEKLTGDYYV
FT                   TDARHLYHDLVYTTEFSVRGTRGGNLMTGLSPQPKLKPGQTNLVGIVTNNKDPEGMGRV
FT                   KVKFPTLTEEHESNWARVVGPGAGPKHGIYWMPEVNDEVLVCFEHGDIHRPYVVGGVWN
FT                   GKDDTPETVDDSLTPVKLRTMKTRVGHYLRFADEDTPPDKKGIYIRTADNYQIQINETD
FT                   QFMELRTPGGCFIKLDDATGSITIEAPMTVTIKAGQVFIN"
FT   CDS_pept        complement(448365..448931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0426"
FT                   /note="ORF_ID:gll0426"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88367"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88367"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNI5"
FT                   /protein_id="BAC88367.1"
FT                   /translation="MTLVKAQLVPQEGGGSTITFLYNPSAISFTRTVEWKENKGSVGNN
FT                   DTLPSTDYKGVKPYQVTIENMLIDTYESRSSCQSYIDALKDAVSPKQVSDATAGADGAA
FT                   DGGLLNRKRPLVYMFTMGSNIQLRCVVTTLTYNYTMFLPNGDPVRAMITLKLQEVDDIA
FT                   AGSQGDNAGAANRQTDSRSARTPTG"
FT   CDS_pept        complement(448965..458798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0427"
FT                   /note="ORF_ID:gll0427"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88368"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88368"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNI4"
FT                   /protein_id="BAC88368.1"
FT                   /translation="MEPQPSLSDFSVPLGMSAPASEPETLAPELVSPPEPLGQDIQLPQ
FT                   ALIAPVGASPMAAADLTALIPEGIPGYDRPQNPFEGWPFQAPEPPELPPLEVPEPLAPG
FT                   QMSLEEAMAADASNRNDDRRGEDPRREQQEERTVELPRYQPGELGELGDEFEPPEALRF
FT                   APEPDDDLPAAADLPPPAAALADFTSADDPEALSAEYLSQVPESPVAEVPGDTLENPLD
FT                   PAEHSQQPEAFSPPEEALQAYNALSPLPPTEQLFPSTAAQDPLVPPGSPPQAVPGAPEL
FT                   SGAGSAEGSGPSLGTGDPRSLFSLEASFAAEPGSTPFVAGNLNPPFPGDASALVPPGGP
FT                   GQDVLPAVDPPDTAAQEFLSLEDRFVQEGFLLPDQLAAPEILPDEILPELPSPELLEAE
FT                   VPPPPDGLPTAAVDLAASPPTDNGEPLLGEAESLIPAVDPEAAEPTMQPSILEAAADGT
FT                   ASPFAGYPPELLTGAHGSPVGEGPIPPVDFFSAPDEGSLPPSVAEPFAQGDELASTGQP
FT                   GMIPQPEPLGAQSQPREQSDPAIEPQSIAQAEPLSAATATPSEWPEAEPSLPAAPAEIP
FT                   FLEQAEPFYADESAPESPPGDGTSPVADAEEAFPVPPLIPQATDPAADFPLPVEPVMLT
FT                   PSELPGEVTASEALRATASSEGEPQRYVPPDDAGASAFSSGVPEFSTLPPESESSVEAP
FT                   GLDAPVETLEEVAFLPTQDELADNEPVEFVEPLPVVSEMESEAAPEESVESVPGPEDAL
FT                   IREVGGGGQAFGAPAGEAGIADTSLLSTETSPQVFPSPATPDEIGQSAADTAAGREAEM
FT                   PPRLQDPELPESPLVSILDSQTVAEQPTVVESDPQPTTGSEPQEFVPSAFEAASRSPSE
FT                   AQIFQPEPLADPGVPLREEPSIEPAVLSTAESINAGDLGETSESPFVALEEQFPREGLP
FT                   ESVLPAAAEPFVPADIPAPSSGGELQIPIGDEQPPAAFYEAAGLTAQPLQAQMPTRPEA
FT                   SGEPMPPEGFAAQVEPSMLESLAPEPSPIAEISSPTGSESIAVPQLSLPEQPAAEPDLT
FT                   VPLELPLDDETTAEQVAQAQASELSGETPALSLPQTVELSGQSESLLSFETQAPGEAPE
FT                   VSFPVETETVESAGKSDGSVSSLEAVESIGELEPFSVLEAEASEPSGQSDTFLSPVTTE
FT                   PTDETLSVGMPASQLGIPGGESEIFALQEAETAAAVPEATLLSALQGPPAAEALGAQPE
FT                   AILPLEGQDPQATEFLETAGEPVFVSLEAQFSREQPPGSEPVAGLTAQTPERLAQPQAV
FT                   GETTAEVAEWFAPPEAIETPTEAPESLAQPEAFAEGASEVLDLRSQPQAVGEGGVFDEL
FT                   DPLADRPPDLLGRLQPLSEQALPEQSGASLLERPEPLGEAQPLTPQEPLAETELAIPLE
FT                   PPSATASTDDAVPFARLQTPEEFQPSEAPLRQTDSPIEPTADELEPEYEALVEAGLETQ
FT                   PVAVPTPELAAPALDVSEGEFFSEPLLQAEQAELPPQPEPLSALSAFTEPEEGFAPSPT
FT                   AEVAAVAPELAAAAEPTSDDEIAVEEVVAFQPPELPGEPDDFLPLQPAELSGQPEALLS
FT                   PPLEALEPSGGPETVASIGDGDLDAVLPPPEAAAAGGEAGIIPQPERTVVIEPSEPDSP
FT                   SPSLEPQAAEFLETAGEPVFVSLETQFTHEHPPGSEPVAGLTAQTPERLAQPQAVGETT
FT                   AEVAEWFAPPEAIETPTEAPELLAQPEAFAEGASEVPDLHSQLEAVGGGAVPDGLNLLA
FT                   DRPPSEQASPEQSSATASTDDAVPFARLQTPEEFQPSEAPLRQTDSPIGPTADELEPEY
FT                   EAPSLEEQFAQEQEQPTSTISVDGTAVAQEAPDTEVGFTEQVTWTPPEVLDPVESVMPP
FT                   AEPLLPAEESVPSEVGVIEPSAEPAVQLEPQAVEPEALISSGLPGEVLTFGEETVAPPE
FT                   ALVEAGLETQPVAVPTSELAAPALDVSEGEFFSEPLLQAEQAELPPQTEPLSQSPPEES
FT                   PAQPWIPLEEQFVGEELPESQSQVLPDEASAVTSPAEVPGEGQETPELTFAALEDRFSQ
FT                   EEGFEPGMFTAEPPVASEDPSINLELPLETVQSELPAELPGPPQSTDGLPQTVVPTGTA
FT                   IEQATAAETAAAAAEPFGPSLEGDSALFEEQPIEPEAQELPLSALSAFVEPEESFAPEP
FT                   TAEVAAVAPELVAAAEATADTEFLETAGEPVFTSLEAQFSREQPPGSEPVAGLTAQTPE
FT                   RLAQPQAVGETTAEVAEWFAPPEAIETPTEAPESLAQPDEISEGAFEATELPAPTQAIG
FT                   EGGAYDESDPLADTPADLLGPPHPPGEEAPPEHSGTLLLEQPEPLGQSADEPESILPAE
FT                   ALGELEPLAVSEPLGELELLGQPEPLSEAQPLSSPEPLGEGGSIAPELLIAQDAPVGGA
FT                   SEEDLLSLEEAFVDRSAAPAATESAAAEAVALEPGDSATPATEELPPAVARGVEPSLSV
FT                   SQPTFESSAPLPQAELPEDRTAGEHPEPIHQTAPETVYPELLLPERGDGQAGLEDLPPA
FT                   PTAVSPGQEAPSLEAPLVTEAPPVAELPVQSEDAAEPAGLTGELPEISAEPEWRQDAQT
FT                   LPIGESQAEETESADGPAVAGREETFEIDELAAATEGSLEPLGAAFDLGAFPGLQTQHL
FT                   GSSDPLGSTDYLGVGSSAALLLPSVVQDLTVLRSLVEDEDDLAATLPDGPELPALAAIE
FT                   ADLTPVDLVPAVEPDLPPLSEREIWPGWSGDRSTPDPTALEALPVDGEAADDRSESPLG
FT                   VARDLTVLRSLSEAALPLEADGIVSASPAFALPDEQSETTEIEPTRPTIDDTQEIPDAD
FT                   GAFDPALRTDEPAPEDDPVAAEGPLGVAQDLTVLRPLAGDGFSPTVAQDLGVLTLLGVA
FT                   AGVFATAGSEAIDPVEYGPLLYALAEQAEGPLDEADGGLEALLTPLDATVPEPLPLESA
FT                   AGRSAAADTATSRPLGMDVQPLGVPEVPALGLETAVPLASVADLQDFDADLPEADLEAP
FT                   TLPIASERTLGQGPLLFAAQLLADQQPEEDAEEEPEVPPDDVALQSDFAQQEPDGFSGA
FT                   GEDEMEVEPLVLQEYLLQLEARKNAEEEDEEEEEEDGGGSDLPTVAGEAAALSGAASAP
FT                   LLFAGSGALTDALGGRDHQIPDNWSDIEELLTVSAAEIGLGTTLPADTGSSSSTGGGGG
FT                   GGGGGGGGGGGGGVPEAASTYSGYMGDSMEQVLLSGQLPAHVPPPAGAAAAAAAAPGDP
FT                   EEAEEEGEGENADLEMLAQEIYGLLRQRLEVERERSGHHYLGRMPW"
FT   CDS_pept        complement(458801..459331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0428"
FT                   /note="ORF_ID:gll0428"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88369"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88369"
FT                   /db_xref="GOA:Q7NNI3"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="InterPro:IPR011747"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNI3"
FT                   /protein_id="BAC88369.1"
FT                   /translation="MAQNGNVVHELNYVLPNRFYVEIDSELTASFMQCSGIGFTMKKNS
FT                   YAEGGVNEQERIYLGPVTYSDVTLQRGITDSLTFWEWAYGSLDPATPTKRRNINIVLFN
FT                   QAGETMQCWTLIGAVVTGFKGPQLMANLPAQNATAAIEQVIVSYEGLRIQRSGGGGAMM
FT                   NLTRDASGYFGSN"
FT   CDS_pept        complement(459331..459606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0429"
FT                   /note="ORF_ID:gsl0429"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88370"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88370"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNI2"
FT                   /protein_id="BAC88370.1"
FT                   /translation="MDFNSKPPQLETRFHASPVQAPAAQAHSAAGTAAGAALQTRNKQK
FT                   LALMLQAGKVLKSHLVMRRLSDRVYELMRDELDRHRERGRDYGGHF"
FT   CDS_pept        complement(459704..460339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0430"
FT                   /note="FraH protein homolog"
FT                   /note="ORF_ID:gll0430"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88371"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88371"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNI1"
FT                   /protein_id="BAC88371.1"
FT                   /translation="MAAPKCPNPQCEYFNRTLPNTAQVCPMCGTPLGNVVRSGSAAPVA
FT                   AAPPPPPIVSPYQQPAPPPHVYAPAAPPPAYPQPAPAAYPQPPVAPAAAPPASQGRPTL
FT                   KLVHALIGREFAAPGDESYIGRRGGTVKPAPEIDLTGIPNDQVISRPHACILWDAAYAT
FT                   YTITDNNSRNGTFVNGQPLTPGVSYQLVDGDTLQLGRENLVQFKVAIA"
FT   CDS_pept        complement(460351..462441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0431"
FT                   /note="ORF_ID:gll0431"
FT                   /note="probable serine/threonine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88372"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88372"
FT                   /db_xref="GOA:Q7NNI0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNI0"
FT                   /protein_id="BAC88372.1"
FT                   /translation="MQLFETSYKAYRCSRNMPLNCDVLVQTAQQIPGAKFCQECGFPTL
FT                   LAEKSEIRGTRGTYRIVKFVGTRGMGRLYQAIQAGDNQPCVVKEYLLPSRCFNKAETRQ
FT                   RKDAFKRVAGLLPADGKNQDFRLVSPWEAIADEQGERCYLVTKGALEASPTLARHLAES
FT                   GPMNAAQVRSVLNQVLQSLQFLHSQKFRLPSGQVQPGLAHGHLTLDSLLISRGGAQFFV
FT                   YVCDLALWEQLFDPPPAVADEPLPEHDLIALGYVAYFLLTGQLVNPATGGYFDPRDPQQ
FT                   WPAVEPRLQEYLYRLMGLDVPFETAEAARAALLKLPGEEQFAAVSAPVEYDKKDKANLT
FT                   LFALLAFALLAMIAGLLFIFWPQLERWFPKPPQIDTRVASFAEVSGVPEGTFSYAAERD
FT                   GTWSYLLQGKPADDQRLVDLLTEPRARVEMRFAPVVSPKIDTESEAVRLVQLIRTDFAI
FT                   TSLTEDLSDELESKPIAIDGLVVYVAFSKKPRNLPNALGGKISLENLQKLYTGKVRNWK
FT                   DLGGPDLPVRLFAPTEPEAVRMFERLVLGNDPQRVATFRSLATVLPTKETQRLVLPEFD
FT                   NNRSGIIAFSTLVKAFDQCSGYPLALDQGKGEIQPLVQTDPRFDGRPIHPNVNLCAKAF
FT                   RLDAGAFTQRRYPLGFPLAVVYPRDNSRPTSGLKFAELLTTRQGQQYLEKLGVVPLPLS
FT                   NK"
FT   CDS_pept        462585..463721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0432"
FT                   /note="ORF_ID:glr0432"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88373"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88373"
FT                   /db_xref="GOA:Q7NNH9"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNH9"
FT                   /protein_id="BAC88373.1"
FT                   /translation="MHITIECLTGSLAGKVLAFDQEEISLGRGEQKEKDIDFADIDIGV
FT                   SRNHGLIAIRAGRVVFTDASRGGTLVRGQRVNNDSVELRSGDELQLGGPSGPRLRVRYR
FT                   ALTQIVEPGRMHTQMPDPPETLIDLPPAPLPPPRPVAAPLPPVAAAMPADATAIQPPSA
FT                   PPLPQITAQPAPSPNGTAPLPLPPVSTPPPPSQQQTMLQMPPAPSPSAPTVPPPPRPAV
FT                   VPAPSAQAPYVPPVPPMGGETFFQQTVDPDATVYHPQAPSAPPVPEETFFQSFAAPSAP
FT                   SARPAPAAPNANSYIPPEQQTMLQTPAPVIDSNPTLLQEPAQFPWLLVTLFALGVLALL
FT                   AVIWVFLLRQSVAFFIPVPLVLLLGLGWFFYQSRKAAG"
FT   CDS_pept        complement(463718..464170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf41"
FT                   /note="ORF_ID:gll0433"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88374"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88374"
FT                   /db_xref="GOA:Q7NNH8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNH8"
FT                   /protein_id="BAC88374.1"
FT                   /translation="MNAIALMGTLQSEPELRFTQDGLARLSTLLGFSAGRPEEPDFQIR
FT                   MVAFGNLAEEVARTLHHGDGVLVEGRLQAETRGRPDGTKEKVTELIARKVYPATVGESL
FT                   AGATPAPAAAPAASAKNGAPAARPAPRPAAPARPTAPEPDLDDIPF"
FT   CDS_pept        complement(464176..464466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps6"
FT                   /product="30S ribosomal protein S6"
FT                   /note="ORF_ID:gsl0434"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88375"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88375"
FT                   /db_xref="GOA:Q7NNH7"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNH7"
FT                   /protein_id="BAC88375.1"
FT                   /translation="MSTKYETMYILRPDLTDEIIDQTITRYQTLLAEQGAAPVETQHRG
FT                   KRRLAYELKKFKEGIYVQMNYDAPTTAVAELEKAFRLSEEVIRFLTVREED"
FT   CDS_pept        464612..466120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0435"
FT                   /note="ORF_ID:glr0435"
FT                   /note="probable long-chain-fatty-acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88376"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88376"
FT                   /db_xref="GOA:Q7NNH6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNH6"
FT                   /protein_id="BAC88376.1"
FT                   /translation="MNLSRILDRQVQLHPDAPAFIGPEKSLTFGELARASAAVAGGLAQ
FT                   LGVVCGDRVAVMLPNVLPFPIAAYAIWRLGAQLVTVNPLLKPQEVRHLLTDSGARVLVS
FT                   LGQLLPPIAELIAELNIQVVTVGGGELGTPFEHLFAAPPLLEPAAVAPEDVVAVLYTSG
FT                   TTGRPKGAMLTSRNLGYDSEACAAALEIGPSDRLFMVLPLFHAYGMTIGLLVCTRNGAS
FT                   VYLEPRFVPAQALAHLKQFECTAFIGVPALFAALLTTEGTALTNLRFCISGGAPLPLPV
FT                   LEAFEAKFQTVILEGDGPTECSPVTAVNPLRGVRKAGSIGIPLPGQQMTIRDPQSGEFL
FT                   SDGEVGEILVRGPNTFKGYLNLPEETAQVFVDDWLRTGDLGYRDGDGYFYIVDRLKDLI
FT                   IVAGLNVYAREVEEVLQSHPRVRMAAVVGEFDELRGEVVHAFVEPISEQEPPEAQEIIR
FT                   YCREKLADYKCPRRVTVMAELPRSTTGKILKRVLKEGFKGYSAQ"
FT   CDS_pept        466174..467043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0436"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:glr0436"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88377"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88377"
FT                   /db_xref="GOA:Q7NNH5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNH5"
FT                   /protein_id="BAC88377.1"
FT                   /translation="MLDIHKLSKVFPSGAVGISGVSLSLDGGVLGLLGANGAGKTTLMQ
FT                   MLATITTPTAGQIRFQDVDILRQPDYLRRRLGYLPQDFGVYDNLTAFEFLNYFAALKGV
FT                   SSRARVLEMLELVNLHTVAHRSAGTFSGGMKQRLGIAQALINNPDLLIVDEPTAGLDPE
FT                   ERVRFRNLLGDIGSGKLVILSTHIVSDIESIATMIAVIKKGRLLACAPPEALLATTGGR
FT                   VWEAVLSSAQFDGIRSSLKLSAAVRKPDGIHARIVAQDCPLQNAVPVEANLEDAFLYLM
FT                   NFAPTAFG"
FT   CDS_pept        467040..468629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0437"
FT                   /note="ORF_ID:glr0437"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88378"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88378"
FT                   /db_xref="GOA:Q7NNH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNH4"
FT                   /protein_id="BAC88378.1"
FT                   /translation="MNIAFQRIQAIVVTDFRLRFRRLSTAVLFLLLCLTAYSLVPDPSS
FT                   GTTLMAVNGQRVLYNSTVIALVTSVLGSVLLTLTGFYLVSHSLQREITARTGFVVAATP
FT                   VRNIEYLAGKFLGNAVLLGSIGVGLMLGVMVMHLLRAESPLEPLVYLSIYLWILLPTVA
FT                   FVSAIALVFETFPWISGRLGDVIYFFVWAVLLSVPAALLASGRALDGWQLIDTTGLSYA
FT                   IDEITRQTQGKEVSLGAVPFDRGKPTLEMTTVGWSQGAILTRLATILLALPLLGLALTA
FT                   FARFDPTRIKLSERSSTINPLAWLNGLVKPLARVLEPLYAIAAIAGLPGWLRLVLCDAL
FT                   LTLSLSPLILIVVVGLAVANSFLPIETVHSTILPLMFVALVPVLAGIPTRERQAGLTAL
FT                   LLTVPAARSNFAGWKYGSLLVVTLCFTAIPLLRLVWVQPGEGISLMAGSLFVAAAALAG
FT                   GMLSGGPKTFVLIFMLFLYLVVSGGGQSSTLDFAGWYGKATPAVQGGYAAAAAVLVAVC
FT                   HLKHRWDLRRMY"
FT   CDS_pept        468631..469320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0438"
FT                   /note="ORF_ID:glr0438"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88379"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88379"
FT                   /db_xref="GOA:Q7NNH3"
FT                   /db_xref="InterPro:IPR010404"
FT                   /db_xref="InterPro:IPR038672"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNH3"
FT                   /protein_id="BAC88379.1"
FT                   /translation="MLSSGQSESLNQPMRMVICCLLLSTGLLAAVPSPAEQNALPATER
FT                   QVEEVVTRLTGIMTTTQQAQSDAARPDVRMTTCSVQLEGDKSKAIYLYQEQTMSNNLGA
FT                   PYRQRLLRIAASADGRAVESAGFKFVEAKPLAGLCAKPAAERLIAPMALDGDPTCTVRL
FT                   VQAGDKYMGTTPEGGCQSNVRGAARITNEITLYKEGMDTRDRGFDAQGNQVWGAKEEPY
FT                   RFRRLTP"
FT   CDS_pept        469357..469743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0439"
FT                   /note="ORF_ID:glr0439"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88380"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88380"
FT                   /db_xref="GOA:Q7NNH2"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNH2"
FT                   /protein_id="BAC88380.1"
FT                   /translation="MSPGEEMTMAPEENPSPTESTPPPPEAAPPGAESKASVQERLDRA
FT                   LHEAARKLEETAEQFERLGSQGTKASEYSQKVASQLRTGARYLEGAEVDDLLERTRSTV
FT                   RRYPVASLGIAFGVGFVLARLLKR"
FT   CDS_pept        469757..470134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0440"
FT                   /note="ORF_ID:glr0440"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88381"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88381"
FT                   /db_xref="GOA:Q7NNH1"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNH1"
FT                   /protein_id="BAC88381.1"
FT                   /translation="MRQSEPSLKDLLTELVGQFEQLVVQHIRLARQEFTADGQKLAFHA
FT                   GGVVLGLLLLVLGMAFAGVALLVGLQLVLPTWAAAIVVALLFLSSGSLIAAGSMRNLKR
FT                   NSPGRAIEEAQETITWLIRRK"
FT   CDS_pept        470137..470523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0441"
FT                   /note="ORF_ID:glr0441"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88382"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88382"
FT                   /db_xref="GOA:Q7NNH0"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNH0"
FT                   /protein_id="BAC88382.1"
FT                   /translation="MAANGKPAPSGAPETAPLAEADLQRTRERIAQTASAIEQRVKADL
FT                   NWRTWVNRYPLGAVGVAAAAGALVALGLPGGSKRRANRDEVIAREVGKSSLVASVVSTV
FT                   ATLALREGARIVVERFLGDGKKPE"
FT   CDS_pept        complement(470524..470790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0442"
FT                   /note="ORF_ID:gsl0442"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88383"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88383"
FT                   /db_xref="GOA:Q7NNG9"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNG9"
FT                   /protein_id="BAC88383.1"
FT                   /translation="MHYKATIRVTLRPSVLDPAGVAVRSGLQQLGYASVANVRIGKYIE
FT                   LELEADNDAEARHQVDRLCDQMLANPVIEVYKFEVVALEAARR"
FT   CDS_pept        470886..472256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0443"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="ORF_ID:glr0443"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88384"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88384"
FT                   /db_xref="GOA:Q7NNG8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNG8"
FT                   /protein_id="BAC88384.1"
FT                   /translation="MSARLAAIVLAAGKGTRMRSTLPKVLHPLAGSTILERVLAALGEL
FT                   ALAECFIVVGQGAELVRGRIARPGVQFVEQTEQRGTGHAVQQVIPHLEGFEGEVLVLNG
FT                   DAPLLRPSTVAHLVEKHRSFAADATILAARIADPGGYGRVFLDADGRVRQVIEDRDCTE
FT                   EQRRNDLINGGVYCFRWPALMTVLPALSADNDQGELYLPDALPMLTHVRAVAVEDPQEI
FT                   FGINDRLQLSQASRILNERTLVGLMLSGVTIVDPLRVTIDETVEIEPDVVIEPETHLRG
FT                   ATRIAGGCRIGPGTLLEDTVVGAGTEILYSVLRRSRVGAHSTIGPYSHLRPGADVGSHC
FT                   RVGNYVEIKNATIGDHTNAAHLSYVGDASVGERVNFGAGTIVVNYDGKHKHRTEIGDGV
FT                   RTGANSCLVAPLKLGDGVTVAAGSTVTEDVPCGLVIARSRQVVKPDWKAPYERTEDG"
FT   CDS_pept        complement(472253..473044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0444"
FT                   /product="stationary phase survival protein"
FT                   /note="ORF_ID:gll0444"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88385"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88385"
FT                   /db_xref="GOA:Q7NNG7"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNG7"
FT                   /protein_id="BAC88385.1"
FT                   /translation="MRILVSNDDGILAQGIRTLANTLHRAGHTVTVVCPDRERSATGHA
FT                   LTMHKPLRAEAVENLFEPGLAAWAINGTPSDSVKLGLDALLGERPDLVVSGINCGANLG
FT                   SDVLYSGTVSAAMEGTIEGLPSIAVSLASRVRCDFQPAADFLVRFVRALEVQPLPEAFL
FT                   LNVNVPALPESEILGARVCRLGMRRYRDQFVKRVDPRGVNYYWLAGEVIESEEAPDSDV
FT                   VAVGEGCIAITPLKYDLTYEPGIGLLGARQWEKIFDPLAGG"
FT   CDS_pept        473307..474350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0445"
FT                   /product="phosphate ABC transporter periplasmic
FT                   phosphate-binding protein"
FT                   /note="ORF_ID:glr0445"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88386"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88386"
FT                   /db_xref="GOA:Q7NNG6"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNG6"
FT                   /protein_id="BAC88386.1"
FT                   /translation="MQTNKWTRRAFVSVVALASLASPLLTQVAHALTLSGAGATFPQPL
FT                   YEKWFFEYNKKNPDVKINYQGIGSGGGINQITNKTVDFGASDAAMNDEQLAKVGGSSKM
FT                   LMLPMTAGAVAITFNVPGVKSGLRITRVALTDIFLGKVTKWNDPAIASVNRDVKLPDLP
FT                   IAVVRRSDSSGTTFIFTNHLSAIKSSDWSEKVGKGTSVNWPTGIGAKGNQGVSAQVQQT
FT                   PGAIGYVEYAYATENNLPVAAVENREGKFVLPTVKATETALDGTKYPENFRVFIEDPDG
FT                   AGSYPIVGLTWLLVYKEGNDKAKAAELKKFVNWALTEGQQYVEPLKYTPLPAAVSKNVI
FT                   KAAEQIK"
FT   CDS_pept        474386..475363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0446"
FT                   /product="phosphate ABC transporter permease protein"
FT                   /note="ORF_ID:glr0446"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88387"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88387"
FT                   /db_xref="GOA:Q7NNG5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNG5"
FT                   /protein_id="BAC88387.1"
FT                   /translation="MQTQPSNQLEAPENLTAGGGSLQPDTIARGVFLVAALAVVGTLFW
FT                   MAFVVARDALPAISKFGLGFLVNSTWDPVVEEFGGLTFVFGTVASSAIAMLLAVPVGLG
FT                   IAIFLTEDFLPEWVLTPIAFMVELLAAIPSVVYGLWGIFVMIPIVRAVETFLNQTLGWI
FT                   QIGGKSIFGVPYGPGLLTAGILLAIMILPTIASISRDVLRAIPRSLRNGSLALGATRWE
FT                   TIFRVLLPAASSGVVGACILGLGRALGETMAVTMVIGNTPQIDTSIFAPAYTIAALLAN
FT                   EFAEANTPVHIGALFFAALLLFVITLLVNVVAELIVRRVSLERN"
FT   CDS_pept        475370..476257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0447"
FT                   /product="phosphate ABC transporter permease protein"
FT                   /note="ORF_ID:glr0447"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88388"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88388"
FT                   /db_xref="GOA:Q7NNG4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNG4"
FT                   /protein_id="BAC88388.1"
FT                   /translation="MTTSLRPEQPVSDDLTSPLEPGRALFTTSMTTLSVVFTFFAIIPL
FT                   FSVLIYVLIQGFSSLSPDIFTELPAPAGTPGGGFGNAIQGTLLMVGIAALISVPFGVLS
FT                   GIFLSEYARDDRGIIEVVRFGVNVLAGVPSIVIGVFAYGVVVLSTKTFSAYAGGFALAI
FT                   LMLPIIVRTTEEALKLVPWELRLGSLGLGADRFNTIARVIVPAALPGIITGVMLAVSRA
FT                   AGETAPLLFTALFSQYWIDKVGQPTASLAVLIFNYATTPYADLQRKAWGASLLLLILVL
FT                   AISIISRYVFRRRF"
FT   CDS_pept        476275..477081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0448"
FT                   /product="phosphate ABC transporter ATP binding protein"
FT                   /note="ORF_ID:glr0448"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88389"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88389"
FT                   /db_xref="GOA:Q7NNG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNG3"
FT                   /protein_id="BAC88389.1"
FT                   /translation="MSSEQLQADQVPTKAGIAYKVRNMAFFYGTKKALDNISVDLPAKS
FT                   VTAIIGPSGCGKSTFIKALNRIAEAETKVRIDGQIELFGQNIYDPKVNITRLRRRVGMV
FT                   FQRPNPFPMTIYDNITYGPRVFGFKGNYDEIVETSLRRAALWNEVKDKVKTSALGLSGG
FT                   QQQRLCIARSLAVNPDVLLMDEPCSALDPIATLRIEELIETLRDQFTIIIVTHNMQQAG
FT                   RVSQNTLFFNTDESRIGQLVENGPTKEIFFSPKDKRTEDYISGRFG"
FT   CDS_pept        complement(477154..478002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xer"
FT                   /product="integrase/recombinase"
FT                   /note="ORF_ID:gll0449"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88390"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88390"
FT                   /db_xref="GOA:Q7NNG2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNG2"
FT                   /protein_id="BAC88390.1"
FT                   /translation="MSCLDDFWDYLERERRLQPATCRAYRCDLKQWFGYLQTANPLAAR
FT                   PEQLRSYLVQLGERGIGHGTLRRKRSSLRVFYGYLHRQGVIAADPAAALPTETSRVPGP
FT                   PPLRPQQLEALLGAVGDDACGVCHRALILALYAGGLRSAEVSAANLENLDWERGLWRLP
FT                   QRDVLLDPRLYAALLDYLRCGRPGLAAGIAERALFVSRRGHRLSVRALQAYLSRYGVTA
FT                   QQLRNSYAAHLLEGGTDPVDVQALLGLRSTQAAAGRQPTVAQGLRRVYDLAHPRSGLHK
FT                   K"
FT   CDS_pept        complement(478018..478497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0450"
FT                   /note="ORF_ID:gll0450"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88391"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88391"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNG1"
FT                   /protein_id="BAC88391.1"
FT                   /translation="MSYTQQLAHLSAMDYVVVGVALCYQKNAEGKTDPVRVVEPIPATA
FT                   LEAMSRGNRTSYLKIYATTLGAVIVDQRPVLPTDILGEDAHVCHDFLGRTQAAARTYKA
FT                   KSDLRLVPVGEVCTPETGQFRLHYDPAFRRILGGERLISDSDNVKQHSHTHKTLV"
FT   CDS_pept        478664..479491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0451"
FT                   /note="ORF_ID:glr0451"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88392"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88392"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNG0"
FT                   /protein_id="BAC88392.1"
FT                   /translation="MSQEYTQNLRAGFDRLNLPELRKLERTEAGLAKAFLKSARILHRQ
FT                   LERVEAAVQRDKEPDTLSVTVAALFARMVRHYYSHTALEVYRDTVASRFVLDQLYRVGV
FT                   TMLYLIEKPHGFETYVAESQPYLRRLVDIVEEQLVAFPEHGELVSIRQTLRSMLNRQGG
FT                   PVPLKSADNLDERARWQGLQFLSDPARKIRLLAPPGSWLDLQLENSRAAQVRGRVNFTH
FT                   LRDAAHLCLHVTQALLEADDLEVAGLNQRTLNTLFEWFYEAHALYESQVRSVN"
FT   CDS_pept        complement(479504..479896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0452"
FT                   /note="ORF_ID:gll0452"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88393"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88393"
FT                   /db_xref="GOA:Q7NNF9"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNF9"
FT                   /protein_id="BAC88393.1"
FT                   /translation="MPGKRSKRSKVDRFHCPHCEARLWRLGSQKYHLFYTHLSEMTAEG
FT                   GIPRKQAALLISQKSEYVDNCAWLEEFFCGEHGKMWMLVRQSSEGVLTAIVPSEHDWKR
FT                   TTGTLFPNRPNPSVSEFTYRMSRGAG"
FT   CDS_pept        480859..481833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0453"
FT                   /note="ORF_ID:glr0453"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88394"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88394"
FT                   /db_xref="GOA:Q7NNF8"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNF8"
FT                   /protein_id="BAC88394.1"
FT                   /translation="MQKRNWREWTILPGLLALLGTAPMVGSASAMTLSAYDRVSVTVVN
FT                   GEEFSSAGEQGFVVGADGNIFVPQLGRIPAAGREELELQQELAQRLREYIRVPDVQVRL
FT                   VSMSSVAVDVSGSVYRPGLVTLQPPASVATKMEVGAVRTVYNAIKEAGGVRPDANLAQI
FT                   ELERNGQRTRLPLGQDVPVISGDRIVVASLGPGQYEMANLPSQLAPEQITVYVSGQDLP
FT                   SNAVGPVKVRPGTTLAGALTAAGGSGESFLRGGRQVTLIRTDPTNGQRTAQNFPVAQVM
FT                   DGTNDLKLLQDDSIVVNAGSPANAEGFLSLIQPLLMPFVWLFR"
FT   CDS_pept        481891..483921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0454"
FT                   /note="ORF_ID:glr0454"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88395"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88395"
FT                   /db_xref="GOA:Q7NNF7"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNF7"
FT                   /protein_id="BAC88395.1"
FT                   /translation="MSSVVAIGRRHWRPLLALNSVLLAATVGIALFYPRTWTSTAQLII
FT                   PNNSSSLSANLGPLGNLQQQGLTYSNQLNPTGIQSDILLSSNVLRPIWEKDPERAEKFS
FT                   RLEQYAKLFKSKAGDQSTILVLEAKGSSSELAKQRSEAVLQSYQQRLNELRIDDSKRRD
FT                   QFSKEELQRAQKELQRAQLALSNYKQSTGLLDADEQTRGLVATLNTLRSSQALTQAQSE
FT                   AAAQRADSLEQAVGMDMGRATAALNLGEDKAYQALRAKLADVESQLVQARGLYTDKNLR
FT                   VKSLELQREELLAKIKQQVGSIVPDAAKVNTSLGGNNYRDSRIDLILQLIQAQAESAAL
FT                   GRQSERIQNRIDSIDSQLKTLAPRQSRLRELTRRYEIAEGVYKGMVAQMQQAKVNAFDA
FT                   YPNVQILDAPSVNSRPSPSGLLIAVGGLVAMLSGSIALALWLERRNPLLALRELEGTGL
FT                   PVLARIPRLKESAAKVAEAEEFRQLASVVSLLPLESRRLMITSSGVGEGKTTVTLGLAK
FT                   ALRELGFRVLVVDADFRQAGLGRRLQIEGQSSEPVALAPSLNFLPACLPEAGLSVGEYI
FT                   AKGQFTRYLAELERTGNYDYVLIDTAPEDLVAETKLIAAAIRNVLFVVRSGVSNRDSVN
FT                   SSLYTLQRFGSSISLVINGSESAKDAYRYRYERPALQAADS"
FT   CDS_pept        483925..485304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0455"
FT                   /note="ORF_ID:glr0455"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88396"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88396"
FT                   /db_xref="GOA:Q7NNF6"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNF6"
FT                   /protein_id="BAC88396.1"
FT                   /translation="MSPMDAPIAIRAGLVDSLRAMWGQMSHAERSVFGIIVLLPLWWGI
FT                   GFGYISLLLLAGLAASELWQFGRIRLKAPRPEVWALFAFGAYVTVNMNLHVEKITGNSL
FT                   LSPTLLWIGGALVLWYIQSNDVRVRVQVAIWAIAVLMAEVLAVWLVAHFVIGESSLPIM
FT                   RSLTGLLLSKQERYVEGLGDTNYLRLFDAEDGTSFLGTPRYAAFFGHPEFFAQATAFVF
FT                   LLGLSGRSPWPLLLGSAAVVALILDGARSSVAVLIAVLALRMLLTLGKHGGIWALFALI
FT                   AALSFGALALPPVTEALVTTYERTVDSTNNLRKASTEARSLLYGRTFESLGDAPIFGHG
FT                   IPGRTVVPGYEPAKVGSHSFLLGALLYCNGLAGTLLFGIFAVTFMRWLWRTRADRPDCV
FT                   WWTLLLFMILASVVAFDFTRMAILLLCTMLSLDRGRTETDEAMWAVKQFPRTQQKLAAS
FT                   R"
FT   CDS_pept        485339..486412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0456"
FT                   /note="ORF_ID:glr0456"
FT                   /note="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88397"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88397"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNF5"
FT                   /protein_id="BAC88397.1"
FT                   /translation="MSTQSPSSHSPISSQPLVSIIICNYNFGHLIGQAIDSALKQTYRN
FT                   CEIVVVDDASTDHSVEVIRSYGDQVRPIFLEKNSGQAEAFNTGLRNSRGEIVCFLDSDD
FT                   RYYENKVERVVEAFGEHPEWVQVSHSWVTVDAEDTKIGYGAKSLVQGDVRRMLLTWGRY
FT                   PCAITSALSYRRSVLDKILPIPNRQVWVCGRSYDGGADCYLVAVAPFHGQVGFVKEPLM
FT                   YYRIHGKNRRSRSKNFEHAVHCYKAVGQFVNDAAKQTGVAGRFDISRDGQYLALLSLHE
FT                   GASQCSLLKIVALTLDEARGTGMRPWDALKWMLRRSICVVSPKDGKEVLLLGLSSFIRT
FT                   KLAAQVPGMARASSTRS"
FT   CDS_pept        486426..487910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0457"
FT                   /note="ORF_ID:glr0457"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88398"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88398"
FT                   /db_xref="GOA:Q7NNF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNF4"
FT                   /protein_id="BAC88398.1"
FT                   /translation="MGNKIGWIKPLLNRLPLRGHLARGGMWLLSAFFFERGSQFLMQLL
FT                   LARLLSPNEFGLWAMVLVLTNFSRLFRDGAVGSVLVQRGLEDKKLVDAVYSLGVNISFG
FT                   MFILQALAGFPLSLFFDQPLLWPLTAFHALVFLINAGTGAHDAVMLRQQRFKDIAISDS
FT                   AAGASRLLGAAICALCGGGVWSFAVAEVAYACTDAVTRRRMSGYRFAYAFKPDPEALKE
FT                   VRRFITGMLGISMAAQANTSGDNLVIGRLLGAQALGYYNVAYQLAMVPVFAAAKTNRVH
FT                   FSALSRMEPAECRPYVVRAIEQYGLIAAPINALSFVLAPWLIPFLYGADWVDAIKVFQL
FT                   VLVFAYVRGTMQILGTSLTAAGKPGINARINWALVPLSIPAYLAGAWLGGIQGVALAVA
FT                   VVMGPAALVWFWLAVCRTNGWRLGDLARPILLPPAVAVLAVASTWLVTLPIALEALMML
FT                   AFYLVSVTGLLIRLPKLRGQDKAYIQQDLANTTSKH"
FT   CDS_pept        487915..488574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0458"
FT                   /note="ORF_ID:glr0458"
FT                   /note="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88399"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88399"
FT                   /db_xref="GOA:Q7NNF3"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNF3"
FT                   /protein_id="BAC88399.1"
FT                   /translation="METLTRKPEVRNLQMQQAVKRLLDLAGAALGLLLFAPIFAYIALR
FT                   IRLDSPGPIFFRQQRMGLGGQYFHVWKFRTMVTDAETQLARLEKFNESEGGVLFKMKND
FT                   PRVTSFGQFLRRTSLDELPQLINVLLGQMSLVGPRPLQERDCQRASALFDARRLGARLS
FT                   VLPGMTGLWQVGGRSELSFEQMLDLDLQYAETWSLRLDLVILWKTVQVVLVKRGAY"
FT   CDS_pept        488609..489784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0459"
FT                   /note="ORF_ID:glr0459"
FT                   /note="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88400"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88400"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNF2"
FT                   /protein_id="BAC88400.1"
FT                   /translation="MLTQKQRADGRTRERYRVALIHTSAGVIWSGGSEIFAIEMSRRLS
FT                   EYFDVELLSGEPCGPLSTPVGAVSRTRSRAVFRHPLLAPLWRRFTNVPELWWEYLTGYF
FT                   PTVSHLLRKPADLVFPINGLGGLAAAWTVRALIGTPLLYTEHCGLLRNGRDLRRSLDFR
FT                   PDRLIALSTEIAEFARRHRPQQPVAVIPNGIDLARFRPEGECIELGLPAPVVLCVASLR
FT                   KDGHKRVNLAIEAVSRLPGVSLLICGDGLDRPYYSALAERLLGAGRSRIDSFPFEQMPA
FT                   VYRSCQAFTLPSVDEPWGLAYVEAMASGLGVVATDDAMRRHIVADAGLLCDVTDIDTYA
FT                   RCLRQVLAENWQERALRSSRRFGWDRLAIDYRDAIVETIQVKQTASKKAAD"
FT   CDS_pept        complement(489800..491215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0460"
FT                   /note="ORF_ID:gll0460"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88401"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88401"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNF1"
FT                   /protein_id="BAC88401.1"
FT                   /translation="MEIVMYYLQLFRPVPILSYCALFYTLLVLLGLPELGSRALAAGIS
FT                   GFSPSSGPIGTTVTIDGSGFKDVSSVQFGGGNVSFTQTSDSTITATINSNAETGKITVK
FT                   ASSGSLTSSNSFTVTIAKPSISSFSPAGGPPETKVVVKGANFEGVQSFKIGNVYLPFTY
FT                   DSSSQLTATTKVGNVTGKITITTSGGSVTSSNTFTSDPPSITSITPLQGSAYPATDITI
FT                   KGINLSGIGGVAFGKGYAERWEYISHNELRTQVPCTASTGKVTIDTFAGKITSYNDFTV
FT                   PDAGVPSDVPQRIACVKEPLTPPDGFTAITYWGQAIVDTSKTGEATVEIDYMKLWCTIN
FT                   GTEKLLADDQGSVYGHLYVRSGWYSIRETEPMPYTYNAQNDSVVLKLSQHPDKIFHWYM
FT                   NTPRASWSPQDTVSGCRVEGRMKISGPALVQLGADWWVDAYAPWNGAQVNNREMGYTNW
FT                   YRQSPDWRVIDLP"
FT   CDS_pept        491587..492477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0461"
FT                   /note="ORF_ID:glr0461"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88402"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88402"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNF0"
FT                   /protein_id="BAC88402.1"
FT                   /translation="MSPVKRMFPHLQNYVRMVRKVLVSAASIRQQPHNRFTSDGYEVIP
FT                   DFLSSAESREIIAFAQSYVRGHSYVIPPQHYCEDEQDGGKCYMHHRAESTDINLGMVQF
FT                   INVQKLDERYSRLLYSVKTMLEKRTGETLVAQSAVVQLDMPDQQTKRRLHTDGLTVRYK
FT                   AFLYLSDVQNIDDGPYTVIAHSHRHVARKLLNLFYVRWRSLGWSREKVSRSDQFGDMAL
FT                   FYNEKQTIPILGQAGTLILSNQLIVHQGGYNTNPRWALILHYIPSKFWDGKPFDMYQKD
FT                   VGSQGYPDQQMLAEA"
FT   CDS_pept        492553..494475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0462"
FT                   /note="ORF_ID:glr0462"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88403"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88403"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNE9"
FT                   /protein_id="BAC88403.1"
FT                   /translation="MRMLIRNRCRYLVAVRMSVLTAGLLALATLVSSPAAKASGKLSVR
FT                   TPDSEIVNNRVVFSTVDEEIRSPKSVTLTNSGLEPLTISSLVLGDSDEIVNAANGRSGD
FT                   YKRAGDFQILNAPALPLVLAPNASLELSIQFAPQRGSGIIQNSSTHSTNAENYATLSVS
FT                   TDDPAQPIFKIPLAGLNAVGYEGNNEPAAAEISRSFGWSTVIGTELLKIGGDKALVGEE
FT                   LYSPYWVRADASKPLLAWPLARYAARKTGLQGYTKLRPKSGGTDNQILVFEGGSDESGG
FT                   ENQRLLPKISVDGTDVAPTAGTIGRFPNGPFGIKLDNAYINDAQNTPDQPHNWRIFPVR
FT                   DKNGALVPNHWYGIVDPGNKNPTPESGKNYDYQDGVFLLANVRPESASLNPATPGLTPG
FT                   NSALILFFRSAVSGTLTDVNGAGLGFTSTQRNNNDTFTSTPSYNAGLLRLSTANTGTLV
FT                   LTTADSSPSRTDNNLVNGLQLAFDGRSVPFTASAKILGPLSQIAVPPYQQAGIFTGPDQ
FT                   DNFIKLVARATDTNTIGIEFYQERRAVGTTISTVSLANPSTLQSLELYLTADPNGSTIR
FT                   SAYRAVYADLDTGVVNLPGTVTLAGGDKGRYFDLQSKAGIMAYSKDSPSIQIVYDNFQV
FT                   LKANP"
FT   CDS_pept        494627..495862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0463"
FT                   /note="ORF_ID:glr0463"
FT                   /note="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88404"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88404"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNE8"
FT                   /protein_id="BAC88404.1"
FT                   /translation="MLPTVLNVSQNYFIRGGSDRYFFSLGELLEKWGHQVIPFAARQPE
FT                   NCETPWAHYFPEPINFTSPSARDLLRFVHSKPAADALSRLLGEHRPAIAHLHIYYGQLT
FT                   TSILRPLKEAGIPIVQTLHEYRLVCPVSTLMSADGQLCQSCNGKDFWQAVAKRCNRGSL
FT                   SRSLLSAAELYYSHALGGVIDKVDRFITVSHFQRRKLAELGIPAHKMVTVHNFVDVSNI
FT                   PVNPGKGDYFLYFGRLERLKGIFTLIEAAAPLTEVPLLIVGDGEAREEVEATVARRGLS
FT                   HIRVLGPKRGRELQQLIADSLCCVLPSEWYENCPMAVLEAYAHSRPQIGADIGGIPELI
FT                   EDGTDGLLFAPGDSEHLRECLLAMARDRRRAMEMGLAGRQKIERYFSQNHHYEQIVGVY
FT                   NDLMGAKVPVPR"
FT   CDS_pept        495942..496880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0464"
FT                   /note="ORF_ID:glr0464"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88405"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88405"
FT                   /db_xref="GOA:Q7NNE7"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNE7"
FT                   /protein_id="BAC88405.1"
FT                   /translation="MAVQQIAPIVKTEAGVLPNLVIAGVVKGGTTSVFTYLSQHPDICP
FT                   SSKKETCYFLPVRYGGEPAPVTEYLLNFKRYRTERYVMEATPGYFEGGYKLASLMRQQL
FT                   GQARIVMILREPVERLFSFYNYQKAMLNISKDMIFDRYIKLCENIPYTEVCKQTNDPYW
FT                   GIQGGFYANYMNDWFEVFPDSIRVFFFDQIKRDPALLLAELYDWLGVEAVVPETLRVEN
FT                   KTISYKVALLHKAALAFNMKAERVLRLFPDLKDAARRLYFTLNGQPFEERMSSRTRSYL
FT                   ESVYAPYNERLAHQLAKRGYSNMPTWLVPPA"
FT   CDS_pept        496976..497863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0465"
FT                   /note="ORF_ID:glr0465"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88406"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88406"
FT                   /db_xref="GOA:Q7NNE6"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNE6"
FT                   /protein_id="BAC88406.1"
FT                   /translation="MKNPPIRLMVAGAHKAGTTSLKDYLGQHPDIATHDQTEYCGFLAD
FT                   VQYAKGYDATFRQYFPEASPGHSTIIAKCIEVMYQPKMVQRLYEHNPDCRIVLLLRHPI
FT                   DRAYSAYWYLRCKAWEESPSFEQALAEEPERLRSNNIRVFSGAYLNRSTYYKHLANLYN
FT                   TFGEHRVQVFLVDDLKKDPAAVCRKIFEAAGVDGAFTPSFERRSNAAALSRSVELTKMM
FT                   TSDNDHFLRAMIRPFLPSKLRYTIRKALLSLNEKPFTPPPMKPETRQRLIEYFLPHNGA
FT                   LSSMLDRPLHSWNR"
FT   CDS_pept        497893..499116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0466"
FT                   /note="ORF_ID:glr0466"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88407"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88407"
FT                   /db_xref="InterPro:IPR015393"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNE5"
FT                   /protein_id="BAC88407.1"
FT                   /translation="MRPRQLLPRAHLTNCRLLLIISGVVRMKIAFCGTRGLPAKYGGFE
FT                   TAVQEITSRLAADGVECEVFCRGHMYKQQPAAYEGRTLVYVPGSTNRSLDTFVSSIQTG
FT                   LHLLSNRKQYDYVFWFNNANLPGILMTLFTGIPMSVNTDGLEWRRPKWSLPFKLYYFGA
FT                   SAIIAKLCNLISDSRELSIYYRKRFGASSVFIPYGVPQLPQVSSVRAAEILKQYGVEPG
FT                   KYSLQITRIEADNLPVEAAEGFVDSGLSREGYKHLVIGYSHDTPYSLRLKELAARHGEH
FT                   VLVCKAVYDADVVTVLRRYCALYIHGNSVGGTNPALLEAMQLCPRVLAIDTPFSRETLG
FT                   ELGEFFTVGTLASDFRRTIAASDHSKQLRQRIEQLYDWDAVADAYVALATGNTMAVKQP
FT                   SLLNSGKV"
FT   CDS_pept        499175..500698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0467"
FT                   /note="ORF_ID:glr0467"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88408"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88408"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNE4"
FT                   /protein_id="BAC88408.1"
FT                   /translation="MVAMGRETNTVRPRQMVAPAAHTIVTLCLAVLLFSTAPRPVQSQV
FT                   LTPRATGNERQLPPDYFGYNGANFLGEVAWDDSALIRALVPLKPALLRYPGGTESNYWN
FT                   WKVGWFVTGFPMPNYLRQLKPRSVRLENFQASIRATGAVPVYVLNLLSSDLETQLGSLR
FT                   EAKGLGLPVKYVELGNEFYIGSADHKSKFPTAAAYAQEANRWTAAIKKEFPEAKVASVA
FT                   APPKRVRDRRWLGWNADLLSTLQGGDALTLHHYYGTGLSDPYRRSQRSRSLRYSATEIA
FT                   SILGTPFVAWNELRTEGIGSLPVGREIWITEYNLFDRSQPLAGTWVHGLGVTVTTLLFI
FT                   DEPRITHVLCHTLLGNALFASIFSNERGFLVPTDFTRAAAPPQSVPLALTATGSALKLV
FT                   GAALAGKTLGQKLDFPGAPTIRAGRGAGYPSLLGWSFGDGRNRQAIVVNLASSTQQITT
FT                   AAVIPQGSFEQVSGDPLTLVSSPASLRKTSGGIAKNLALPPYSITRFSS"
FT   CDS_pept        501287..502369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /product="dTDP-glucose 4-6-dehydratase"
FT                   /note="ORF_ID:glr0468"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88409"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88409"
FT                   /db_xref="GOA:Q7NNE3"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNE3"
FT                   /protein_id="BAC88409.1"
FT                   /translation="MDKPTILVTGGAGFIGANFVCAWLSRHNGTLVNLDKLTYAGNPAN
FT                   LHALQADPRHVFVRGDICDPELIAQLLARFRPRYIVNFAAESHVDRSIHSPDAFVKTNV
FT                   DGVFLLLEAALHHWKQLTQPEVEDFRFLQVSTDEVYGSLSAEESAFSETTPYRPNSPYA
FT                   ASKAAGDHLVRAYHRTYGLPVLTTNCSNNYGPYQHPEKLIPLMLLNALAGKALPVYGDG
FT                   ANIRDWLFVEDHCRAIERVLDSGTPGQTYNVGGHNEKTNLEVIRTLCAILDQERPRLGS
FT                   GSYREQIRFVADRPGHDRRYAIDASKIGRELGWKPVESFESGIRKTVHWYLSQHRDWVE
FT                   QVLSGDYKEWFAINYRGRTA"
FT   CDS_pept        502369..503244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="ORF_ID:glr0469"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88410"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88410"
FT                   /db_xref="GOA:Q7NNE2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNE2"
FT                   /protein_id="BAC88410.1"
FT                   /translation="MKGIILAGGKGTRLYPLTLGVSKQLLPVYDKPMIYYPLATLMLAG
FT                   IREVLLISTPRDLPAYQELLGDGSRYGIEIRYCVQPSPDGLAQAFVLGREFLEGGPACL
FT                   ILGDNIFYGYGLGEMLQKAATRTFGSTIFAYRVSDPERYGVVEYDEQGRVLSIDEKPKA
FT                   PKSNYAVVGLYFYDAQISEIAAGVKPSARGELEITDVNNAYLERGLLRVERLGRGMAWL
FT                   DTGTHESLLQASNFIETIEKRQGLKVACLEEIAYQMGHIGVEAVLEQAGRLGKTEYGQY
FT                   LRNLVERGNR"
FT   CDS_pept        503246..503800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /note="ORF_ID:glr0470"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88411"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88411"
FT                   /db_xref="GOA:Q7NNE1"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNE1"
FT                   /protein_id="BAC88411.1"
FT                   /translation="MRFIATALPGVVVIEPAVYEQSCGYFFESYQRQKFAAAGISVSFV
FT                   QEYRSRSAQGTLRGLHYQLHRPQARLYTALHGELFAVAIDVRKGSPSFGQSAGVLLSAA
FT                   NKQQLFVPRGFAHGLLVLSQKAEFMYKCDEFFYPQDERGVLWSDPALGIAWRIEEPVLS
FT                   ARDRCNLPLSRIDPLDLPTYP"
FT   CDS_pept        503871..504854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0471"
FT                   /product="mannose-1-phosphate guanyltransferase"
FT                   /note="ORF_ID:glr0471"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88412"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88412"
FT                   /db_xref="GOA:Q7NNE0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNE0"
FT                   /protein_id="BAC88412.1"
FT                   /translation="MKAFVLAAGKGTRLRPFTDALPKPLMPVVNKPVMTHILALCRKHG
FT                   FDQIVANLHYRGEKIAERFADGHRHGVELRYSWEEQLLGTAGGVRRQADFLAGDAFLVI
FT                   SGDVMTDLDLGALVRFHKQSGAVATMAVKEVGDPSRFGVVLTDPDGRVESFQEKPAKGS
FT                   ERSRLANTGIYVLEPEVFEHIPEAAFFDFGNDLFPLLVSKGAPVYAMRTGAYWSDVGTL
FT                   SQYLYTHWELLTHPELKQRVGANTVVESGAVVSEQALIGSGCTIEKGARVLGYSCVSDG
FT                   CTIRAGSVVVDSVVWTSARWGHKLKGDLVRSIWGDGMQVSLGLPNL"
FT   CDS_pept        505141..505524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0472"
FT                   /note="ORF_ID:glr0472"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88413"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88413"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NND9"
FT                   /protein_id="BAC88413.1"
FT                   /translation="MDDWRFRFLLECVPHIVWTSSPEGYLECCNQYCLEYTGSSLEQLQ
FT                   GCGWQHAVHPEDLPLLLRRSLQSLRSGEAYEVEYRLRCSSDGTYRWHLGKAMPIHDGDG
FT                   QVLRWFGTCTDVHSYKLAGQREL"
FT   CDS_pept        complement(505528..506460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0473"
FT                   /note="ORF_ID:gll0473"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88414"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88414"
FT                   /db_xref="GOA:Q7NND8"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NND8"
FT                   /protein_id="BAC88414.1"
FT                   /translation="MPAFETVVIAYRAEEAHSRIAADRCESLLHKVGCRVLKGPTGPQD
FT                   NPYPHFLEATGGHIDLAIVLGGDGSILAAARYLAAVDVPILAVNVGGHLGFLTQPPEVL
FT                   GGRYWERLLAGEWELEKRMMLQASLTGPPPLPERQPYFCLNEFCLKPASEMRLTSIILE
FT                   LAIDGEIIDQIHGDGLLVSTPTGSTSYTVAANGPIIAPSLQAITITPICPLSLSSRPVV
FT                   LPATGTIEVSPLRDPDLNIKLWSDGAFAAPVHPCQTVRIEVARHPTRLLILEEDHSYFR
FT                   TLREKLKWAGTRIQAERDPECLLPPQNHP"
FT   CDS_pept        506562..506837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0474"
FT                   /note="ORF_ID:gsr0474"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88415"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88415"
FT                   /db_xref="InterPro:IPR021926"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NND7"
FT                   /protein_id="BAC88415.1"
FT                   /translation="MLRRMTSEQYLTHPTFGLLFLICPVGEESALYSTLYTQQLFFLVT
FT                   LIPVLGFEPIGREKARRIVENRIKILRALGENTALDRLQQFQQRHF"
FT   CDS_pept        507077..508189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0475"
FT                   /note="ORF_ID:glr0475"
FT                   /note="probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88416"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88416"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NND6"
FT                   /protein_id="BAC88416.1"
FT                   /translation="MRILHIVNHIRRDGNGVTNVVVDLACLQAEAGNHVLLVAARGEYQ
FT                   ELLQAYGVTHVELEHTALKKNPIKFLKAAIHYQRILREFQPDIVHAHMIPGMVLAKLLR
FT                   IGSKYKLVSTVHSEFQKGAWVMGLADRVIAVSQAVAQAIVLRGFPSHKVTTVLNGTLGS
FT                   PRMRSLDQYSKANLQHPAITTVAGMAERKGITELIEAFERISKKFPDAHLYLVGDGPDR
FT                   AKFEAEARKTSAFDRVHFEGFQLEPQKYLLATDIFVLASHREPYGLVISEAREVGCAIV
FT                   ASRVDGIPEALDNGQAGLLVAPRNSEALASALEKLLSDSVSLRYWRGKAKQNLEGLKVA
FT                   RVCGETLAVYHGLLGSADCGSASEGSLKAL"
FT   mobile_element  complement(508458..508580)
FT                   /mobile_element_type="insertion sequence:ISGL8c"
FT   CDS_pept        508789..510327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0476"
FT                   /note="ORF_ID:glr0476"
FT                   /note="competence protein ComM homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88417"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88417"
FT                   /db_xref="GOA:Q7NND5"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NND5"
FT                   /protein_id="BAC88417.1"
FT                   /translation="MLACVRSAALSGIDALGVTVEVDVGFGLPQTTLVGLPDAAVQESR
FT                   ERIKAALQNAGFVFPMRRIIVNLAPGDLKKAGPSFDLPIALGVLAASEQLQAEALGDFL
FT                   FVGELSLDGSLRPVTGAMCLALGARQMGLCGIVVPEANGPEAALVDGIAVYALRGLQEV
FT                   AQFLAEPGRFEPLAGDLLSLLERPPAADEPDLQDVRGQPLARRALEVAASGGHNLLLLG
FT                   PPGSGKTMLARRLPGILPALGFEEALESTRIHSVAGLLGRRDCLVTGRPFRAPHHSISA
FT                   AALVGGGGIPKPGEVSLAHNGVLFLDEATEFARPVLESLRQPLEDGQVLISRTRQSLTF
FT                   PARFAVVLAANPCPCGYFGDALRPCRCTVRERVRYWAKLSGPLLDRIDLQILVGRPKPE
FT                   EIAHLVPGEPSAAVRKRVIAARERQKTRFAGHPRVRCNAHMQTSHLRLFCTLDESARRL
FT                   LEGAIRGLHLSARSAERVLKVARTLADLAGSDQIAPPHIAEALQFRSLERMQTG"
FT   CDS_pept        complement(510418..514008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   S-methyltransferase"
FT                   /note="ORF_ID:gll0477"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88418"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88418"
FT                   /db_xref="GOA:Q7NND4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NND4"
FT                   /protein_id="BAC88418.1"
FT                   /translation="MTHPFLELLRHKIVVFDGAMGTSIQKMGLGPEDFGGAHLEGCNEY
FT                   LVFSKPEAIEQVHASFLEAGADVIETDTFGCSTIVLAEYGIEAMAYELSKVAAALARQV
FT                   AARYSTLDKPRFVAGSIGPGTKIATLGQTDYDALKEAYLDNVRGLIDGGADVLMIETCQ
FT                   DLLQIKAVLAAAEIAFDERGVRLPVITSVTLERDDRNVADKMLVGSDIATVVSALQPYT
FT                   IDVLGLNCATGPDLMSENIRYLSHNSPFYISVIPNAGLPENIGGHAHYHLTPGELVRYV
FT                   RHYVDELGINIVGGCCGTTPDHIRALATAVSGVKPRNRSVEVVPQVSSLYSAVPMHMDP
FT                   APLLVGERLNSNGSKKFRELLLAEDWDGIAGMAREQEREGAHVLDVCVDYVGRDGVRDM
FT                   GEVVSRLKTRSTLPLMIDSTEVPVIHTALKQLGGRAIVNSINLEDGEVRLQKLLPLCRE
FT                   FGSAVVALTIDEGEGMARTAERKLEVARRIHDLTVHKYGMKSEDLIFDPLTFTLGSGDA
FT                   DSRRLGIETLEGIRLIKENLPGVRTILGLSNISFGLNPGARQALNSVYLYYAVQNGLDM
FT                   AIVHASKILPLNRIDAEERELHRKLIFDEHDNGDPLQNLLAFYAKQEGGGKARKTAVVD
FT                   ASAPIEERLRRRIIDGNRVGLDKDLTEALRIYAPLDIINQHLLDGMRVVGELFGSGQMQ
FT                   LPFVLQSAETMKAAVGYLEPFMEKSDHSAKGTVVIATVKGDVHDIGKNLVDIILSNNGY
FT                   RVVNLGIRQPVENIIAAFGEHQADCIAMSGLLVKSTAFMKENLEIFNERGITAPVILGG
FT                   AALTRRFVESDCQQVYRGKVIYGKDAFADLHFLDALVEAKAKSAWKDGEGFVDGFAPVG
FT                   EELKRLMASSEGGAPPAPASFRSSEALVQPPEDGPIVRSRVAIGVPRPRPPFWGTRVLG
FT                   GSDGPDLSEVFRYLDLNALFAGQWNYRKSPDQSRAEYEAKRDTEMGPVLERLKCEVIDQ
FT                   QLLHPQVAYGYFPCQAESNSLRIYSLESFERFQQSGDPADLLVCARLAFPRQKGQDHLC
FT                   IADYFADAASGQIDALALQAVTVGHVASEHGQKLFKADRYSEYLYYYGLSVQTAEALAD
FT                   WTHARIRRELGIDGQDTAEMRRLVAGGYQGARFSYGYPACPNLEDQAILLDLVGARRID
FT                   LAMDESHQLLPEQSTTAIVCHHPEARYFAV"
FT   CDS_pept        complement(514192..515037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0478"
FT                   /note="ORF_ID:gll0478"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88419"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88419"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="InterPro:IPR022573"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NND3"
FT                   /protein_id="BAC88419.1"
FT                   /translation="MKTDTLFYRLFQTFPATLFELLGADPALAFDYEFRSVELKQTAFR
FT                   LDGVFVPTTPDRPLYFVEVQFQPDRRFYSRLFTEIFLYIHQLAPASDWRVLVLFPGRSA
FT                   DPADQPAFADLLSGSRVQRLYLDELEPGLSPSLGVGLVRLVVEDERSAVARARQLLVQA
FT                   VREPMDEAARRQALELIETFIVYKLPQMSRQEIEAMFGLDELKQTRYFQDVQAEARQEE
FT                   ALALVTRLLTKRFGPPDATVQQRLRELSLEQIEALGEALLDFKEEADLRAWLAALSKRG
FT                   "
FT   CDS_pept        complement(515072..516001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0479"
FT                   /note="ORF_ID:gll0479"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88420"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88420"
FT                   /db_xref="GOA:Q7NND2"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NND2"
FT                   /protein_id="BAC88420.1"
FT                   /translation="MKGGAGFQLSSSLSSLLEDSTLQSQSNKTRIIELEKEIRELKSEI
FT                   LKKNLANEETEREFYKLRETVEELQKKQELQDLESRVNEQAAKALFEHENFLNEFLKNQ
FT                   EHETFVMSIDIRRSTELMLKARSPEMFAQFISSLCKDLKEVITKNYGIFDKFTGDGILA
FT                   FFPEFYSGPDAGIHAVQSAIECHSIFQRKYKDHRRNFTTVLNNTGLSIGIDYGPANMQT
FT                   IAGGLTVVGAPVVYACRLSGGPPGKTLLNQWAYNKIQEVSTSFLYFSEETLKIKHEEEI
FT                   LVYSIQPNGTEVQARDPEWKLKFSTSIS"
FT   CDS_pept        516903..518570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0480"
FT                   /product="thioredoxin reductase carring response regulator
FT                   receiver domain"
FT                   /note="ORF_ID:glr0480"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88421"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88421"
FT                   /db_xref="GOA:Q7NND1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NND1"
FT                   /protein_id="BAC88421.1"
FT                   /translation="MAKPALLTVDDDPEVLQAVGRDLQSKYGGRFRVLRADSGASALAA
FT                   LKQLQLRNQPVALFLVDQRMPQMSGVEFLEQALPLFPEAKRVLLTAYADTDAAIRAINS
FT                   VRTDYYLLKPWDPPEERLYPVLDDLLDDWLANHKPPFEGIRVVGNRWSPQSHRVKDFLA
FT                   RQQVPYQWLDLEIQPEAQHLLNAAGDDQAHLPLVVFADGSRLAQPTNAEIAEKLGLRTR
FT                   AERPFYDLIIVGGGPAGLAAAVYGASEGLSTVMVERQAPGGQAGSSSRIENYLGFPVGL
FT                   SGADLARRAVAQARRFGVEILSPQEVTGIRIEPPYRVVTLADGSEVSCHALLIATGVSY
FT                   RKLEVAGAEALTGAGVYYGAAQSEALACSNEAVFIVGGANSAGQAAVYFARYAKQVTML
FT                   VRGESLTASMSQYLIEQIAQTENIVVRTRTSVTAVKGESNLEAITVHDDATGETQTLPA
FT                   NSLFILIGAAPNTDWLAGVVERDERGFILAGPDLMRDRRRPRGWTLDRDPFLLETSVPG
FT                   IFVAGDVRCKSVKRVASGVGEGSIAVQFIHQYLSKVGT"
FT   CDS_pept        518666..519247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0481"
FT                   /note="ORF_ID:glr0481"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88422"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88422"
FT                   /db_xref="GOA:Q7NND0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NND0"
FT                   /protein_id="BAC88422.1"
FT                   /translation="MKASKNPSAPRSQITAAAYRLLAEKGYEAATMKEIAHAAGVAPGL
FT                   IHYYFKSKDELLQEVLSEAGRRYIQQMQRFAEQYSGEALEQVTLAEPRERVEREPEWYR
FT                   LRSELFALGLHHPHFKPAAAAMLAAGRECIGGTIEKIARHKLAHPPEAVAAVLLATFDG
FT                   LATQKLADPDFDLEAAYRVLAEMFRSQLSG"
FT   CDS_pept        519340..520212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0482"
FT                   /note="ORF_ID:glr0482"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88423"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88423"
FT                   /db_xref="GOA:Q7NNC9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNC9"
FT                   /protein_id="BAC88423.1"
FT                   /translation="MEIFLTGATGYIGGAVARELLGRGHRVVGLVRNEDSARKLPEDPR
FT                   LLPLVADLADTAALAQAAREVDAVVHAGATGGSDGAEVDRRATFALLEALRGTAKPFLY
FT                   TSGVWIMGNTGGQVLDEAAPLDPTPLIAWRAELEAKLLAESGVRAVVVRPAVVYGRGGG
FT                   LVGGLVDSGREAGVVRYVGDGENRWPLVHVDDLARLYAAAIESGLSNTVFIAAAGPSLR
FT                   LKDIALAASRAAGIPGRVESWPLEAARQTLGAFADALALDQQVTAAKATRLLGWQSQAP
FT                   SLPDELARA"
FT   CDS_pept        520244..520714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0483"
FT                   /note="ORF_ID:glr0483"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88424"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88424"
FT                   /db_xref="GOA:Q7NNC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNC8"
FT                   /protein_id="BAC88424.1"
FT                   /translation="MNDPLPTALWLVSVLSTAVLYGTDVFFAVVGRDALAKSSTACLAD
FT                   VVARLHEVADERMPVFGATALASTFAFGLSLGLPTASGLLVLVTLAALLSQLGLYLAVA
FT                   RPVNRRMVQAVQTGQALPDARALQARWDSVIVARALSLTLALVTLLAAGVLR"
FT   CDS_pept        complement(521128..521895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0484"
FT                   /product="aminoglycoside N3'-acetyltransferase"
FT                   /note="ORF_ID:gll0484"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88425"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88425"
FT                   /db_xref="GOA:Q7NNC7"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNC7"
FT                   /protein_id="BAC88425.1"
FT                   /translation="MVTTRSALLEDLVRLDVGRGDLLMVHASIRSVGRIVGGVNVLAQA
FT                   MFDAIGPEGTLSAYVDFEPFYEDDDDPAEIPVFDKRIAHAARDHGILHETLRNWPGALR
FT                   SDHPDAGVVAIGPQAGWITGEHPFQYGYGEGSPFEKIVQAQGRVLLIGAPLDTITLLHY
FT                   AEHKANIPNKRIVRYRRRVPGEGGHRWVDFEEFDTAEPVSDALPANCFERIASDFLACG
FT                   FGRRGRVGAAESFLFEAPELIGFGIQWLERFFP"
FT   CDS_pept        complement(521961..522617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0485"
FT                   /product="TetR family transcriptional regulatory protein"
FT                   /note="ORF_ID:gll0485"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88426"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88426"
FT                   /db_xref="GOA:Q7NNC6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNC6"
FT                   /protein_id="BAC88426.1"
FT                   /translation="MAAARANPSASARRSTARGARTREEILHTAAQLASVEGLENLSLG
FT                   RLAAELGRSKSGLFAHFGSLTELQLAIVEQARAIFSAEVLERLSPQSRGLVALEQLCDA
FT                   WLGYIERGVFAGGCFFMAISTEFDSRPGPVREKLALIMGYWLRNLERRIREAQELGELP
FT                   TDIEPAQLAFEIHALGMGANWAFQLFDDPQALQRARLAIRERVAQLAGGPIGLQR"
FT   CDS_pept        complement(522629..523789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0486"
FT                   /note="ORF_ID:gll0486"
FT                   /note="permease protein DevC homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88427"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88427"
FT                   /db_xref="GOA:Q7NNC5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR005891"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNC5"
FT                   /protein_id="BAC88427.1"
FT                   /translation="MVRIRMPLAWLQLRRERTRLLVGVSGITFAVVLIFMQMGFRSALF
FT                   DSAVGMHSGLQGEIVLISPRSVALIAMEQFSERTLYQALGTEGVASVSPVYVESALWRN
FT                   PETRVTRNIRVYGFNPNEHVFALPGVAEQRALLKEPDTVLFDRGSRSEYGPVPRLIERQ
FT                   GEVVTEVDERRVRVRGLVTLGVSFGSDGHLITSDQNFLRIFGKRRTKGLVDIGLIRLVP
FT                   GTDTARVLADLRGRLPQNVRVLTKQEYKDFEVNYWNTSTPIGFTFTLGAIMGFVVGSII
FT                   VYQVLYTDVAEHLAEYATLKAIGYGDRYFLGVVFQSALILAALGFVPGLAIAWGLYELT
FT                   RSATLLPLFMVVDRSLLVLGLTFAMCLLSGVIAVRKLRDADPADIF"
FT   CDS_pept        complement(523782..524951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0487"
FT                   /note="ORF_ID:gll0487"
FT                   /note="permease protein DevB homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88428"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88428"
FT                   /db_xref="GOA:Q7NNC4"
FT                   /db_xref="InterPro:IPR014315"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNC4"
FT                   /protein_id="BAC88428.1"
FT                   /translation="MDVHSPDIAPSAIETASMQTQKPLIDAPEVPQAPAPKRQPSRRKA
FT                   IWLVGIPLTLLAIGGAIGIRQSLQPEPAPAIRPQVPTPPQAVTSLGRLEPEGEVISLSA
FT                   PTFLEGARVAQVRVEEGQPVRRGQVVAVLDRRDRLAAALAQASRQVEVAETRLAQVQAG
FT                   AKAGDLGAQRSAIARLAAEMRIAQRELQRFEALYDTGAISASQLDDKRLVVETLNGQLQ
FT                   QARSALVAIAEVRPTDLRAAAAEIAAARAAEARARAELDTAYVRALQEGRILKIRTRAG
FT                   EMVSGEPIAEMGRTERMEAVAEVYEDDLSRLRVGQKATVRSLNGAFSGRLRGTVYRIVP
FT                   LIGKKDVLDTDPAADVDARVAEVRIRLDAADSRRVADLTNLKVEVAIDG"
FT   CDS_pept        525056..525253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0488"
FT                   /note="ORF_ID:gsr0488"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88429"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88429"
FT                   /db_xref="GOA:Q7NNC3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNC3"
FT                   /protein_id="BAC88429.1"
FT                   /translation="MVRWFDLQAGYGAIARDDTGEEVFLLFTAIPGEGYRTIAPSTAVH
FT                   FELAQGPSGPVARNVQKSEP"
FT   CDS_pept        525429..526073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0489"
FT                   /note="ORF_ID:glr0489"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88430"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88430"
FT                   /db_xref="InterPro:IPR009666"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNC2"
FT                   /protein_id="BAC88430.1"
FT                   /translation="MGHFSTLSTKLADGKLIARTCRDMGFEVLTGEYAYVRGYAGQRTH
FT                   AEVVCALNGNYDLGFLPNENGSYDLIADLWGIAIKYNQTELINGIFKRYWLVGLIKPRD
FT                   NRPQRLLAANYDTWFRTGYTDTHLLAQRFQAMGFSLLGTHRTVPYLEAPVRAELAVERR
FT                   TPVEFLVDRSIRLLWVRNEQGSLDLNITCGWQNRSVLAELFNELGFVPHES"
FT   CDS_pept        complement(526510..528111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0490"
FT                   /product="phosphodiesterase/alkaline phosphatase D"
FT                   /note="ORF_ID:gll0490"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88431"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88431"
FT                   /db_xref="GOA:Q7NNC1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNC1"
FT                   /protein_id="BAC88431.1"
FT                   /translation="MRNSRPPLESFARKSLNRRQFLAVSGTLAGAFALALASGEDARSA
FT                   PSLGATPFTLGVASGDPLPTSIVLWTRLAPDPLVADGGMPARRVSVEWFVATDAGMRRI
FT                   VRRGTALASPELVHSVHVEVFGLEPSREYYYQFRYRSEYSPIGRTKTAPAAGSPLNSLA
FT                   FAIATCQKWDDGFYSPYRRMVEEDLDLVVHLGDYTYEYGIASGGVRGATLPDTFAPETV
FT                   TLDRYRLQHALYKTDPDLQAAHARFPWVVTWDDHEVENDYTDAISENFEPVETFLARRA
FT                   AAYKAYYEHLPLRRLSIPDGPNLRLYRRLAFGDLAEFNVLDTRQYRSDQPCGDGESDRC
FT                   EAALDPTKTMAGFDQERWLRQGLEGSGALWNVLAQQVLMAELNHDLEGGTRYWNDGWDG
FT                   YPVARQRLLRHIATQRIANPVVITGDWHSTFVSDLKLDFKNPDSLVVAAEFVTPSITTN
FT                   GDAIVYGPYYGPMIPQNPHIKFFDGDRRGYIRCHLDRERWLADIRYVESVSTPDSPIET
FT                   FASFVIENGQPGVQPA"
FT   CDS_pept        528201..528557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0491"
FT                   /note="ORF_ID:glr0491"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88432"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88432"
FT                   /db_xref="InterPro:IPR011719"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNC0"
FT                   /protein_id="BAC88432.1"
FT                   /translation="MHVMFIEYGMGLDLHGQDATVAAVRAARDAIGRSSLPGMRLVLPD
FT                   GDLGRMQVHVKLAVPVAAERVDVERVKQVFPYGQVSVEITPGGMLCTSGIVLTEHGDSE
FT                   DLVIIVNAAVEVGY"
FT   CDS_pept        complement(528551..529243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0492"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ORF_ID:gll0492"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88433"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88433"
FT                   /db_xref="GOA:Q7NNB9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNB9"
FT                   /protein_id="BAC88433.1"
FT                   /translation="MLIRLENIRKSYKLGNNEVPVLRGIDLDIDRGEYVAIMGPSGSGK
FT                   STLMNIIGCLDRPTSGNYFLNGSNVATLDRKALAQIRNREIGFVFQQFNLMARSDALEN
FT                   VMLPALYAGTPAKERKVRATELLERVGIGAQIHQRPNQLSGGQQQRVAVARALMNRPSI
FT                   LLADEPTGALDTRTGEEVLALFEELNAEGITVLVITHDQEVGDRARRMVRLRDGQLESE
FT                   ASQVMSAQ"
FT   CDS_pept        complement(529249..530481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0493"
FT                   /note="ORF_ID:gll0493"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88434"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88434"
FT                   /db_xref="GOA:Q7NNB8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNB8"
FT                   /protein_id="BAC88434.1"
FT                   /translation="MSWLENLKIAAVALWANWLRSVLTMLGLIIGVGSVVLIVAIGVGT
FT                   QKFVKDQFRSFGTNVVVVGEDRPPDGLTQNTDRRIRPLTIEDMEALRTQIGAISRASGI
FT                   LSENGRVVWNNKDADGRIYGMEPELARILNWSVRKGRFFTDKEVQQRARVAVLGEEIAD
FT                   ELFGTEQPVGKQILVNGRTMTVIGVLEKRSGAFRGYLQFLERGAIMPFTVVQESLISNV
FT                   TPFGRRVRIIFLETKPAETIEAVTFQVTNLLRARHQITAEDDFFVGNAQEILNVFNAIA
FT                   AGLTVMLGLIAAIALLVGGINIMNIMLVSVTERTREIGLRKALGASEGVILAQFVIEAV
FT                   LISVLGGLIGLGLGWGAAALVGALSPIKPEVTPMAVFLAVGVATGIGLFFGVFPARRAA
FT                   RLDPIVALRTE"
FT   CDS_pept        complement(530503..531630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0494"
FT                   /note="ORF_ID:gll0494"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88435"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88435"
FT                   /db_xref="GOA:Q7NNB7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNB7"
FT                   /protein_id="BAC88435.1"
FT                   /translation="MVGLIIGVGAVILVIALGVGAQNFVKDQFRGLGTNVVGVYDGGPR
FT                   TKGRRPLTLADVEAVRTQAPAVEAVAPLALGNASVSWGSRKSQAQLTGVPPNLERVTRL
FT                   GYSKGRFFSLGEVESRARVAILGETLAKKLFSFEDPIGKTIVVNNRQLTVVGVTRPSFG
FT                   GWIDVDRGVLVPLPLALESLIASDSPFGKKVGGFLAATKADSTIDQVTFELKNLLRLRH
FT                   NVTDKDDFLIGNIQETLDLFNNIALGVTVVLGLTAAISLVVSGIGIMNIMLVSVTERTR
FT                   EIGLRKALGASEEVILAQFVTEAVLLSVLGGLLGMAWGLAAAVAVGQFSPFKPEITPWS
FT                   VVLALGVSVATGLFFGVFPARRAARLDPIVALRSE"
FT   CDS_pept        complement(531732..533042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0495"
FT                   /note="ORF_ID:gll0495"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88436"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88436"
FT                   /db_xref="GOA:Q7NNB6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNB6"
FT                   /protein_id="BAC88436.1"
FT                   /translation="MATSQLNAEFKWPALWRWLLVGVGVVGVAVAIFTFAIPRPDPAAK
FT                   FEKFLTAAERISTDVRITSAGQVAPNRKVNVGPKEAGLLTKLYVDQGDAVREGQVLAQM
FT                   DASRIVSEVAAAKAARDLAAAQYQEARNGFRPQEIDQVRADLRAAQANVDIAGNNLVRE
FT                   ERLFTERAIAETQVINRRLEFSRAQDALKAAQEKFSLYKAGTRNEQVLAAKARLDQAEA
FT                   TYRNNRTRLADLTIRAPFSGIISQRYAQPGAFVSPTVNTSGDSANSSSILLLIDRLEVL
FT                   ATVAESDIARIKVGQPVQITTSAYPGTVFKGTVRLVAPEAVTESGITQFQVRVRLDDEA
FT                   ARTLKSRLNVTVNFVAGRVNGVLVVPTTALITRDGKTGVLVPDAKKGPTYREVGTGVSL
FT                   GDKTQILSGLSDGEKLFAKLPPDVNIEEVLGKSNDFR"
FT   CDS_pept        complement(533350..534222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0496"
FT                   /note="ORF_ID:gll0496"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88437"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88437"
FT                   /db_xref="InterPro:IPR016980"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNB5"
FT                   /protein_id="BAC88437.1"
FT                   /translation="MADIRFRPLWPGLVAGALLVTGAAGLAVYRPAAVGAEQVATAAIE
FT                   QQIRSAMANPVRTEQQRARDAYRHPLETLTFFGLRPEMTVVELWPGGGWYTTLLAPVVA
FT                   ERGKLVVSTFDANGPKESGMTRGARALNERLASDPKTYGKVQTVLIAPPDSLTLGPDNS
FT                   ADLVLTFRNIHNWAAAGYEDKVYAAAFKVLKKGGTFGVEEHRARPGVSVAESIKTGYMP
FT                   EDYVIKKIEAAGFKLTSKSEINANPRDTRDHVGGVWTLPPTLSQGEKDREKYLAIGESD
FT                   RMTLKFTKP"
FT   CDS_pept        534380..535561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0497"
FT                   /note="ORF_ID:glr0497"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88438"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88438"
FT                   /db_xref="GOA:Q7NNB4"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNB4"
FT                   /protein_id="BAC88438.1"
FT                   /translation="MSSNANNPLAKGLLGAGWRPLGRSLDWEYLGHLALRDTWKLSQKT
FT                   LDIASDLADALSRREHPWWANLLNAFSENMQYELDEYWDYITPEPAAPDYRFKDTLSID
FT                   RPVVQAVGRDSIPIDYVLNRLQETVILRILALLGRPDSITQYYLDRHFEFPVEQFVDWD
FT                   RMLVPGTLFAYWSAHQVWLKICLSQQQGKQQYSLIAIELLPLINKTAYNLAVMLSGYQS
FT                   RIGQLASPYAIRSFPQEVQAFTDAVQQAVLDGDHLAVLVHGEPGTGKTAWAQAVSKEIL
FT                   QPLGFVTFILDHDAVENFAPPAYLERVCLIVNEADNLAQNRASEVAQASGKTEHILGLL
FT                   DGTLYRSVIDESGLHAQQKLVVILTCNTTERLDPAVLRKGRIDLISQFTYRFV"
FT   CDS_pept        535558..536880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0498"
FT                   /product="DNA-damage-inducible protein"
FT                   /note="ORF_ID:glr0498"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88439"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88439"
FT                   /db_xref="GOA:Q7NNB3"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNB3"
FT                   /protein_id="BAC88439.1"
FT                   /translation="MSTQPVPAAPPLVGRFWRLSVVNVLSNLMVPLAGLISTAFLGHLP
FT                   QVSSLAGVALATVLFNYIYWTFGFLRMGTTGLTAQAAGQGDHDRVLLVAVRHWLLALAL
FT                   GIAIVLLQAPLRTVGFALLSAAPDVKEAAYRFYDALIWGAPATLINFVLVGWFLGREQS
FT                   GRVLVLTAITAFANVALDYLFIVQWGWQSAGAGAATAISQYLALAAGLAFVAVEVRPGA
FT                   VAKVAHRIFDLVELQAIFSLNRDLVVRTFVLVTILGTFTNLGAAMGTDVLAANAVLMQV
FT                   VSLAAYFIDGVAFATESLAGYFKGGGNFRQLRSLLYLAGAVSFTLGVAFALVFIAFPGP
FT                   LFGLLTDRAELIERLARHAIWLLPVLAVGSLTWMLDGYFLGLTESKILRTSAIGAAVGF
FT                   VPLAALAWQQQSEPLLWLAVTTYMVGRLIPLTLRVGTVGDR"
FT   CDS_pept        complement(537211..537912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0499"
FT                   /note="ORF_ID:gll0499"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88440"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88440"
FT                   /db_xref="GOA:Q7NNB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNB2"
FT                   /protein_id="BAC88440.1"
FT                   /translation="MTFFNFSEPVLRRKQHELDVQDQRGLLKIRWQIGRRALISTVFTR
FT                   LDQVFWGWGLVCALIFATAQFVPIDWNVQAVGWTLLSLAATTWMGVCTWFWAKVERATS
FT                   LVLGWGGLMLFGLVLTDFSIAVGWAEVMVHLGVLWLVLSAVGYGMSGFALRSRALLMAG
FT                   AVHLAAAAAALLLAEWQFLIAGGVLSGCLALLGSAQWDMRLPIDYELPQEALALNRTQH
FT                   ERRLAGSGASR"
FT   CDS_pept        537983..541042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0500"
FT                   /note="ORF_ID:glr0500"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88441"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88441"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNB1"
FT                   /protein_id="BAC88441.1"
FT                   /translation="MHLEAARRVRVWSNTRKAQAGAVPFWVVLPRVMRGLLWRDAVIRR
FT                   QDFPTPARIAAAGLLAGSLLLGSLSMARAFTQNPATVFINEIHYDNTGTDAGEAVEIAG
FT                   PAGTDLSGWSIVLYNGSGGAVYTTTALGGTIADQQNGFGTVAVSYPSNGIQNGSPDGIA
FT                   LVSPGGTVVQFLSYEGSFAATDGPASGLTSTDIGVAETGSEPLGLSLQLTGSGTVYQDF
FT                   AWAAPADDSFGQINGSQGFGGGPLPTLSVAVSPASFSEAAGAAAATGTVTRSGSAEAAV
FT                   SVNLSSSDGSEAVVPATVTIAAGASSAAFAVDAVDDAISDGSQAVTITAAAPGFATGTT
FT                   GLTVTDDEPVSVTPIREIQGKAQISPKNGQFVSNVPGIVTAKRSNGFYLQDPAPDSDEG
FT                   TSEAIFVFTSSAPTVAVGDSLTVSGTVTEFIPGGASTGNLSITEITSPAITVISSGNPL
FT                   PAPMVIGVGGRVPPTQVIDDDGLTSFDPAGDGIDFYESFEAMRVQVNGAVATSPTLTFN
FT                   EGESDENSEIIVLADGGAGAALRTTRGGIVIRPGDFNPERIFLGDAIARPGQILPKLNV
FT                   GDSFSGPVVGVLDYSFGNFKLLVTETLPGTASAGLTPEQTTLAAGGSQLTIASFNVENL
FT                   DPGDTERIAGLAAAVTGNLKSPDILVLQEVQDNNGPTDDGTVDSTTTLADLAAAIAGVG
FT                   GPAYNFRFINPVNNQDGGEPGGNIRVVFLFNPARVSFIDRPAPDGTDLSTTAVGAVDGP
FT                   SGLELTFSPGRIDPANPAFDDSRKPLVGEFLFNGRKLFVVGNHFNSKGGDTPLFGAAQP
FT                   PVLNSEPQRLGQATAVNSFVQSLLALDAKASVIVLGDLNDFQFSPPLATLQQGGILSNL
FT                   IDAVSPADAYTFNFQGNSQVLDHILLSGSLAAGAEIDIVHLDSEFADALSDHDPPLARL
FT                   DLVLAPLSVTGVSPTSGPVGTQITIAGTGFVAGGTTVRFRGGVEASAVAVNGDGTQLTV
FT                   TVPAGARSGRIAVRTGGRAVLTPGRFVVTP"
FT   CDS_pept        complement(541032..541967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0501"
FT                   /note="ORF_ID:gll0501"
FT                   /note="probable sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88442"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88442"
FT                   /db_xref="GOA:Q7NNB0"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNB0"
FT                   /protein_id="BAC88442.1"
FT                   /translation="MVVLVTGAAVVDILVSAPQELPAPGASRLTDTIALAAGGCGVNTA
FT                   IGLARLGVPVEFAAHLGADGAGEWIKAELSRAGVGLAHFRQSAEVATKSAVVLLSAAGE
FT                   RSFLRTRGGGNAIARADLEHLDWSGIGHLHIGGCYSLRRLLGEDLAAVLRSARRAGVVT
FT                   CLDTVWSSDGNWEALLPALGQIDHLLPSLAEARAITGESTPQAMARWLIAHGSTRVIIK
FT                   LGERGAYACGPDIDAVVPALPVPGGRVIDTTGAGDAFCAGYLAALAEGLTAPRAVRWAN
FT                   AWGAVAVSGLGATAALRDRSQLEALVVPTE"
FT   CDS_pept        complement(541974..542936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0502"
FT                   /product="fructokinase"
FT                   /note="ORF_ID:gll0502"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88443"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88443"
FT                   /db_xref="GOA:Q7NNA9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNA9"
FT                   /protein_id="BAC88443.1"
FT                   /translation="MSTHVLCLGEMLLDCLADQPDRPEAQVASWTSYPGGAPANVACAL
FT                   AAIGGKSCFVGCLGADPEGERLLAVLERSGVNTAGVQRAPWPTRKVYVTRTAAGERTFA
FT                   SFGGHPPDAFADTHLQAEKITPDLFDGAAFLTLGTLMMAFPDSARAVEGALDLADERFV
FT                   KICLDVNWRPVFWEQPEQAPAVVRGLIERCDVLKVSEEEAEWLGMPSIEAITAAFDHLE
FT                   GILLTRGENGCLWQVGERRGEHLGYRVPTVDTTGAGDAFVAALLHRLSRAPLRAWESEA
FT                   AAVVDYACAAGALSTMIPGGIGSTPDEAAVQAFLRAQAL"
FT   CDS_pept        542935..543759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0503"
FT                   /note="ORF_ID:glr0503"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88444"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88444"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNA8"
FT                   /protein_id="BAC88444.1"
FT                   /translation="MDEQGQGRLRLPHEIDPNEAAFDSLSAEYDERYALSAVGCLQRRQ
FT                   VWRRIAGLFLPGGRILELGCGTGLDAEYLAGLGVQVLATDLSPAMAALAARRCRELPAV
FT                   AVRVLAAEQIGTLEDTFEGVFSNFAALNCVLDLNAFAAALAARLRPGGAAALVLFGRLC
FT                   WWEMAGYGLRGRWPEATRRLRPGVVRASIGSGREVALRYYSPTQVRRAFSPWFRLEATA
FT                   AVGFAVPPTYWDGFVRARPRLLAFGQRVDRAVGGLWPFNRCGDHTLYVLRRR"
FT   CDS_pept        543806..545095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0504"
FT                   /note="ORF_ID:glr0504"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88445"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88445"
FT                   /db_xref="GOA:Q7NNA7"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="InterPro:IPR016991"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNA7"
FT                   /protein_id="BAC88445.1"
FT                   /translation="MQVAATSIKPAGTGGWKLALTIVHYVLPPIVGALIGFTSDTLAIK
FT                   MLFRPYKPKYFLGRQIPLTPGLFPKGQERFARKVAQMLTDKLLTPDEVHRIAQRLLTPE
FT                   RLEEGLRFALLYALGEYSDGRKRARLAVALGDILQEVFSESLPKWIDALSRSSASNKIF
FT                   EQIFDQVAGSLRIEEAQAVRLAEWIEKNVFTPDRLRLALINLLTNQTIDTLDKEARERA
FT                   QGGLWLVANVVGIKGPLSRFKSFCVEQPEAANELFTRFLAEAEVRERLTGALNGLSVQT
FT                   LSMATVQDLKRQFVTSLTAALSAQGPGLSQRLGESIDWSRWAAEVLDRVVTSEKTLGWI
FT                   DRIAEGSSRLLDRYLTRELEPLVMKFLPALGLEQMVITKICNTSPQELEAAIEQVARNE
FT                   LRAIPYVGMVLGFCVGLFEVFLITVVIPVG"
FT   CDS_pept        545170..545844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0505"
FT                   /note="ORF_ID:glr0505"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88446"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88446"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNA6"
FT                   /protein_id="BAC88446.1"
FT                   /translation="MFALISPERIELPPGAVVRMPATWQEYQSLTERRGDKATPRIRYC
FT                   AGEVLLMSPLPKHGRDANLMADVVKALLDHLGRDYDAYTPVTMQLPQETGIEPDYCFYI
FT                   DHWRAVAGKDRINWQTDPPPDLALEVDVTSYTNINSYLPYFVPEVWLLKEKLLEIYQLR
FT                   VDKYQLQDTSLYFPEFNLRSIVEDALQLAYSRNSGSAIQRLRQRLSAGNYGCTGRISSE
FT                   ET"
FT   CDS_pept        complement(546096..546542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0506"
FT                   /product="bacterioferritin comigratory protein"
FT                   /note="ORF_ID:gll0506"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88447"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88447"
FT                   /db_xref="GOA:Q7NNA5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNA5"
FT                   /protein_id="BAC88447.1"
FT                   /translation="MAIEVGRPAPDFTLDGSQGPVTLSQYRGKNNVLLAFYPGDFTPVC
FT                   TKELTCFVEDWSKFQGKDTVILGISSGSVDSKSKFAQSLGAQFPLLSDGEKRVAGLYDV
FT                   SGFLGVARAYFIVDKQGVLRYKHVEALPFFKREDEELLGVLAEL"
FT   CDS_pept        546607..546870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0507"
FT                   /note="ORF_ID:gsr0507"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88448"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88448"
FT                   /db_xref="GOA:Q7NNA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNA4"
FT                   /protein_id="BAC88448.1"
FT                   /translation="MLWVFYSLLTFFLAVSIGLMLPVAPMTMVHHGASWQMIAAVVGSV
FT                   VFLALPFRAFQTGKFSPPLTTLGFICLGLALNGWVYVANGAK"
FT   CDS_pept        complement(546904..547674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0508"
FT                   /note="ORF_ID:gll0508"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88449"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88449"
FT                   /db_xref="GOA:Q7NNA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNA3"
FT                   /protein_id="BAC88449.1"
FT                   /translation="MIPPLWVAGPAELTGALAQSCRRWGGEVRVLESSSLQALDPAGRI
FT                   IWLARPDSTSPATALFERCADLAPTEVPLALPDSTASLLVLPLVITARGVLYAEAIGMA
FT                   GEYLWQPEPLSDKARQILYRFARGLIDLSEPLPPGVYMVYFTVICGAVRFEKLIPHPDR
FT                   TALVTLTSQRPDLFCCHWRCALGLPVVDLQVHRPTAAAFVGDWPDDLPLRAALEPEASL
FT                   DAAAGLVLVQAPTLQQARSKVQTLLGETDADAGR"
FT   CDS_pept        complement(547671..548114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0509"
FT                   /note="ORF_ID:gll0509"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88450"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88450"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNA2"
FT                   /protein_id="BAC88450.1"
FT                   /translation="MDRKLEPATDAWPLPPLTRGTLLDQLAAELAACRRHHRTLADQLE
FT                   AARAEADEREAVVRELTEQVRVLGEENRRLEALLREVPDVYRRKFSERLEAVAERIERL
FT                   LAENAHLRRTAAADARRWAALEALMAAQPQSPPRLAPPPVGGR"
FT   CDS_pept        complement(548143..549807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx"
FT                   /product="exopolyphosphatase"
FT                   /note="ORF_ID:gll0510"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88451"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88451"
FT                   /db_xref="GOA:Q7NNA1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NNA1"
FT                   /protein_id="BAC88451.1"
FT                   /translation="MPEPAADAEKTLAAIDIGTNSIHMVVVHIQPRLASYTIVAREKQM
FT                   VRLGEYCQKTGWLTPEAMVRALDALRHCKAFAEGLGAQEMIAVATSAVREAPNGPEFLL
FT                   QIQRVVGLKVDLISGEEEARRIYLGVLSAIEFDNRTHAVIDIGGGSTELILGDGREPRY
FT                   LASVKAGAVRLSEQFVQSDPISGRDYGRLRNQVRNLIEPAVDKLLALGPFERLVGTSGT
FT                   IMTLAEIDARRGGSFPTSLQGYELTLASLEQIAAQLRELDLEARRRLPGVSERRADIIV
FT                   AGATILLEAMQMLGVGSITVCEAALREGLIVDWMIGRGLIADRLRYQGSVRERSVLQLA
FT                   DKFNLDTTHAEQVTRLSLSLFDQSRGRLHRWSDADRELLWAAAMLHNCGHFINHSSHHK
FT                   HSYYLIRHGGMLGFTEEEIEVIANVARYHRKSTPKSKHREFQHLVKEHKRLVRQMSVFL
FT                   RLASALDRRHKGAVRGVRLAFAPGEVELFVQPHDPADPCEMELWNAEFKKAEFEQEFGR
FT                   TLAIALESAVAEPLAVLGAKAETQPDAVRVPQGSWVS"
FT   CDS_pept        complement(549944..550066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petG"
FT                   /product="cytochrome b6-f complex subunit 5"
FT                   /note="ORF_ID:gsl0511"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88452"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88452"
FT                   /db_xref="GOA:Q7NNA0"
FT                   /db_xref="InterPro:IPR003683"
FT                   /db_xref="InterPro:IPR036099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NNA0"
FT                   /protein_id="BAC88452.1"
FT                   /translation="MIEPILLGMVLGFVPVTIAGLLVAAWLQYKQGNPSGLGEK"
FT   CDS_pept        complement(550163..550687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /product="adenylylsulfate kinase"
FT                   /note="ORF_ID:gll0512"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88453"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88453"
FT                   /db_xref="GOA:Q7NN99"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN99"
FT                   /protein_id="BAC88453.1"
FT                   /translation="MGKGVTLWFTGLSGAGKSTISGIVAKKLQEIGRNVEVLDGDEVRL
FT                   NLSAGLSFSKADRDTNVRRIGYVCRLLSRNGVIAISAAISPYRNTREELRANIIDFLEI
FT                   FVDCPLDVCIERDVKGLYAKALKGEIPAFTGVSDPYEAPANPDLTILTNTESKDESANR
FT                   VVQLLYERGYL"
FT   CDS_pept        550839..552197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0513"
FT                   /note="ORF_ID:glr0513"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88454"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88454"
FT                   /db_xref="GOA:Q7NN98"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN98"
FT                   /protein_id="BAC88454.1"
FT                   /translation="MVRLLHISDIHLGSGLSHGRINPATGLHTRFEDFLYCLSQAIDRG
FT                   LAEGVDLALFGGDAFPNATPEPTHQEEFARQFKRLTDAGIPTVLLVGNHDLHGRGVGGA
FT                   SLNIYAALQVPGFVVGSRLQIHPIATRSGPVQVLSLPWVNRSTLLTREEMRGKSLEQVD
FT                   LALVERMKLALEAQVRRLDPAVPTVLLGHLMVENAVFGAERHLAVGRSFSIPLAMLARS
FT                   EFDYVALGHVHRHQVLCEDPPIIYPGSIERVDFGEEKESKGFILAEVERGRCRYEFVSV
FT                   PARSFKTIQANLADSGDPQGDLAAILRKHKIEGAIVRVLYRLHPHQIERIDTASLRQML
FT                   EGAFSYQLQPELISQLSQPRVPGLGESCALDPIDALRQYLESRPELADLRLALVEAAEA
FT                   LIKGDSPGLADTDECESDAEVLEVTTTAALDLLAREEGLPAGGTNGQLGLFHA"
FT   CDS_pept        552338..553597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0514"
FT                   /product="Na+/H+-exchanging protein"
FT                   /note="ORF_ID:glr0514"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88455"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88455"
FT                   /db_xref="GOA:Q7NN97"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN97"
FT                   /protein_id="BAC88455.1"
FT                   /translation="MSTGATQRSYAMFYPLIAASAPGALPEGLLSLGQLLASLIVIYVA
FT                   SKLGGELALRLRQPAVLGELVAGLAVGISGLKLIDPTQPVLLLLAQVGVTLLLFEIGLE
FT                   SDLRGLLKLGPQAVAVAAVGMAVPFALGYGVMKFAGAGELLAIFVGASSTATSIGISAK
FT                   VLSDLGYLKRTEGQIILGAAVLDDILGVIILSVVAGIAQGGSLELGEVARIVFSSLGFL
FT                   VGAIVIGNRFMPVFLGIVRRLRTRGELLTASLVFAFALAYLAELLGSAAIIGAFAAGLV
FT                   LAETDKRHDLEAQLRPVTDFFLPIFFITVGAGVNLALLGNQQALLLAGGLSVTAVLGKL
FT                   VCGWAAFGVKANKLAIGAGMVPRGEVGLVFASVGLASGVLTGVNHTAVVIMVILTTFFG
FT                   PLLLGLLLRREPVALTAGSS"
FT   CDS_pept        553622..554983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0515"
FT                   /note="ORF_ID:glr0515"
FT                   /note="probable Na+-transporting ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88456"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88456"
FT                   /db_xref="GOA:Q7NN96"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN96"
FT                   /protein_id="BAC88456.1"
FT                   /translation="MPTLSPARTICLGFLLVIAIGTSLLLLPWSTASGEWTPWLVALFT
FT                   STSAVCVTGLAVVDTGSYYSFFGQLVILLLIQVGGLGYMSATTFLLLLVGRRISLRNRL
FT                   ALQEALGSLGDKAVPRLVARVAILTLGFELVGALVIAPTMVRQEGLLPGLWSAIFHSVS
FT                   AFNNAGFGLRSDNLIPWQNNFWVLGGLGFLILAGGLGYQVWIELYEKILLRLVRQIFGK
FT                   QPAPPAPLSLHTRVVLLTSAILVVVGSVGFFLIERTNALTLGRLSLDAQVAGAIFHSIS
FT                   ARTAGFNAVPFDGLLEAGLFWIILLMLIGASPASTGGGLKTTTFAILVSNMLAVIQGRE
FT                   DVLLFDRRLGVGAVRKASAVLLGSIAAIAVALVGLTLSDPEPGFVQVLFEAVSAFCTVG
FT                   LSTGITPKLSVVGQLILVFSMYLGRVGVLLLAEALLSQKPTFPYRQPEEQILIG"
FT   CDS_pept        554988..555719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0516"
FT                   /note="ORF_ID:glr0516"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88457"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88457"
FT                   /db_xref="GOA:Q7NN95"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN95"
FT                   /protein_id="BAC88457.1"
FT                   /translation="MNLMGWLKKERRNQFLIIGLGRFGTSVARTLHNLGYDVLAVDAEE
FT                   ERVRRAACENIATQVLQVNATDPDALKQIGAGEFQVAVVAIGSFLQESILATLNAKEMG
FT                   IAYVVAKATTPIHGAVLEKVGADRVVYPESDMGRNVALSLTSRGMLESLQLDPEHSIVE
FT                   VVAPREFTGQTLRDLDLRRRFRVNVLALRHDGRFNVNPDPDDRIGAGDIIVMIGANRDL
FT                   DQLPKADLTMPDHAARTRAES"
FT   mobile_element  complement(555722..555852)
FT                   /mobile_element_type="insertion sequence:ISGL13c"
FT   CDS_pept        556087..556818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0517"
FT                   /note="ORF_ID:glr0517"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88458"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88458"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN94"
FT                   /protein_id="BAC88458.1"
FT                   /translation="MVQFDSQLRLPTALELPDSDDIPVDNELQIPVAAVLRAILTLLWQ
FT                   HRQDWFFGVNMGIFADTERPRIPIVPDGFLSLNVPRFRPQYGERGRPSYVLWEEDGIMP
FT                   YLVLEVVSQTYGGEYDTKLQDYQALEVLYYVVYDPEGFQPEHARLEVHRLVNGAYARLE
FT                   GEPVWLPEIELGLGRARGTVDGWTREWLYWFSKEGERYPVPEEFQRYRADLAEARAEQA
FT                   ERQAKALAERLQALEIDPDTL"
FT   mobile_element  complement(556822..558217)
FT                   /mobile_element_type="insertion sequence:ISGL5b"
FT   CDS_pept        complement(556855..557763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0518"
FT                   /note="ORF_ID:gll0518"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88459"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88459"
FT                   /db_xref="GOA:Q7M7E5"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M7E5"
FT                   /protein_id="BAC88459.1"
FT                   /translation="MTTRDIQAQLQEMYGVEVSPTLISNVTDAVMDEVRQWQNRPLETV
FT                   YPIAYFDCLQVKVRDNGRVVNKAVYLALGVDLEGRKELLGLWLSAHEGAKFWLGILTEL
FT                   NNRGLKDILIACVDGLTGLPEAIESVYHGCLVQLCMVHMVRNSCKYVSWKDRKSLCADL
FT                   RSIYSAATEEEAELHLGGVVPTPLELLSEKWDKQYSSVSRMWRENWGSLPQRPWVRVIP
FT                   IFRFGEDIRKVIYTTNAIESLNMTIRKVSRNHHIMPNDESVMKMVYLAIQNQMKKWTMP
FT                   IRDWRPALNRLTIEFEGRLKV"
FT   CDS_pept        complement(557792..558193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0519"
FT                   /note="ORF_ID:gll0519"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88460"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88460"
FT                   /db_xref="GOA:Q7M7C1"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M7C1"
FT                   /protein_id="BAC88460.1"
FT                   /translation="MVAAKKVQYSLRQEELMTIRKEILDELLKDYDGTDPQTILGEGGL
FT                   LKQLTKAVIERALEAEMETHLGYKKHEAAGKGTGNSRNGKSQKTLQAECGPVELHIPRD
FT                   RNAEFEPVVVRKGHTRWINGWSDTPGGTR"
FT   CDS_pept        558247..558447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0520"
FT                   /note="ORF_ID:gsr0520"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88461"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88461"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN93"
FT                   /protein_id="BAC88461.1"
FT                   /translation="MPFLLPLYPWPTPEQAMACFVICCRLTFLLQPVQLVRLDTRYNEV
FT                   YILAGESFQVVISATGYVRYL"
FT   CDS_pept        complement(558625..560628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0521"
FT                   /note="ORF_ID:gll0521"
FT                   /note="probable transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88462"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88462"
FT                   /db_xref="GOA:Q7NN92"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN92"
FT                   /protein_id="BAC88462.1"
FT                   /translation="MTPMPFRFKTRTLLIAASLAGALGLAWVAFPKPPTEDSPLVALSS
FT                   QDRSGRYRRGSAAFVRGDYAEARRQLAGLAASYPALAERIGLKLAVASGEGRRWLEAHP
FT                   KSPLVPDALALLARQDRAALLPLLNGYPDHYRTREALERALVRDPDDHTLAGALLARFP
FT                   ESTLAYAMATRREKIGELSPAEWQLVASIYRRVNAKQALAAYERAPATPENLLERARLQ
FT                   RKLGDKPAARELYELVLRRFPESPLVLDAAFERAELLGAGEAFAALEPWERASAERGDE
FT                   VLWARSQIAARRLDAPEMAIPLYRRLVERYPQSAKAPNAAWELAAQSAERGNTGAARSY
FT                   ARWLVRNHPADPFAPKAAFWLGKWAEQAGATAEARSQFREVLKRYPRSYYAWRSAARLG
FT                   LADGSYNIDQSVVSVRWSQPPLPLAGTSAALRELLALGEISEAEQQWQSETYRCKLSPT
FT                   QKLAESQLRARLGQHLRSINQATLTLFAEPPADPRAWEQAYPLFYAPGLRQWSQERNLN
FT                   PLLVASLIRQESRFEPAIRSRSGAMGLMQIMPATARFIAEREPGQFELTNPVDNLRLGT
FT                   WYLRYTHERFGGSTMLALASYNAGPGNVSKWLKRNPVTDEEDFIEQIPFKETRFYVVNI
FT                   YENYWNYLRLYTSQGRKALAAIDGRTAMDGSN"
FT   CDS_pept        complement(560625..562385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0522"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /note="ORF_ID:gll0522"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88463"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88463"
FT                   /db_xref="GOA:Q7NN91"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN91"
FT                   /protein_id="BAC88463.1"
FT                   /translation="MSAMRFATALFVSVWLGVPQAAAALRLVYPPDGHRTESASIYFIG
FT                   TAPGAGSLQVNGQKVARHPAGHFAWTVPLQSGINTFRWTFRGTHGASETVERQVIRQSP
FT                   NPPVPGDRLFLEARLPRGEQRVLPFEPVCFEARATPGGQLQARVGEQSIALAEAAPFRE
FT                   PGDAAAVLSGGAAGRSLVGFYRGCLAAAESWRDVEPRLDFRRRGQVLSSPVPATITSLD
FT                   PRQLTVIEVTAAEAIVRAGPGAEFARLSPLTRGVRSRVTAVSGDWLRLQGEGWIARADG
FT                   MALPVGTALPTSAVGALRTRVTTAGSELIVPLEMRLPASVRQEEHRLIVTLWGAQARTD
FT                   LIRFDAPDPLIRSVQWETVSPEGVRFYIDLRERRQWGYQLRYEDNALVVALRKGPRVGR
FT                   GLAGARVMIDPGHGGAQTGSIGPSGIPEKTVNLAIALRLGEQLRRAGAEVLFTRTADVD
FT                   VPLAERSRMLEAKQPTVFLSLHHNALPDAGDPLRQYGTSVYWYHMQSRELAEVLHRQLL
FT                   RDLGRPDYGLYWDSLAVIRPTAAPAVLLELGFMTHPDEYTLITAPAYQERIARALTRGL
FT                   ERWLHAERPE"
FT   CDS_pept        562492..562833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0523"
FT                   /note="ORF_ID:glr0523"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88464"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88464"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN90"
FT                   /protein_id="BAC88464.1"
FT                   /translation="MLTYARVLSLSEGGHFTPFAHLNHRIIRFLCHSLDASENRDELLG
FT                   EAIENAKLHFSLRSAHRAYEVFGSSYTQFVEQGVCGERLDERLVCDLYAVYRRRLESDV
FT                   AEYLKMRLA"
FT   CDS_pept        complement(562840..563673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0524"
FT                   /product="prephenate dehydratase"
FT                   /note="ORF_ID:gll0524"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88465"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88465"
FT                   /db_xref="GOA:Q7NN89"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN89"
FT                   /protein_id="BAC88465.1"
FT                   /translation="MILRVAFLGPSGTYAEEATLALLGNECERLAHPSIQGTLRAAAAG
FT                   EVDCAVVPVENAVEGTVSATLDTLWLYPQLRVRRALVLPVRHCLIGPVQHLTDIQAVYS
FT                   HPQALAQCQGWLEEHLGAVERIPTASTSEALRHIGAHTAAIASERAARLHGLRVIFRAI
FT                   NDHPDNCTRFWLVSEKPLTETLPPPGGCTSIAFALRRNQPGVLHEVLSIFARHRINLAK
FT                   IESRPTKKVIGEYLFFADLEGGVEAEPVNTALRQVAAVVAELNILGSYAVEQSGG"
FT   CDS_pept        complement(563683..564891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0525"
FT                   /note="ORF_ID:gll0525"
FT                   /note="probable NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88466"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88466"
FT                   /db_xref="GOA:Q7NN88"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN88"
FT                   /protein_id="BAC88466.1"
FT                   /translation="MQTIVVGGGYAGLRAVQLLAGQNLPVILVEPRREHILRPRLVAAA
FT                   AGRTALKEVSVPLARVLPTGVRHLQATALGFDPETAAVETDYEMLQGDRLVIAVGSEAN
FT                   LSASGAPRYTLPLYSLEDLQQALSHWARLEDALQRERCDLSLLRWVIVGGGITGVELAA
FT                   ELVHLARRWRNRYGGLAEAIQIHLIQRGSRLLPDWPVQASDWVTRWLKRHRVIVQTATA
FT                   VRRVRADGVVLEGPAGPEELATQTVFWTGGSRPVRLEEEPADLRDKSQFLRVDPYLRLV
FT                   DYPRTYAIGDSVLPFNPQLNRTLPPCGQLAVRSAEVAAANIVAESRGEALTAFVPTIER
FT                   IALSLGAFDGLAVVDGQVLTGTAGWTVAQAADLFYFNAIQNPLLARMAPELFSGTGLPS
FT                   ERQ"
FT   CDS_pept        complement(565050..565406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0526"
FT                   /note="ORF_ID:gll0526"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88467"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88467"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN87"
FT                   /protein_id="BAC88467.1"
FT                   /translation="MIQPLSSVVRQPLQSGDPYARTVRAKAALQVWLQQLDRFFRPENV
FT                   ADGQMGDGFEHSGVESPRSHCPDGALALAQNVPQIDLRIRTLRIHRVISKIENKDPQLL
FT                   KLPPWKTGSVSHYV"
FT   tRNA            complement(565548..565619)
FT                   /product="trnG-GCC"
FT   CDS_pept        complement(565663..565887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0527"
FT                   /note="ORF_ID:gsl0527"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88468"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88468"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN86"
FT                   /protein_id="BAC88468.1"
FT                   /translation="MTRISREQLNRISNFTNSSHRMRARVVVNRFWWDSFGRTYRNSAD
FT                   LLLLDEPQAEALLDLLTQEWESDPALSAG"
FT   CDS_pept        complement(565895..566884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0528"
FT                   /note="ORF_ID:gll0528"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88469"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88469"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN85"
FT                   /protein_id="BAC88469.1"
FT                   /translation="MMATIRVGLLGYGGLGQAAARMLAVKKQMILVAAADSKGYAYHPE
FT                   GLDAARLSLAVSRHGSVGYDPAVGVPADAPIQALLEQQVPADGYFLALPNLPNTFMASV
FT                   ARTFITSGWRGVLVDAIKRTSAVEQLLTLAPDLQRAGITYVTGCGATPGLLTAAAALAA
FT                   QSFSEVLSVQITFGVGIANWEAYRSTVREDIAHLEGYSVERARAMSDAQVSELLDRTGG
FT                   LLTLEKMEHADDILLELAGICGRERVSVGGVVDTRNPQKPLSTNVRVTGRTFEGKTSTH
FT                   TFTLGDETSMAANVCGPALGYLKAGIEMHRRGHHGIWSSAELMPRFVG"
FT   CDS_pept        complement(566969..567595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiX"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="ORF_ID:gll0529"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88470"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88470"
FT                   /db_xref="GOA:Q7NN84"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN84"
FT                   /protein_id="BAC88470.1"
FT                   /translation="MQTQAPSSRPIVLGVAGASGLIYAVRTVRFLLAAGHAVDLVASRA
FT                   SFMVWREEMGTAMPVEPAEQERFWREQSGESGGKLRCHAFANLAASIASGSYRTRGMLV
FT                   IPCSMSTVGKLAAGLSSDLLERAADVQLKEGRPLVLVPRETPFSLIHLRNLTALAEAGA
FT                   RIVPAIPAWYQQPKTIEDLVDFVIGRALDQLDIDHSLFERWHPDT"
FT   CDS_pept        567754..568770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap1"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /note="ORF_ID:glr0530"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88471"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88471"
FT                   /db_xref="GOA:Q7NN83"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN83"
FT                   /protein_id="BAC88471.1"
FT                   /translation="MTIKVAINGFGRIGRNFLRCWLGRKQSDFEVVAINDTSDPNTNAH
FT                   LLKYDSMLGQFSGEVSADENSLTANGHTIKCFSDRNPLNLPWKDWGVDLVIESTGVFTS
FT                   RDGASKHLAAGAKKVLITAPGKNDDGTFVMGVNDHNYDPEKHTIISNASCTTNCLAPVA
FT                   KVLHENFKIVKGTMTTIHSYTGDQRLLDASHRDWRRARAAALSIVPTSTGAAKAIGLVL
FT                   PELKGKLDGLAFRVPTPNVSVVDLVVEVEKPTLVEQVNHVLKEASENELKGILAFSEIP
FT                   LVSIDYRITDVSSIVDAQLTMVLKDNLVKVISWYDNEWGYSQRVVDLAELVARKWAA"
FT   CDS_pept        complement(568825..569193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0531"
FT                   /note="ORF_ID:gll0531"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88472"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88472"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN82"
FT                   /protein_id="BAC88472.1"
FT                   /translation="MCPMANFYDLKHYIAHYINKGRCLVSEKGKITTFSERVYDRRGNY
FT                   SEQFNHFIDRLLESGEFFHLYVEGDGYAFSDLIHSRFDLEYCVRCREPIPVPTNGALGP
FT                   PACYLCPEFEPQQEAQVS"
FT   CDS_pept        569381..569968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0532"
FT                   /note="ORF_ID:glr0532"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88473"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88473"
FT                   /db_xref="GOA:Q7NN81"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NN81"
FT                   /protein_id="BAC88473.1"
FT                   /translation="MMRFLILATNNQGKLQELRRLLAGTGWVVQAAPPDFAVEETGTTF
FT                   AENARLKALAAAERTGEWSVGDDSGLAVDALGGAPGVYSARYGRNDGERISRLLAALAG
FT                   QADRGARFICAIALAEPGRVLKEVEAECRGVILHAPRGNGGFGYDPIFLVPELDKTFAE
FT                   LDIVEKERHSHRGRAVRKLLSGCSRGTFIVDH"
FT   CDS_pept        570250..570924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0533"
FT                   /note="ORF_ID:glr0533"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88474"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88474"
FT                   /db_xref="GOA:Q7NN80"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN80"
FT                   /protein_id="BAC88474.1"
FT                   /translation="MEESFLFLALVLGMRHGMDADHLAAIDGLARVHPGPWNGLLFALG
FT                   HGAVVTLLAVGVGGAVAAVAGGWSPWLLIALGALNLWRLANPHPVRVPRLVTTGPLLLG
FT                   VLLAAGFETASQLSALALSNRADPLLLGTAFSLGMILVDGTDGYLASRVQRASASGGRR
FT                   TRIASRALGVAVVVFSFGLGGAQLLGFDFEPYSLAAGGGLFALLVALRLWSVEKPALDE
FT                   SK"
FT   CDS_pept        570945..572294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0534"
FT                   /note="ORF_ID:glr0534"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88475"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88475"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN79"
FT                   /protein_id="BAC88475.1"
FT                   /translation="MESNRVPVTVLTGFLGSGKTTLLNRILTEEHGKRIAVIENEFGEI
FT                   GIDQALVVNAEEEIFEMNNGCICCTVRGDLIRIIGSLMRRKDKFDHILVETTGLADPSP
FT                   VAQTFFVDDEMRSQLKLDGIVTVVDARHIWQHIDQSDQCKEQIAFADVILLNKTDLVTP
FT                   EELDTLEQRVRSMNALARVHRTQNAAVEMDRVLEIGGFDLERALAVKPTFLEPEYPFEW
FT                   GGIYELAAGTYTLALQDGPDSSMTLALFAAEGTDEAALEAAQQEAVPLFSQQAPPVHPK
FT                   GALVPQAAPVALNLAKAGAKDFFLEIQMAGTYSLFTQHRPEEFDLTVHAADGATRTPRI
FT                   GRTFEAGHTHDEEVTSVGIEVQGAVDPKKLSAWLSVLLREQGVDIFRTKGILHLQGDNR
FT                   RYVFQGVHMLFDSSADRPWGSDEPRTNQLVFIGRNLDRNRLVREFKACLV"
FT   CDS_pept        572282..573346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0535"
FT                   /product="WD-40 repeat protein"
FT                   /note="ORF_ID:glr0535"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88476"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88476"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN78"
FT                   /protein_id="BAC88476.1"
FT                   /translation="MSGLKRSRNSHTLAERWRTGLEDYVTATAWSADGTLLAAATASGP
FT                   VALLAGDTGEVAATLPGHPSGTLTLAWSPRDRYLATGGQDGRARLWDPTTGREMAALEG
FT                   GAAWVEHLAWSDAPYLLATAAGRRLNLWSADGQLIRTAEPPHTSTISGLVWHPGQRRFA
FT                   TSCYGAVRLHLPLKPEPADVFEYQGSLIALSWSPDGRWIVCGCQDATVHIWETTSGEDL
FT                   QMRGFETKVRNLSWEPGGRYLATASGMIITVWDFSGRGPANTRPRLLSAHQGSVTGLAY
FT                   QHRGGLLASGSSDGSVCLWNPLKQTKPVAFAQGNAPVDNLAWRPDDQSFVCGLASGEVS
FT                   AWGVPTEGRGFGRH"
FT   CDS_pept        573396..574103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0536"
FT                   /note="ORF_ID:glr0536"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88477"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88477"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN77"
FT                   /protein_id="BAC88477.1"
FT                   /translation="MQNQEPSIVFDQERAASYDKRFAKLAPLRDALHLLIRLVLSELPT
FT                   DARILCVGVGTGLELIDLAQTFPRWQFTAVEPAAPMLDICRQRAEESGIAPRCTFHEGY
FT                   LDSLPASPSFDAATCLLVSHFFAQQDERRNFFSQIASRLSPDGYLVSSDLASDMSTSAY
FT                   QSLLEVWIRMLRYSEVPAEEVEKFCASYGRDVAVLPPIEVESIIESSGFDAPVLFFQTL
FT                   LIHAWYAKRTPLS"
FT   CDS_pept        complement(574155..574367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0537"
FT                   /note="ORF_ID:gsl0537"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88478"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88478"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN76"
FT                   /protein_id="BAC88478.1"
FT                   /translation="MSHAAPERQGAWTDAVAALSAAAKLIPLAVSAVACAAGQYGYRGE
FT                   IRFDRKGPLPFDDHLEVLLLPTSEA"
FT   CDS_pept        complement(574700..575296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /note="ORF_ID:gll0538"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88479"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88479"
FT                   /db_xref="GOA:Q7NN75"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NN75"
FT                   /protein_id="BAC88479.1"
FT                   /translation="MELRLFVGLGNPGLQYTQTRHNAGFLAVDALAKRWQCSWVEKSRF
FT                   KGYLAEGAGPGGRAILLKPTTYMNHSGQSVRAVADYFRLPPQQLLVLYDEVALPLGKIR
FT                   LRPEGSAAGHNGIKSLIEHLGTNQFARLRIGIGREPPPPVLTNYVLGKFAPEEQEQLPA
FT                   ILDGCVEAVEAVLAKGLEKAMSIYNARSFGSPPDP"
FT   CDS_pept        575395..575748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0539"
FT                   /note="ORF_ID:glr0539"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88480"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88480"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN74"
FT                   /protein_id="BAC88480.1"
FT                   /translation="MSKGFSAPPNPEKEFSTWFFREYRRLSLSTLNDSLLGEAPSPVEA
FT                   RMKIARELPGCYWLAQQWPRVPNKNTILKLHARGKFESLSDINAFVLRSPEGDEIRRWA
FT                   RDHADPAFACSCC"
FT   CDS_pept        575748..576554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /product="dihydropteroate synthase"
FT                   /note="ORF_ID:glr0540"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88481"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88481"
FT                   /db_xref="GOA:Q7NN73"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN73"
FT                   /protein_id="BAC88481.1"
FT                   /translation="MTQIVGIVNITTDSFSDGGQFLDAERAIGHARRLRGEGAHWIDLG
FT                   AESSNPDGEQVTAEIEAERLAPVVAALSADGVSVAVDTCKSSVMVRCLELGARMINDIT
FT                   ALADPRSVEVLKTFRVPVVLMFARNRQARAEQRPGDCETVWNEIEAFFSGRIDRLLGAG
FT                   LQERQLILDPGMGFFLGSNPEPSLRVLAHVDRLGRFGLPVYLSVSRKSFIGSVLGGRPA
FT                   GGRDHGTLAAEIWAYLAGVDYLRTHAVAPLSDAIRVIAAIRAQALA"
FT   CDS_pept        complement(576608..577501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0541"
FT                   /note="ORF_ID:gll0541"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88482"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88482"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN72"
FT                   /protein_id="BAC88482.1"
FT                   /translation="MSIQEGVLKYSELINRPILDLRTTEELGRVDNLSTVEDAHRVAGI
FT                   IYKSGFLGGQKKTLLLSQIRAIGPDALMVNTDGETDEQIKSGESLVGHEVWTDGGSRIG
FT                   KITDFLFDGQTGVISHYLFAASGWSGITDGTYLLEASAITTPGKKRVIVNEAVAKSSTL
FT                   YSEGLKQRLGTALEQAKERSQSLTDQLKERTAALGEQAKGLVDQAKERGQVLGEQAKER
FT                   AAALGEQARELADQAIERGQSLVESTQERLHPPTTDVEATVVEEPQPLPPAEPVDSSVT
FT                   PSEPLEPQPKDPHTPH"
FT   CDS_pept        complement(577638..578903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0542"
FT                   /note="ORF_ID:gll0542"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88483"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88483"
FT                   /db_xref="GOA:Q7NN71"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NN71"
FT                   /protein_id="BAC88483.1"
FT                   /translation="MKLAYFDCPAGISGDMCLGALVDAGVPADYLIAQLAKLPMHDEYR
FT                   LHFERVVKNGVAATKARVPLGERAGHTHRHLPEIRALLETASLPPRAAEWSVRVFVALA
FT                   HAEALVHNTTPERVHFHEVGATDALVDVVGTCLGLDYLNIEALHCSALPVGGGLVHAAH
FT                   GVMPVPTPAVVRLWESRRVPVYSNRIHRELVTPTGAAIACALAASFGEMPSMAVLRVGL
FT                   GAGDMDLPIPNILRLWLGEATEPLLAARARTVTDVHAHAHHDHSHEEVVACLETQTDDL
FT                   NPQISGYLFERLLAAGAADVFTVPVGMKKSRPGTLMTVLCAPHLLSTCEEILLRETTTL
FT                   GVRRHFQVRSVLERHHEPVETIFGTVRIKVGSRDQQVLNAQPEFEDCRRLSEQTGQPLK
FT                   LVQQVALATWHQRRPTQSERQN"
FT   CDS_pept        579079..579474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0543"
FT                   /note="ORF_ID:glr0543"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88484"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88484"
FT                   /db_xref="GOA:Q7NN70"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN70"
FT                   /protein_id="BAC88484.1"
FT                   /translation="MTNGPVRPRLEFPTALLTLATPILTFVLFFALSFSVANDLGRAFL
FT                   ALLVAFIIILLVGFLVPAVYRRINRGSLLVHTSASFFFGLVSALFLTLGNLSPWIICWI
FT                   VLCLFWAYLPNPSFHRSLEENFGDLFN"
FT   CDS_pept        complement(579478..580011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0544"
FT                   /note="ORF_ID:gll0544"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88485"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88485"
FT                   /db_xref="GOA:Q7NN69"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="InterPro:IPR030816"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN69"
FT                   /protein_id="BAC88485.1"
FT                   /translation="MGVWEDFSQFLEGRLEEFLEKNPRLKLLVLLENVRQQEAEAEQQL
FT                   TQCQADMRRIQDEIVAVARDVQKWQDRIAQAKAGGREDLAQAAKERSDALLRRGNELWG
FT                   QMSVLKEQQQQTAAMLSRIAQKRQELEAHMAAQQGETAARSARSMGFEGSDDLDARFRD
FT                   WELEQELERLKRRK"
FT   CDS_pept        complement(580018..580650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0545"
FT                   /note="ORF_ID:gll0545"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88486"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88486"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN68"
FT                   /protein_id="BAC88486.1"
FT                   /translation="MGAQLQPHRAALESEAQAMIEDLFYRIEGLLAEAQRGDCEPAPLP
FT                   SVALAGAGISLATTAGFAAALVATLGTALWSAAKPAASLPMAIPAPIPATREPVPDPLT
FT                   QTQALAHRLARLPAATKDPFEPPRMLIAPVPAVAAASETLHPPARLVGVIETAGKPVAA
FT                   LLQLGERFGEHLPGGKVGKGWRLERIEADRVILKRKGHTHTLTIGGD"
FT   CDS_pept        complement(580691..581695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0546"
FT                   /note="ORF_ID:gll0546"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88487"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88487"
FT                   /db_xref="GOA:Q7NN67"
FT                   /db_xref="InterPro:IPR010903"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN67"
FT                   /protein_id="BAC88487.1"
FT                   /translation="MAPPAKTLLRRTASCSLALGLALGAVAFDGAEAWARRSSGGRIGG
FT                   GSFRAPSRSYTPAPSPRTYSPAPGGYYSPPPVMPVPVPIPGPGYYPPVGGGYAVGGPGI
FT                   GLSSILLIVVVVGAGFYVLRVIRRGASGAVGGQDGAYAAGFDPDKVEIFRLQVALLASA
FT                   KQLQRDLTRIAEEADTTTPEGLARLNQEVSLALLRNPEFWVYAKSDQQILPRLTAESQF
FT                   NRLALTERTKYTDETVSRSGEQSALVKKTFVNDNPDETAEYIVVTILVASESGVPTLEE
FT                   VRSSDQLRQALATIGSLSGEQIVALEIIWSPSDEKDTLTAEELLTQYTDLVRI"
FT   CDS_pept        581851..583065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /product="N-acetylornithine aminotransferase"
FT                   /note="ORF_ID:glr0547"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88488"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88488"
FT                   /db_xref="GOA:Q7NN66"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NN66"
FT                   /protein_id="BAC88488.1"
FT                   /translation="MVAVMTVQQAFEQHVMHTYARFSVVFERGEGCYLEDSEGRRYLDF
FT                   VAGIATCVLGHAHPVLSAAVAEQARTLIHVSNLYYTPQQACLAEWLTAHSAADQVFFCN
FT                   SGAEANEGAIKLARKYGRTVLGIAEPQIICAHQSFHGRTMATVTATGQPKYQKHFHPLV
FT                   PGFVHVPYNDFEALRAQVTDATAAVLIEPIQGEGGVVPGDVEFFQKLRRFCSERRILLM
FT                   LDEVQTGMGRTGRLFGYEHLGIEPDVFTLAKALGGGVPIGALCAKEAFAIFEPGDHAST
FT                   FGGNPLACAAALAVCQTLEAEQLVDNARERGAQLAAGLGRLVERFKPLVRTARGRGLMQ
FT                   GLVLSEPRAAEIVRLAMEQGLLLVSAGPEVIRFVPPLIVSAIEVDEALAILEGVFARLP
FT                   VTVTA"
FT   CDS_pept        583105..583929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0548"
FT                   /note="ORF_ID:glr0548"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88489"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88489"
FT                   /db_xref="GOA:Q7NN65"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN65"
FT                   /protein_id="BAC88489.1"
FT                   /translation="MQSLVLSPHPALAPFVTGYWFVEDLADANQGRPIRTTPHANAVLT
FT                   VHFGRPNADESGVAVPMVSLLGVQSRARTWHSGEGCYFVMVMLSVPGLARLFPQTGTDS
FT                   RNNWLDVGALLGGRVTNYLSDDLIGAWQPDRVTRRLDAWLLGRLASRGPVAEFERFEGA
FT                   WRTLRRTARIDAASAAVGVSPRQLERWFQLHIGQSPKQLICQERVIASLHATQTGTGDP
FT                   LAGFSDQAHQIRSWRRYLGTTPGHYTQTPTSEIAQHFSGDSHFASVGLAHYL"
FT   CDS_pept        583931..584773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0549"
FT                   /note="ORF_ID:glr0549"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88490"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88490"
FT                   /db_xref="GOA:Q7NN64"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN64"
FT                   /protein_id="BAC88490.1"
FT                   /translation="MEAAGGSHSFNTSGPSTHRLVALHSERQATMAVQTSAGIYAEFLD
FT                   YAADEVLCEAYVAHDGTDGSKHPCVIVAHDWSGQNASIRTATEQFVSYGYLGFALDVYG
FT                   KGVRGGETDDNSALMAPLMQDRALLRRRLLAAVAAAKRHPLVDPDRIAVVGYCFGGLCA
FT                   LDVARSATPDVPGVVSIHGVLQPPRIGVQASIRAKVLILHGWEDPMAPPADVLAVAQEL
FT                   TEAGADWQIHAYGHAMHSFSWPLANRPEVGIAYNSSAHKRSTIALQKFLEEIFKAVVS"
FT   CDS_pept        complement(584861..585289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0550"
FT                   /note="ORF_ID:gll0550"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88491"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88491"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN63"
FT                   /protein_id="BAC88491.1"
FT                   /translation="MAFLYDKDFAAWATRQAELLRQRRLAELDLDHLSEEIEELAARER
FT                   RALISSLKLILHHLLKWQYQPEKRSTSWEETIIRERGNVEDALDDMPSLRQLLTPEWID
FT                   KAYRRACRDANRETKLPDDAFPEQCPYALADILGDWWP"
FT   CDS_pept        complement(585337..586410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0551"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="ORF_ID:gll0551"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88492"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88492"
FT                   /db_xref="GOA:Q7MBC9"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MBC9"
FT                   /protein_id="BAC88492.1"
FT                   /translation="MTSSPKIVAALSGGVDSSVAAALVRKQGYRVCGVTLWLMRGKGSC
FT                   CSDGMKDAARVCEQLDIPHHIVDIRQQFEETIVDFLVEGYREGITPLPCSRCNKELKFG
FT                   LLLEYARRKLGIGTVATGHYARTGFDGQTGRHWLARAVDRTKDQSYFLYDLSQEQLASA
FT                   VFPLGEMTKDQTRTLAAELGLSVAHKPESMDLCLVEAAGSMRNFLNAHIDTRRGEIVDT
FT                   SGKILGEHDGAHHYTVGQRRGLGVAAPYPLYVVAVDAANNRVVVGAREEATACECTVGQ
FT                   VNWVSMAEPEAPIQAEVQVRYRSQPVQATIIPLPARGARIAFDDAPQFAISPGQAAVWY
FT                   AGERVLGGGIILASGRS"
FT   CDS_pept        complement(586506..587234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0552"
FT                   /note="ORF_ID:gll0552"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88493"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88493"
FT                   /db_xref="GOA:Q7NN62"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN62"
FT                   /protein_id="BAC88493.1"
FT                   /translation="MSGPQPPEEHQALLVDYVLDQLNPEQASTVQSLIARDPEAAAEVE
FT                   RLRRVRDLLPYGVAAEPPAGLESAILAAMDAAPSQAARPRPRLTVVPWRPIAAAAAAGL
FT                   VLALGLDSLRLRQELSTTADLVQLLQQPNTRLFALRGTGATTAASGSIVMDLDRRTALV
FT                   AIQNLPASAPGQTYHLWAIVDGEPLTCGEFKTDAKGTAVARLEVPPGLYSSVVSQLLVT
FT                   REMAGSAEKPGEAEVMISVT"
FT   CDS_pept        complement(587362..587745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0553"
FT                   /note="ORF_ID:gll0553"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88494"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88494"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN61"
FT                   /protein_id="BAC88494.1"
FT                   /translation="MAAIRPMCFDGTFELDPEAKQTLFTLLHGEAFRGQIRRAADCASV
FT                   AFTELVFQPVPYSFETPHGMARAFEPYFHSSDYVLINVPPNFMFKARISNPSRLCAIYR
FT                   KGNGKMPGAPPPDDPTSGPGRTE"
FT   CDS_pept        complement(587811..588608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0554"
FT                   /note="ORF_ID:gll0554"
FT                   /note="probable tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88495"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88495"
FT                   /db_xref="GOA:Q7NN60"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN60"
FT                   /protein_id="BAC88495.1"
FT                   /translation="MLTSLQNPVIKQLRKLHAAKERQAQGLFLVEGTHPVAAALAGGWE
FT                   LEFVCATEAWVGEHPAMHTALSGRAGRYETVAPAVIEALADTVHPSGVVAAVRRRADAW
FT                   RPLLERDVSLLVLGERLQDPGNVGTLVRSCAAVGADGLVLSADSVDPDHPKVLRASAGL
FT                   WFRSPPLSVPDLTACVADLVRRGVQVLAADAGAGRSLWECDLRRPTAFVLGSEGQGLSE
FT                   PLRRCLPERVGIPLAPGVESLNVAVSGALLLFEAARQRRGSSH"
FT   CDS_pept        588705..589307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0555"
FT                   /note="ORF_ID:glr0555"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88496"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88496"
FT                   /db_xref="GOA:Q7NN59"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN59"
FT                   /protein_id="BAC88496.1"
FT                   /translation="MLERVIEVVGTLGYLGIAALMFLETVVPPIPSEAIMPLAGVAAAQ
FT                   GKLNLLGVVVSGTIGALLGNLLWYYLGRRIGPKRLGRWADRYGRWFGLSARSVDTAQLW
FT                   FARYGAAAVFLCRMVPGIRTWISLPAGAAGMSLVPFLLCSALGTLLWTALLAWTGLLLE
FT                   NNYRLAEQQLGPLSAVAFGGLLFLIVLWKFRRKNSAP"
FT   CDS_pept        complement(589327..592812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0556"
FT                   /note="ORF_ID:gll0556"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88497"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88497"
FT                   /db_xref="GOA:Q7NN58"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN58"
FT                   /protein_id="BAC88497.1"
FT                   /translation="MCLDAVAPSEFWRYPLSNFGPCAIGFPTVHAVLTCSVREAMNMNV
FT                   FSLPSVQIRPIHFIGTLTTLVWLLCLWFGTAAWADPTLPAGFVSETVVTGISKPTTIAW
FT                   TPDGTKMFIAIKDGHVRVVDKGVLLGTDFIDISAEVNDYYDRGLLGIAVHPEFPAKPYV
FT                   YLLYTYDPPGVVSNGTGARVSRLLRVSADPNNLNVALPGSAVVLLGKNSTFEHIGDPAS
FT                   NFGPSSCEQAGLFVDDCLPSDHYFHTIGTVTFGIDGSLYVGNGDGSSLTVDTQKLRVLN
FT                   LDSFAGKILRINPLTGDGYADNPFFDGDPTHNRSKVYNYGLRNPFRFSIHPQTNEPFIA
FT                   DVGWTNWEEINSGRGKNFGWPCYEGRDGGVSEPQAKYRDSTATKDACSALYAQEASAVQ
FT                   APLYAYPHNGKGAAVLAGPFYQGIAYPASYQGAMFIGDYNNDWIKYLAFAADGSASVQD
FT                   FASDLSPAGGPVQIVQGPDTNLYFVIFNGSDNSEIRRIRYVAGGNTPPLARVGATPTSG
FT                   LAPLAVSFSSGGSSDADGGPLLYSWQFADGTSSTDPNPVHTYTADGTYSATLTVTDAQG
FT                   SAATATIAISVGNRPPAARITTPANGSTYADGQTVYFTGEASDPEEGTLTGDRLQWELY
FT                   QHHNEHVHFDLLPPTSGTSGSFTPVVHGEDGDPAYLELCLRAGDASGLQDSDCLNLYPA
FT                   AAVDGLRLDFASAAGTVVDKDGEGTGFTSVQPNAAANQYDPARIDLDRAAGTLALTATR
FT                   GGLAANTLKNGLQAVLDATRPFTVSARLRGPFTSLSAAFQQGGVFFGPDQNNHVRLVIV
FT                   HNGAAGLSLLLQQEQNGKLLNVAEVKNLDWAGIQTLDLFLQGDPDGGKIAASYRINSDA
FT                   TAPTAMPGVFQPTTPAPFFADDASARAGILAFTGSGPDTVFRFESFAIEHPLPGQLNLD
FT                   FASAAVGTVVDKDGEGTGFTSVQPNAAANQYDPARINLDRAAGTLVLTATQGGPGPNTL
FT                   KNGLQAALDATRPFTVSARLQGPPTNLTTAYQQGGIFVGRDQDNYVKLVVVNSASGTGG
FT                   LGLQFYQEQNGVRTSVGGGQASQIKGLDWAGIRTLDLFLQGDPATGKITASYRINSDTA
FT                   APIPFAQVFQPTNPGVFFADAATARAGILALTSNAPDVTVVFESFALQSAAVGP"
FT   CDS_pept        complement(593186..594214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0557"
FT                   /note="ORF_ID:gll0557"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88498"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88498"
FT                   /db_xref="InterPro:IPR021763"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN57"
FT                   /protein_id="BAC88498.1"
FT                   /translation="MKPLVVLLLVPTGVGAAVGGFAGDAIPVARLLAGVADCLITHPNV
FT                   LNGALLSYPLTNALYVEGYGLDRFCKGEWRLRPVHRNRVGVVLDAGLSASQHQQHLHAL
FT                   EAARYTLGVDILGHCTTEGPLGVEICGGAVGTAWGTLRHPQRLLAAAQRLATAGAEAIA
FT                   VVSRCPESDDTAYRAGRGVDPVGGVEAVISHLVVRHLQLPAAHAPAFDYDPLPGPVHPR
FT                   VAAEVLGPTFLPCVLAGLARAPRFVSGPGVLPQDLAAAAVDVVVSPVDCCGGAGLLALM
FT                   DSTNRPVLLAVEENTTRLNVTPERLGLKVRRVRSYLEACGWLVALKQGVAFAEGTAPEL
FT                   PV"
FT   CDS_pept        complement(594211..594381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0558"
FT                   /note="ORF_ID:gsl0558"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88499"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88499"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN56"
FT                   /protein_id="BAC88499.1"
FT                   /translation="MCVQYIEAEIELDRGKALSPQIEQALQAHGEPLRWAIVEADEAGG
FT                   PVRVEAVVVGA"
FT   CDS_pept        594478..595977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /product="phosphoribosyl aminoimidazole carboxy formyl
FT                   formyltransferase/inosinemonophosphate cyclohydrolase"
FT                   /note="ORF_ID:glr0559"
FT                   /note="bifunctional"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88500"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88500"
FT                   /db_xref="GOA:Q7NN55"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN55"
FT                   /protein_id="BAC88500.1"
FT                   /translation="MPIALLSVSDKTGLVDFARALVTEFEYQLISSGGTARALAEAGVP
FT                   VQEVGDFTGAAEMLGGRVKTLHPKIHGGILARRDQESDRRDLETHSIAPIDLVVVNLYP
FT                   FEQDPRIEQIDVGGPTMVRAAAKNHAFVTVLVSPGQYEGCLAELRRNRGVTTLPFRAAC
FT                   AAAAFARTAAYDRAIAAWFAGSEPVLGERLVLELERVQPLRYGENPHQAAAWYRHGPAA
FT                   GWSTGRILQGKALSFNNLIDLEASRRLVAEFDDTPAAVIIKHTNPCGVAADATIAAAYR
FT                   RAFDADSASAFGGIVALNRPCDEPTAALLGQTFLECVVAPAFTLGALALLERKKNLRLL
FT                   ELADLTTPPVFDVKPISGGFLIQQVDAPVRAEDWKVVTEAVPDEDQRAELLFAWKVCQH
FT                   VKSNAIVVSHLRQTLGVGAGQMNRVGSARLALAQAGEKARGAVLASDGFFPFDDTVRAA
FT                   AERGIRAIVQPGGSLRDEDSIRACNELGVAMVFTGVRHFLH"
FT   CDS_pept        complement(595981..596835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0560"
FT                   /note="ORF_ID:gll0560"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88501"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88501"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN54"
FT                   /protein_id="BAC88501.1"
FT                   /translation="MHTPRWLIAAAIWILIAAPARSACQPQAMAQLPVPLLAEVSGMVR
FT                   GGSGNFWWFINDSGDGAHLYAVDDSSKLKGKVSVAGANNVDWEDLAAGRCPDGNGRCLF
FT                   IGDIGNNALKRQDLTIYVVREPEPANSKVEVLLALPLRYPDRPADAEALVYDEQNRQLV
FT                   LFTKEFSGLSRVYARSLDPAETALKPIARLDLSEREIGDNLLSGAAMSPDGKILMLRSY
FT                   LTAFRWQRGAAENWEQLLARAPEAIALEKEPQGEAIGIDGNEGHFSTTSEVKPVLMRYP
FT                   CKP"
FT   CDS_pept        complement(596866..598965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0561"
FT                   /note="ORF_ID:gll0561"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88502"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88502"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN53"
FT                   /protein_id="BAC88502.1"
FT                   /translation="MDSVMQRRDFLEFLAAAGAATLLPAPAEAARKAFVPGAGKLPGFT
FT                   PVAVPAPMAPTFGELTRFEVKDALVVPREYRYEVVVAWGDRVFADPADHFGYNNDFTAF
FT                   LPLGADDSEGLLWVNHEYVSEKPWLDTYNSVIGKPLPGEAVLRTQAGSLDDEQKRALAK
FT                   AVLYEQGGSIVHLRRDPSGRYQVVKGSKYNRRVSGIEGLDKPERLLDADGPAATVLAAG
FT                   KDGLGKRIVGTFANCSGGVTPWGTVLSCEENFQSQVPDAVDSRGVPVPAKVGFDPASFG
FT                   DFAGAALGLAPNKYGWVVEIDPRRPEAVPVKRTALGRFRHENVAVRAVEGKPLACYMGD
FT                   DRTGGHTWKFVSRNPYRAAAGAAGSALLAEGTLYIARYRPDGTGEWVPLVLATPVDPAD
FT                   PTHVAGGRVLLPNRPAGGPVAVDTPEQAAAFKERYKTLADLYESEGAMLIDAFLAANAV
FT                   GGTPTARPEDLEIHPTDGSVFIAYTSGAASPEGGPDDRIFVTAFKSEDKRDKPPHGAIY
FT                   RLFEEANDPAALRFRWKTFANSGEIAAGGAGFAFPDNLCFDSQANLWICSDIGNQNQPV
FT                   PNRTNARASATSGLFGSNTLWFMATDGAKAGTALPFATGPVECELTGPTFTNDGRTLFL
FT                   AVQHPGEGGGWRKNGATRPETEYELLSADGKRTFVQTRSIPAGSNFPSTDGGPPKPCVV
FT                   AIRRR"
FT   CDS_pept        599118..599312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0562"
FT                   /note="ORF_ID:gsr0562"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88503"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88503"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN52"
FT                   /protein_id="BAC88503.1"
FT                   /translation="MLEVVLAAPEQILEEDDLSVFQARYAATNGKTYLLRAYVNSSVEP
FT                   ARVVTVYRTSKIEKYWRPG"
FT   CDS_pept        599309..599521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0563"
FT                   /note="ORF_ID:gsr0563"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88504"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88504"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN51"
FT                   /protein_id="BAC88504.1"
FT                   /translation="MKAHYNQDVDILRIVWSESPIEQSDELQPGVILDYDGSGRVVGVE
FT                   ILNASRQVENLRNHDSIPVLQREGR"
FT   CDS_pept        complement(599518..601041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0564"
FT                   /product="mercuric reductase"
FT                   /note="ORF_ID:gll0564"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88505"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88505"
FT                   /db_xref="GOA:Q7NN50"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN50"
FT                   /protein_id="BAC88505.1"
FT                   /translation="MSEQPIGIAPMDVHNTRLVAHTHPLDWVNPKPAGRYNLVVIGGGT
FT                   AGLVSAGGAALLGGKVALVERHLLGGDCLVAGCVPSKALIRSARAMADVKDAHRYGIRV
FT                   HGNVEADFGAVMERLRRVRADISPHDAAERFKNWGVDVFLGAARFTGPDTVRVGEVELR
FT                   FKRAIVATGGRAARPEIAGLAEAGFLTNETVFSLTERPERLVVIGGGPIGCELAQSFAR
FT                   LGSQVTLLHKNERVLDREDPETSRIVGCALERDGVRVLTKARIEKVSRAGSIKTVHLAG
FT                   GEQVACEAILLAAGRVPNVEGLGLEAAGVRYGKGGVEVDDRLCTSNPRIYACGDICLPW
FT                   KFTHAAEASARIALENALFGGTLVLGQKKTSALTMPWCTYTDPEIAHVGLGEDEARKRG
FT                   IAFDTIRLPLAESDRALTDGEEDGFIAVLLKQGSDKILGATLVARHAGEMISEITLAMV
FT                   AGKGLATLSQVIHPYPTQAEIIRKVADAYESRSLERLRPFTEKWLAWLR"
FT   CDS_pept        complement(601086..602357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0565"
FT                   /product="chromate transport protein"
FT                   /note="ORF_ID:gll0565"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88506"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88506"
FT                   /db_xref="GOA:Q7NN49"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN49"
FT                   /protein_id="BAC88506.1"
FT                   /translation="MRTIPRPAARRQSGRFSVSHELVGNRGKRATWQVYASELAVSNVQ
FT                   KTSLSELALLFLRLGVTAFGGPAAHIAMMEDEVVRRRRWLSREAFVDLLGITNLLPGPN
FT                   STEMAIHIGLKQAGWAGLVVAGVCFILPAALMVGVLAWVYVQFGSLPQVDAAFYGIKPV
FT                   IIAVVGQALWRLGRTVLKTPLLIVLAVAATALSLAGADELVLLFFAGALVTLAHRMGAP
FT                   GRLLQLTPWPLLVPLAAAPAAGAVAVGLWPLFLIFLKIGSVLFGSGYVLLAFLRTELVE
FT                   KTGWLSEVQLLDAVAVGQFTPGPVFTTATFVGYLLGGVPGAAVATLGIFLPAFIFVALA
FT                   GWLAPRIGRSSAARAFLDGLNVASLALMAAVTFELAGAAIVDVPTVVLAAISAVLLVRW
FT                   GWNSAWLVLIGAVVGLVTTVVRGL"
FT   CDS_pept        complement(602368..602706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0566"
FT                   /note="ORF_ID:gll0566"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88507"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88507"
FT                   /db_xref="GOA:Q7NN48"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN48"
FT                   /protein_id="BAC88507.1"
FT                   /translation="MPRHWFVVLGLGLALAAPAQAESVVYGRVFQTMENTVFTDAKVTL
FT                   LSNPPKQTSTDQYGQYWLRDVKPGAYLVRLQIPGRPLITGRVVVGKGTTVANLDLSKIG
FT                   HPDHDEEY"
FT   CDS_pept        complement(602712..605072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0567"
FT                   /note="ORF_ID:gll0567"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88508"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88508"
FT                   /db_xref="GOA:Q7NN47"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN47"
FT                   /protein_id="BAC88508.1"
FT                   /translation="MKRLKWIHVLGALSATVGLASSLGAGPAWAGGDDDTQQSNVPPVL
FT                   GNPPFSDNPTNASPGVGLRILPPTNTTLIADQLFDLRVETQVPGTSGRAPLLKSLTVNG
FT                   TEIAQPFNDTIKKQGLGLESGSPTVPGLYGASARNFAFPQAGRYRVRAVVSVDGADYTI
FT                   QNTYTVAPFALKQNINHVVFFLGDAMGLPIRSAARIAGKGVFEGRAKGQLNMDTMDTYG
FT                   LVYTASFDSIITDSAPGMASYITGMKQPNNALNVSVDNTPENALDNPRIEPLWAYMKRK
FT                   YGWATGVVSDAFVTDATPASEVAHSRARSARTAIAQQFIDYYIDNGPTGTAAQPVTGYA
FT                   SLKALTQPLDVIIGGGARDWLPVNDPTLLNFYQASSGQGRPDGINLFTVAAGQGYSVVK
FT                   DKTELASAPNNKPILGIFAGDFRPGNALGADNIPGTLDRLVARGQATIGGKTASDPELG
FT                   QSVPPPVGTGCGGTVQACFANVPSKTEMVAKAIEVLNAKNPNGWMLMVEQSQTDKLAHP
FT                   LEYERVIYEALELDNALGYVLNGQATDGKTLALITADHAQPETIVGITVPSALDNLPGY
FT                   LGDPSGTDPITPGGCFTNSISSDGTSGSLSLTIDGAGAETKPCALQDAIGTFNDGTFPT
FT                   YVDANKDGFPDDPDPTVKLVLDNGGKPTYSQDYLTNFIPLNPSGITAAVPNPARDPNGI
FT                   LLTGNMSTADVSPISKDSGNIGVAPHSGEDVPLSASGPNAFLFGGTYENSDVFVRLARA
FT                   LSLEGATSRQAALKLPAGFPSVSAEQLFRGKQE"
FT   CDS_pept        605368..606177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0568"
FT                   /note="ORF_ID:glr0568"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88509"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88509"
FT                   /db_xref="GOA:Q7NN46"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN46"
FT                   /protein_id="BAC88509.1"
FT                   /translation="MCGSSWVARLVKRRRFIVQVLTAGSALVWGGAAHLSSASSPSTIR
FT                   ISGEGVIIEAYRALPVGRPWAAVLLVPEEAGLNAFIAGVAAELATLGFAVLVPDLYSRL
FT                   GGTAALGPNPAAALEKLNDSLIARDLDLSFAYLEKLLGPQGKIAILGFGWGGSKALTYA
FT                   TENPDIAAVAVFYAPNPEPVGRVLNLEMPLLGNYAALDEAVTPKLAELEAALTKAGKTY
FT                   DFKIYPGVRAGFFGAALAGPPGAAASRDAWERTVQFFRRTLAAQEQP"
FT   CDS_pept        complement(606225..606509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0569"
FT                   /note="ORF_ID:gsl0569"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88510"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88510"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN45"
FT                   /protein_id="BAC88510.1"
FT                   /translation="MKYLPATPRDWWQTIGRIGRFYRSSQIPAPLKFAPLALSAVYFLL
FT                   PVDFVPDFVPLVGQLDDVSVVFLIHMLVAGWAHQKYWIDAEKTLDTPAR"
FT   CDS_pept        complement(606611..608875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /product="potassium-transporting P-type ATPase D chain"
FT                   /note="ORF_ID:gll0570"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88511"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88511"
FT                   /db_xref="GOA:Q7NN44"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN44"
FT                   /protein_id="BAC88511.1"
FT                   /translation="MFRPNEDCPDPQSLLHELMQLSRGRLKLYLGYTPGVGKTVRMLQE
FT                   ARRLRRRGVDLVVGWVETHGRPDTEALLADLEVMAPRQVAYQGVIIPELDLEAILQRRP
FT                   ATVLIDELAHTNAPGSRHRKRYEDVEVLLDAGVSVMSAMNIQHLESVAEAAGRLIGAVV
FT                   HETVPDRLLRSAEEVQLVDASPEAVLERLQRGDAARYIPPGSPFLRRSTLVYLRELALR
FT                   AVAEVVDADILSGKNGVAGPAGVRERVLAAVSTNPASARLIRRGARIAERLDAELFVAY
FT                   VETGRPLAPPEAQTLQEHRAATEAAAGEFVQLQNRDVAGALIDFALQKNITQVIVGESL
FT                   RSPAEELVRGSVINTLLRTTSNIDVLIVGEAESSMVGPLTPVAAQPPFAVGCLLVGADS
FT                   RRAHGCGRHKIYLGAAPGVGKTFAMLQEAHHLHASGIDVVCGVIETHGRAETAALIENL
FT                   EVVPKRAIGYQGRTFLELDVEAVLRRRPAVVLVDELAHTNIAGAGNTKRFQDVEVLLGA
FT                   GIDVVSTLNIQHLESLNTLVERTTGVKVRETLPDLVVEAADEVVLVDLPTGELTQRLRE
FT                   GKIYAQAKVEQALANFFRPENLSALRELALREVADDCTTRKLEEAAHGPGGRVLVCINL
FT                   RPNAEQLIRRGARIASRLSAPLVVAHIGAHDDGPTARAVERLGELTRQLGGEFIERPAA
FT                   ANQVPEQIDALAHEQGVTLLVMGESRRSRWEKLLHGCVIEQVVRRVRNLDVLIVGDLEH
FT                   E"
FT   CDS_pept        complement(608894..609547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0571"
FT                   /product="two-component response regulator"
FT                   /note="ORF_ID:gll0571"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88512"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88512"
FT                   /db_xref="GOA:Q7NN43"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN43"
FT                   /protein_id="BAC88512.1"
FT                   /translation="MSGRVRVLLVEDDPLFRMGLAMVLRHQPQIELVAEAEDGETALAL
FT                   ANRHRPQLVLLDIGLPGLDGRQTLVRLKQEHPEIRVLVLTSREEAGLVQAMLQAGADGY
FT                   CLKGIGPDRLLTVIREVSAGNGWFDAKVLAQVRSAFAVAPSEPPANAAALTEREREVLG
FT                   WIARGASNPEIGRQLHISSGTVRVHVHAILRKLGATDRTQAAVLALEKGLIAPP"
FT   CDS_pept        complement(609544..610656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0572"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="ORF_ID:gll0572"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88513"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88513"
FT                   /db_xref="GOA:Q7NN42"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN42"
FT                   /protein_id="BAC88513.1"
FT                   /translation="MPARDRYQMLRRSFSFRPIGAYIALMFAVILVLEFSTPPEYIFGY
FT                   LYVGPILLANWFLDRRSTVFVTSLGVVLTLANLLFPRDALASSVAVVDRSITVAALLTV
FT                   AYLGTQYRRIQEESARQKAALQAREELSRAQSDFVATLTHDLKTPLLGAQQTLQFFGRG
FT                   QFGEVSPQQLGVIEMLQKSNHKLLALVDTLLAIYRNSLSGLPLAKQPSDLDELCAEQIV
FT                   VLQDLAVSRQIELVYEGSEGAHLPVDALQLGRVVANLVGNAINHTPRGGRVTVRLLRAP
FT                   DEWRLLVEDTGTGIPPTDIRRVFERFYQAENTRHVPGTGLGLYLSRQIVEAHGGRIWAA
FT                   NRPGGGCLFGVSLPDSVPPGAAALARSAAR"
FT   CDS_pept        611072..612799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /product="potassium-transporting P-type ATPase A chain"
FT                   /note="ORF_ID:glr0573"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88514"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88514"
FT                   /db_xref="GOA:Q7NN41"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NN41"
FT                   /protein_id="BAC88514.1"
FT                   /translation="MAFEGVLQIVATLVLMVAIVPFFGTYMARVFQGESTWLDRVLGPI
FT                   ENLVYRLGGVRPELTMDWWSYARAVLASNAAMFVPVFAVLLLQGSLPLNPNGISGMSWD
FT                   LALHTAISFLTNTNQQHYSGETGASHLAQMVCFQFLMFTSAATGLAVGIAFIRGLLGKP
FT                   LGNFYVDLTRSVSRILMPISIAFAVVLLSQGVPQSLGGTTEAQLVDPYRTEQDGKREQV
FT                   TAQKLVSGPFASMESIKELGENGGGSYGINSAHPYENPNPFTNLLEILLLLAVPTSLIY
FT                   TFGVLANNKKQGWVLFGTIFVLFVGLVGVAALGEYWGNPTVNALLGSANPNFEGQEVRF
FT                   GWAQSALFATATTGTMTGAVNAMHDSLTPLAGLVTLFNLCLQVIWGGQGTGIAYILVFL
FT                   IIAVFLTGLMVGRTPEIFGRKLEKREVALASIIFLVHPVIILVPTAIALAIPGLAGNSN
FT                   PGFHGLTQVVYEYASAAANNGSGFEGLGDATPWWNLSTSVVLLLGRYAPIVALLALAGG
FT                   LQRKQPVPETPGTLRTDTVLFGSVTAGTILILGALTFFPVFALGPIAEWIANLAGKTL"
FT   CDS_pept        612812..614896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /product="potassium-transporting P-type ATPase B chain"
FT                   /note="ORF_ID:glr0574"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88515"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88515"
FT                   /db_xref="GOA:Q7NN40"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN40"
FT                   /protein_id="BAC88515.1"
FT                   /translation="MQLKNKPVRDTAAASPDLRRRKIDNSGIFQRAVVESFVKLNPLTL
FT                   YKNPVMFVVLVGTLVTLALTFEPSLFGEQPEGTRVLNGLITAILFVTVLFGNFAEAVAE
FT                   GRGRAQAAALRSTKQATRARRVLADGRTEEVDAAQLRKGDIVQVVAGDLIPADGEVVEG
FT                   VASVDESAITGESAPVIKEPGSDVASTVTGGTRILSDSLVLRIGSNPGEGFIDRMIALI
FT                   EGAKRQKTPNEIALTVLLAVLTLIFLIVVATLPPIAAFVGAPVSIALLVSLLVALIPTT
FT                   IGGLLSAIGIAGMDRVAQFNVIATSGKAVEAAGDVGTLILDKTGTITLGNRLADEFIPV
FT                   GGYSVREVATAAWAASVFDTTPEGKSVVKLAASQGAAAGYDPEGATGIEFTAQTRMSGT
FT                   DFADGRAVRKGAVDAIKRYVQADGGQIPADLDAATERISRLGGTPLAVCAGNIVYGVIY
FT                   LKDIVKPGMRERFEQLRRMGIKTVMLTGDNRITASVIAAEAGVDDFIAEATPEDKIRVI
FT                   RENQAQGKLVAMTGDGTNDAPALAQADVGVAMNSGTQAAKEAANMVDLDSDPTKLIDVV
FT                   TIGKQLLITRGALTTFSIANDVAKYFAIIPAMFSAAGIGVLNVMALTSPTSAILSALVF
FT                   NALIIPALIPLALRGVQFQPLSADQLLTRNMLIYGLGGLVVPFIGIKLIDVVITAVGLA
FT                   "
FT   CDS_pept        614911..615477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /product="potassium-transporting P-type ATPase C chain"
FT                   /note="ORF_ID:glr0575"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88516"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88516"
FT                   /db_xref="GOA:Q7NN39"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NN39"
FT                   /protein_id="BAC88516.1"
FT                   /translation="MSPLQEIGTAVRMTAIFWIGCGLAYPLIFTGFAQVAFPDQANGSL
FT                   VRNAQNQVIGSSLIGQKFTSERYFHGRPSSIDYKAEASGASQLAPTNKVLIERVKADAA
FT                   AFEAQNGTKPTIDLVTTPGSGLDPHITPAGAAVQTARVSRARNLAPEQVRKLVSQYTEG
FT                   RFLGIFGEPRVNVLALNLALDGIRR"
FT   CDS_pept        615474..615800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0576"
FT                   /note="ORF_ID:glr0576"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88517"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88517"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN38"
FT                   /protein_id="BAC88517.1"
FT                   /translation="MKSLEMHATADFDSLRRELNLRQPAPALVRVSVLHPVCAADWQTL
FT                   PLPPTCRVLCVLRQQQVIEAESSLPLEPGDWIVAVAALPAYGPMLEAALGDWSRRKRRR
FT                   CSLE"
FT   CDS_pept        615839..616402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0577"
FT                   /note="ORF_ID:glr0577"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88518"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88518"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN37"
FT                   /protein_id="BAC88518.1"
FT                   /translation="MVRLPSRPLTLEEFLQLPETEPASEFIDGHIFQKPMPQGKHSAIQ
FT                   GELPAAVNAVFRHRRIARAFPELRCTFGGRSVVPDVAVYVWDRISRDTQGAVANLFQSA
FT                   PDWTVEILSPDQSQTRVVKNILHCLKYGTQMGWLIDPDEQTVFVYRPGQLPEAFEEPEA
FT                   RLPMPDFAEQLSLTVGELFAWLQD"
FT   CDS_pept        complement(616361..617188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0578"
FT                   /product="hemin ABC transporter ATP binding protein"
FT                   /note="ORF_ID:gll0578"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88519"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88519"
FT                   /db_xref="GOA:Q7NN36"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NN36"
FT                   /protein_id="BAC88519.1"
FT                   /translation="MLKAAGIGVRLAGRWLLEQVNLEALPGEVLAVVGPNGAGKSTLLK
FT                   TLAGEIRPTRGSVSMAGKALADWPARERACVRAVLPQNSTLAFAFRVFEVVLMGRTPHS
FT                   RGLEGERDRQIAREAMAAAGVAHLAERLYPTLSGGEKQRVQLARVLAQIWEAPPDSPRY
FT                   LLLDEPTASLDLTHQHSTLAVARNFAHRGAAVVTVLHDLNLAAQYADRLALLKDGKLLV
FT                   VGVPDIVLTPEWIETGFGLQTLVMRHPRLGCPLVIPLGSASVLQPGEQLAHGK"
FT   CDS_pept        complement(617188..618255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0579"
FT                   /product="hemin ABC transporter permease protein"
FT                   /note="ORF_ID:gll0579"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88520"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88520"
FT                   /db_xref="GOA:Q7NN35"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN35"
FT                   /protein_id="BAC88520.1"
FT                   /translation="MSKAGFLPAKGTGRALRVAAPRLGLVGLLVALVLFAVGNGAVAIA
FT                   PTQVAAILAGQIGVALPWAFEPQQEAVLLAVRLPRVLLGALVGAALATAGAAMQGLFRN
FT                   PLADPGLIGVSSGAALAAVGAIVLGTGSLAGPFTLPVAAFAGGLVTTLLVYRLASAEGR
FT                   TSVATMLLAGIAVNALAGAGTGLLTFAATDAQLRSITFWSLGSLGGATWEALAGVAPPL
FT                   LAAIVLLPTLARPLNAFLLGEAEAVHLGVDIERVKAAAIVLAALAVGAAVSISGIIGFV
FT                   GLAVPHLLRFWSGPDHRHLLIDASLLGAALLIAADWLCRTVVAPAELPIGILTAALGAP
FT                   FFLWLLLRERSQGWG"
FT   CDS_pept        complement(618252..619142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0580"
FT                   /product="hemin-binding periplasmic protein"
FT                   /note="ORF_ID:gll0580"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88521"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88521"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN34"
FT                   /protein_id="BAC88521.1"
FT                   /translation="MGKMPAWKGLSFALLALLAVVCAGRAAEKPSASRIVALGGSITEI
FT                   VYALDAGAQLVGVDASSTYPAAAARLPQVGYQRQVSAEGVLSLKPTLILATEEAGPPAA
FT                   LDQLKAAGVKLAVVPSSEHTPAGVEAKIRAVAKAVGRTERGEALVAGLRKDLAAARGEV
FT                   ARQRVRPRVLFLYARGANTLMVAGQDNAADAMLNLAGATNAVDGYEGYKPLTAEAAVAA
FT                   APDVVLVPAAGLASVGGIDGLAQLPGLALTPALKNKRVVAMDDLYLLGFGPRLAQAVRD
FT                   LSRQLRSPAPAGAKV"
FT   CDS_pept        619406..621412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0581"
FT                   /product="acylamino-acid-releasing enzyme"
FT                   /note="ORF_ID:glr0581"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88522"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88522"
FT                   /db_xref="GOA:Q7NN33"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN33"
FT                   /protein_id="BAC88522.1"
FT                   /translation="MKHLRGLSLLCAAVSGFAAAGTLLAVPAMAELPPLIPREVLFGNP
FT                   ERTSPRLSPDGKRLAWLAPDKNNVLQVWVKTIGQNDDKVVTADKKRGIRFFTWAYNNRT
FT                   LIYQQDLDGDENFHLYGVDLPTAQVRDFTPFKGVRAGIAAIDPAYPDGVLVSLNKRNPQ
FT                   LFDIYRLDLKTGELKLDTENPGDVLGWGADAKLAVRAAQVKNADGSNEIRIRDSAKAPW
FT                   KSRLKAGPTEILEFVDFTADGESAVLRSSLGSDTVRVVLKGINKKNDKVLAADARVDAE
FT                   SVLIQPRTRLVQAVSFAPGRTEWKVVSPSVEADFAALEKVFDGDFTVVNRSADDSTWLV
FT                   AYTSDRGSVRYYTWNRRTQKAALLLVQQPKLEGLPLAKMEPVTITARDGLKLNAYLTTP
FT                   VGVPARKLPMVLFVHGGPWSRDDWGYDPYAQWFANRGYAVLQVNFRGSTGYGKNFLNAG
FT                   NRQWGLKMHEDLIDAVNWAAGTLGLADPKKVAIYGGSYGGYAALAGLAFTPEVFACGVD
FT                   IVGPSNIKTLINSIPPYWKPFRSEFDLRVGNIDDPKDAELIKNASPLFKADRIRKPLLI
FT                   GQGANDPRVKQAESEQIVEAIEKNGGQVTYVVYPDEGHGFARPENRIDFNARAEKFLAD
FT                   CLGGRSEPMPSDPIAGATAVVKQIGPKASSAAP"
FT   CDS_pept        621509..622072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0582"
FT                   /note="ORF_ID:glr0582"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88523"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88523"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN32"
FT                   /protein_id="BAC88523.1"
FT                   /translation="MAGVSVGPRPFTVGEYHRMAEAGVFAPEENVELLEGRIIAMPPQG
FT                   PLHASTVRRLLNALLALGLRMDRLLIEQPITLGENGEPVPDITVVEPDPENRFYAGGHP
FT                   GANRVLLVIEVSDSTLDYDLGEKRGAYARAGIGEYWVVDVRGRRVHRHTEPIESNYADT
FT                   SVHSQTDVLPLLGGSIPLHELFSD"
FT   CDS_pept        complement(622111..624618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0583"
FT                   /note="ORF_ID:gll0583"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88524"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88524"
FT                   /db_xref="GOA:Q7NN31"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN31"
FT                   /protein_id="BAC88524.1"
FT                   /translation="MASDIEPDAPRRYRARSEKWVRSAWIWLWRALGALAVVGLIAGGV
FT                   LLVLPFFVEDKSFDALVQKELSTWTRREAILSRVRLRTLGGFGVVVDNLQLLGSDGNVD
FT                   LKARQAFIELDFFALILQDLKVRLVELDEARIDLKRNRDGRWNWADLQPPDRPSGTLKA
FT                   DLTRTGLRLIGASVAITDAQPRPAQQFLIAPLSLKLDDLDERTLLVSVQGAAADYRSKR
FT                   IADLSADGRLLRPVDGDWFSSQGELKILCRKFRPRLLRDYTRQIAGLSGLAGVYDFDGD
FT                   WRRDSDNRVSLKGKLFSRLLHWRWPEVLGKKIWQVRNLGFEGAVSLTGSTVAVERLRVS
FT                   TEGIDVQLAGKVVTPGNPKGKAAVDLKLNSAYFDPFSMRDKLPVTLLPYEVRDWLPGSR
FT                   GSGKLRAEIQLNGPFDRYLTTGTIEAANFAVSHPKLRSAVERLDGKLLLAKTAISMGGL
FT                   RVGAPGLEATLSGTVSRRAGGPVRLKIVSGRTELAPFSALLSERLGLVRGRAGLDLEIA
FT                   GTLKAPELRGWAELAGVSIKQWGWPRAIEGLRGRLLFEPARLTLAGLSARVGDSTVGVD
FT                   GVLNSYSFGDTFSRFTARSRDLDLRAAGPILASNLLGETFGRNFAARFGDLGGRAGIDL
FT                   EVSGGTTKGRIALKGARFVLAELGAQVADMRGMLILRNGDLTTEDGIAALVNGSPVGFF
FT                   GESSMPLSRVGGPNCTERTVELERAQNRERRQCRAFAEQKTETSGEEALTPRRSDCPCS
FT                   RGGGLSSRCRTRAENNLRDSLQLVFTGRLPDNICSRRVPLRERRPVPTRRPPRPEVLLP
FT                   AEAPVVPEPIDNPAPESPASVPP"
FT   CDS_pept        624711..624893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0584"
FT                   /note="ORF_ID:gsr0584"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88525"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88525"
FT                   /db_xref="GOA:Q7NN30"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN30"
FT                   /protein_id="BAC88525.1"
FT                   /translation="MGGKPGRCLFSLVIGVTLQVCDVQVTSGRWRRLVLVQSVLAFIFG
FT                   TVILVFSINLVAGLV"
FT   CDS_pept        complement(624914..627901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0585"
FT                   /product="serine/threonine kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="ORF_ID:gll0585"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88526"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88526"
FT                   /db_xref="GOA:Q7NN29"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN29"
FT                   /protein_id="BAC88526.1"
FT                   /translation="MTPEQWQQLSEILGDALDYQGAERLAFLDGCKLEAEQRRFIDQLL
FT                   TIHEQQPDFLSAPMLSLLAGLADEAVPVGAPLRAGQRLGAYRVVRELGRGGMGVVFLAE
FT                   RADGQFQKQVCIKVLQTGWAAALQVGRFLSERQILANLEHPYIARLIDGGSTEAGVPYL
FT                   VMEFVDGMPIDRYCEAQQLGLRPRLELFSKVCQAVQYAHTCRVIHRDLKPSNILVNCEG
FT                   EPRLLDFGIAKLLDPQGRSSEPTRTDLRVLTPRYASPEQIAGAELTPASDVYALGVVLY
FT                   ELITGQRPAGAQAAASYELAWTLSDQTALLPSRAVGEQPTRAFAPAAAEGGAQGLSRQL
FT                   EGALDRIVLRSLSKPLDRRYATVGELLTEVRRYLDGAERTGMRPWPAGALARAVAVVAL
FT                   NGAAFWVANELTARSLLAGPGWFAAAGLALLAGMMIYGLAEAPRASGRRRRLAVGTVLL
FT                   ELGLLAGLFWAANPFVRLLSNPPNHAIAVLPFVNLGGDKQSAYFSAGMAVDITNQLGKI
FT                   ADLKVIASSAAAQYAESPKSLGEIARELGVSSVLTGSVRREGNKVRIVSQLVDPATGEQ
FT                   LWSGDYDRQLSDVFKIQEDVAQQIAGRLQAKLSPAEKERVTQTPTGNITAYDYYLKGRE
FT                   YFERGRNAENDLAIELFKRALALEPNYALAHAALGNAYFRKAVDYSQGDVWLEASLGAS
FT                   RKALAIDPQLGEAHRALGNGLRGKGFFRKAQDAYRRAIALAPNNAAALGSYGSVNFIRC
FT                   ELEEGVNWTLRAVALDPLSTPLQTNLGDFFTILGDDARARQALEAAVTLRPDDAYALWK
FT                   WSQFYLLNGNFEAARQTARRLIEAEPRQLSGLYAAGDVERFAGNRSQARAYYRRILQGS
FT                   GDLLAGTGYLLPTTVLGELAWRDSRRTEAKALLERSLKLDKAAIARGNEDSFYRFDLAA
FT                   VYAVQGKRDEALRWLRAAVDEGYCHYRFLRREPVFASLHSDSEFLQLLKALEQRVEAMR
FT                   VRVANL"
FT   tRNA            complement(628297..628377)
FT                   /product="trnL-UAG"
FT   CDS_pept        complement(628759..629673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0586"
FT                   /note="ORF_ID:gll0586"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88527"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88527"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN28"
FT                   /protein_id="BAC88527.1"
FT                   /translation="MLMNFKYRLEPTTEQASTLQCWFETSRRVWNFVLAERKDWINSRK
FT                   APLNACSIRSEFIIAADAPWPTYARQCKALTLARKHNPHLQAVHSQVLQQVLQQLEKAF
FT                   ISMREGGLGFPRFKKPGRLRSICFPQFASAPVRGERLKVPTIGYVRMRLSRSIPEGFRV
FT                   KQVRVLRRASGWYAVMAIQSDAALSEAQPHGEAIGIDLGLHHFAAFSDGELVHRPKFFV
FT                   DAQSKLKLLQRRVSRKKRGSNNWRKVQQKVARLHERIGNLRKEFHRQPAHRLCDRAGTI
FT                   FAEDLGCQALAASMLAKHVLDAG"
FT   CDS_pept        complement(629783..630565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0587"
FT                   /note="ORF_ID:gll0587"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88528"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88528"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN27"
FT                   /protein_id="BAC88528.1"
FT                   /translation="MTEIRYELEWTPSLWTIAVGHGDSRSMTEVRRKVGNRRDANAADS
FT                   DARVDHRSLKDQGVDDRPDITSGEQHQAVNLLTVNRFYTGVGSTDPPPDVAALVMTVAQ
FT                   HLAGEGMVVRTGHDKGTDAAFAAGAAPGTREVYVPHSGAGGYRDGLVVCDPETIVRAAR
FT                   LAASVHPHWKTYNNFQRRAHTRRVFQLLGEDLNSPSAYVICFVPEDGDGKVQGSARTVL
FT                   ALAQVKRIECYNLAELQTRTRFRQRLEEIAFQGEGRQG"
FT   CDS_pept        630716..631171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0588"
FT                   /note="ORF_ID:glr0588"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88529"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88529"
FT                   /db_xref="InterPro:IPR013481"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN26"
FT                   /protein_id="BAC88529.1"
FT                   /translation="MHPDALLFFEQDFWPELDCIPMGVRYKLDLCATKVSLRHWQLLAT
FT                   AEREELIALACENGEQVDRYRERLGALARQHDFPLVPIDPDPAPWQAEVPRLAMEAPLW
FT                   RAMNPFERFVCLKAQASSKQAELLPRVLALLKERYPVPAGRPGGEAR"
FT   CDS_pept        complement(631119..631778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0589"
FT                   /note="ORF_ID:gll0589"
FT                   /note="similar to serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88530"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88530"
FT                   /db_xref="GOA:Q7NN25"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN25"
FT                   /protein_id="BAC88530.1"
FT                   /translation="MNVSAPKLAVIGDVHGSAGQLSALLARLPAGYEPIFVGDFVDRGP
FT                   DPVAVLDTLIANRFRAVKGNHDDKLFRALKGNPVQVGGGLAATLERIRSQSAPWRERLM
FT                   VWLAELPTVLLFPGIAVVHAYWSPTCPPDEHLWGPRFHDKQGKIYRIRWWSVPEYWTPG
FT                   IQVVFGHYHMPVVTPQAVCVDFGAPEGPLAAYLTDTQAFLIELPRQVALPEPGSAL"
FT   CDS_pept        complement(631827..632042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0590"
FT                   /note="ORF_ID:gsl0590"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88531"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88531"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN24"
FT                   /protein_id="BAC88531.1"
FT                   /translation="MNRQSIQGRCPQCGSTSIRISRRRGIERLAPFFGLSSHRCCCCAA
FT                   IFFVDTAEVDEAGLEPQAPRATVGVT"
FT   CDS_pept        632242..634101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0591"
FT                   /note="ORF_ID:glr0591"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88532"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88532"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN23"
FT                   /protein_id="BAC88532.1"
FT                   /translation="MGDCIHRGSMPLALLRTSALTLVLLAGFGPLAPTTTAAQTEAARV
FT                   AAARPAWIERSDADARVLLEVTARFAPEQAASFGLEGLDERISDLSAGYDERQQKAYTE
FT                   AATELGRRLTAEKDPLVRQDLEILIEAARDNARELELNRKYMLPYLDMSRLLFFSLSSL
FT                   LDDQVAPARRPAALVRLKRYAGLEPGYKPITQLAEERTRERLNQPGILYPFRAQVEKDL
FT                   ANNASFVAGMGQLFEKYKIAGYQEPLARLKTELAAYDGFLRKEVLPKARDDFRRPPELY
FT                   AFALKQYGVDLPPAELSALARAAFGDIQKQMQVLAPQVAKAKGYRSTDYRDVIRELKKE
FT                   QLVGEAILPHYQERLGQIEQIIRREKLVTLPDRPARIRLASAAESAATPAPNMRPPRLL
FT                   GNKGEQGEFVLPLNIPAPPGAPAGKTERVDDFTHAAASWTLTAHEARPGHELQFASLVE
FT                   KGVSTARAIYAFNSTNAEGWALYSEAITLPFMPPEGQLISLQARLQRAARAFLDPGLQA
FT                   GTVTREEAMRVLTQDVVLSAPFANQEVERYTFRAPGQATSYFYGYTRLNELRKDAEQQM
FT                   GSRFDAQKFHDFILAQGLLPPALLRKAVMEQFVNSGTVGTNSR"
FT   CDS_pept        634263..635678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0592"
FT                   /note="ORF_ID:glr0592"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88533"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88533"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN22"
FT                   /protein_id="BAC88533.1"
FT                   /translation="MGCVRVGCRWSRGVRWWGLGLAAALGVWASPVGAQVEFLPAQSVP
FT                   IGDEPESVASGDMDGDGDLDLVTANPNSEGVSVLLNRGDGSFGPAWSFAAGDIPYSVAL
FT                   GDLDGDGDLDVATDSFFYVLVLLNNGDGSLAPAQSFAAGYPLSSVALGDLDGDGDLDIV
FT                   TTAPGFYGLNNADVPVLLNNGDGSFAPAQTFTAGDIPYSVALGDLDGDGDLDIAVGGTF
FT                   LDTVSVLLNSGDGSFGLAQTFAAGDGPTSLALGDLDGDGDLDVVTANVLDNDVSVLLNS
FT                   GDGSFAPAQSFAAGDGPESVALGDLDGDGDLDVATANSDSNNLSVLLNSGTGTFDPAQS
FT                   FAVGRSPQSAALGDLDGDGDLDIATANSGSNNVSVLQNITQDASSLTIAALSPGGGPVG
FT                   TEVIITGTGFTGTTAVTFRLGFPQRRIPAEFTVLSDTEIRAVVPAGAKTGRITVETPEG
FT                   QAVSPTVFLVVGP"
FT   CDS_pept        636056..636775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0593"
FT                   /note="ORF_ID:glr0593"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88534"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88534"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN21"
FT                   /protein_id="BAC88534.1"
FT                   /translation="MFAARQLWKVAPYIEPPVPRSIWREYHLVYKALRRLARNWQPDFV
FT                   LDIGASTGIWSDVVHHLFPASRFILVDPLAQDHLKLDRRYADLHPEFEWVHAAISNRVD
FT                   EQTLLISSNLYGSSLKYVEGKNEHSRRKVKVTTVDVLAKKKQLQGRGLMKIDVQFGEHQ
FT                   VLEGAKNLLSQIDAFIVELTLDPPPNTMPSFIEMLQIIDSLGFVYGDDVGGWRSETGGL
FT                   LLQKDILFVRPCLRHYA"
FT   CDS_pept        complement(636840..637190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0594"
FT                   /note="ORF_ID:gll0594"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88535"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88535"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN20"
FT                   /protein_id="BAC88535.1"
FT                   /translation="MEERLDRSEQRLDQHGELIAELRAATLANSRRIGELQEATVVNSQ
FT                   NLDRLANIGERFITVVVDAVTELRSTTARLDQNVTELKIAVDELRGFNRRQQAINDYLI
FT                   RKDRERGNGNPG"
FT   CDS_pept        complement(637333..638400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0595"
FT                   /note="ORF_ID:gll0595"
FT                   /note="probable beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88536"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88536"
FT                   /db_xref="GOA:Q7NN19"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN19"
FT                   /protein_id="BAC88536.1"
FT                   /translation="MRISLAWPLLQGLGAVGLWLGVQVYGPTVALAVPNALDSAPFAGD
FT                   PALEPLHRQIARLAERLGGRVGAAIVHVESGRAIALKGAERFSMASVYKLPIAIAILDM
FT                   VDRGELDLTRKLTVKASDLRPGSPLAERRDAVGSVLSVRELIELVMIYSDNSASDLLFD
FT                   LAGGGEAITKRLQTLKIAGLRVDRPELELLADGGGVRQLPAASDLTLERFERLLAAVPP
FT                   AAREEAERQYRLDPRDTSTPEAIGRLLVRLQRGDILKPESNRLLLGIMERCATGVQRIP
FT                   GNLPAGTIVAHKTGTNAGGNNDAGIITLPGKAGHLAVAVFVQTPGQPSAERERLIAEIA
FT                   RAGFDFFVGQGAAVR"
FT   CDS_pept        complement(638780..640393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0596"
FT                   /note="ORF_ID:gll0596"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88537"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88537"
FT                   /db_xref="GOA:Q7NN18"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NN18"
FT                   /protein_id="BAC88537.1"
FT                   /translation="MAPCRSTFRPRLLCTDCSEIRLIWVNSGCPPHASYSCKHSRCAQE
FT                   CLGWKSDPILEGGLDTDASVHNNPLLQLDYEPAFASLGDDYYDLVAAAPFPEHRLRFRG
FT                   DGVLRLLGLDPATVGEEHFIEAFGRFAGRGPFLAMRYHGYQFGEYNPYLGDGRGFLYGQ
FT                   VRGLDGELYDFGTKGSGTTPYSRGGDGRLTLKGGVREVLASEALHHLGVRTSRSLSLIE
FT                   TGEALWRGDEPSPTRSAVLVRTSRSHVRFGTFERLHHFKRKDLIQKLLDYVIAVYYPHY
FT                   GAEPERYALFYRELVGRTAELAAQWMAVGFTHAVLNTDNMSITAESFDYGPYAFIDRFD
FT                   PGFTAAYFDHYGRYSYGNQPLVCRINLEALQLPLSMVIPIADLEAGLAIFDTHYAAHYT
FT                   ARMLAKLGFGALGPVLGPELVKATLNYLEAAQAGYHGFFQALAASFDRSWQSDQGAIPA
FT                   PVVGAPEAFELWRESYFRALASLSDSELLRVGERLNRHNPTTVLLRPAIEAVWAAIDQN
FT                   DDWQPFYDLIGRLRKPYAIA"
FT   CDS_pept        640326..642245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0597"
FT                   /product="ABC transporter ATP binding protein"
FT                   /note="ORF_ID:glr0597"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88538"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88538"
FT                   /db_xref="GOA:Q7NN17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN17"
FT                   /protein_id="BAC88538.1"
FT                   /translation="MSLISLQSVHKSLGLKVLLQGATFSLEAGDKVGLIGTNGSGKSTL
FT                   LKILAGLEAVDAGQIQMGHGARVVYLPQQPELDPERTVIEQVFADSGERMDLVREYEQL
FT                   VAKLAHHADDPVLNTRLASLMQRMETGGAWELETQAKIVLTKLGIVDFEAKVGTLSGGY
FT                   RRRIALATALLAEPDVLLLDEPTNHLDALSVEWLQSYLGRFRGAVVLVTHDRYFLDKVT
FT                   GRILELDRGELTAYSGNYAYYLEKKALAEEAEASSQRKHRGVLRRELEWLKRGPKARST
FT                   KQKARIERARALQDQQFRQAKGKVEIATPGRRIGSKVIELENVSKAHNGRTLIDRFSYK
FT                   FTPEDRLGIIGGNGAGKSTLTDIITGRQSADAGTVEIGSTVHIGYFDQHSEALLAAMDN
FT                   NQRVIDYIKAAGELVKLEGGAVITASQMLERFLFAPNQQYVPLEQLSGGEKRRLFLLRE
FT                   LMAAPNVLILDEPTNDLDVPTLAVLEEYLEDFSGCVIAVSHDRYFLDRVVDTIFAFEEN
FT                   GQIRQYPGNYSVYLEHKKAEEDAQAAMAKFAKPSPAAKPKSTEMPSLDRPRKLSSKEKR
FT                   ELQTLEAKIAQMEDERTQLEQSLGSTDPGNFTQANAVYERMGELTRHLDEATERWMHLA
FT                   ELDS"
FT   CDS_pept        642318..642806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0598"
FT                   /note="ORF_ID:glr0598"
FT                   /note="probable transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88539"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88539"
FT                   /db_xref="GOA:Q7NN16"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN16"
FT                   /protein_id="BAC88539.1"
FT                   /translation="MLLRLGAAVLAGGVLGLNRNLSGKSAGLRTNALVCLGAALVTLVA
FT                   LEIAGADGSGALRVVQGVITGIGFLGGGVILHPQTRKKVSGLTTAATIWVAASLGIACG
FT                   AGLWPVLLCGLLLTLLVLLVGGPFEQLSIALAAHWRGRPPVEPDASPPALPANGRASP"
FT   CDS_pept        complement(642836..643585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0599"
FT                   /note="ORF_ID:gll0599"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88540"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88540"
FT                   /db_xref="GOA:Q7NN15"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016545"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN15"
FT                   /protein_id="BAC88540.1"
FT                   /translation="MTYCLGLLMEAGLVLAADSRTNAGVDYVSSYRKVFDFSMPGERVV
FT                   FILTSGNLSITQSVINLLRQDLHKEGESLHTMPTMFSVCRYIGHKVRQVEQQDRPVLEK
FT                   DRIDFHVSLIVAGQIKGEEPALYLVYTQGNFIQATEETPFVQIGETKYGKPILDRAFNY
FT                   RSSLKIAALCSLLSMDSTMISNLSVGSPVDLLVYERDTFQIAQCCRLQENDPFWVEMRR
FT                   AWQQSLQNAFHNLPNIPFTYTPDPPLL"
FT   CDS_pept        643887..644270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0600"
FT                   /note="ORF_ID:glr0600"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88541"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88541"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN14"
FT                   /protein_id="BAC88541.1"
FT                   /translation="MKDLLLCERTIGELKLRGYLLQEHHLIAVWGLPQSPERPRRLICH
FT                   NFEHLNDLWRTWQQMEPEALKAELLGLPEGVLPKPKPKIFKKAGADEQGGGLLKKPFRP
FT                   RTQDAPSSGPPRLERAPRPRRPL"
FT   CDS_pept        complement(644321..645037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0601"
FT                   /product="oxidase"
FT                   /note="ORF_ID:gll0601"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88542"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88542"
FT                   /db_xref="GOA:Q7NN13"
FT                   /db_xref="InterPro:IPR002680"
FT                   /db_xref="InterPro:IPR038659"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN13"
FT                   /protein_id="BAC88542.1"
FT                   /translation="MIRFLVSILVFVIDVLYKNRPYPRFYVLETVARVPYFSYLSVLHL
FT                   YETLGLWRKSDWLKVHFAETWNELHHLLIMESLGGNDRWYDRLLAKSSALVYYWVIVVL
FT                   YMISPRSAYEFMRQVEEHAFHTYDEFLKSDGERLKLQPAPVVAVSYYLTGDLYMFDEFQ
FT                   TSRRPEERRPACDTLYDVFVNIRDDEAEHVKTMAACKAENAQLTFKSPHSALPEAKSEP
FT                   PIAAPQPRATGRGALE"
FT   CDS_pept        645227..645871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0602"
FT                   /note="ORF_ID:glr0602"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88543"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88543"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN12"
FT                   /protein_id="BAC88543.1"
FT                   /translation="MTPSSTVLDSEATQRLLLQNVSWDTYRNLLRDLGDHRSVRLSYDR
FT                   GILELMSPSFAHENLNRVLNYLVVALARRFKPDFVSAGSTTFAREGTSGVEPASSFYFE
FT                   NAARIRGKKTIDLATDPPPELVIEVDITSPSLRRFSIYAALGVAEIWRYDGSTLDIWHL
FT                   QPEGRYLQQPQSLSFPVLSEIEATQLLQQAAILPEPQLLDLFDTWARERSK"
FT   CDS_pept        645942..646109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0603"
FT                   /note="ORF_ID:gsr0603"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88544"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88544"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN11"
FT                   /protein_id="BAC88544.1"
FT                   /translation="MSAKNEVLCRVENWRVQTFELSDADVDRFGQTIRNWEKQVAERQK
FT                   KNERDRGMKR"
FT   CDS_pept        complement(646435..647244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0604"
FT                   /note="ORF_ID:gll0604"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88545"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88545"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN10"
FT                   /protein_id="BAC88545.1"
FT                   /translation="MLGAFNCVQGAGDYTVRFTGTITTTFGGGTPNPITVNQDSTIKYT
FT                   VNSSGAITNIVAGGGSENCGTPILIDTIGNGFSLTDLANGVEFDYSGQGNNMQTSWTSI
FT                   NSDDAFLALDRNYNGVIDNATELFGNYTQQPLSRRPNGFIALAEFDSSENGGNEDRVIS
FT                   AQDAIFSSLLLWKDLNHNGISESVEIFTLSSLGVAAIGLDYKTSLQTDQHGNQFRYRAR
FT                   VEDFSGEQIGRWAWDIIFITSASTSSLKNFSSNSSEQPISDAKCPIR"
FT   CDS_pept        648171..648698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0605"
FT                   /note="ORF_ID:glr0605"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88546"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88546"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN09"
FT                   /protein_id="BAC88546.1"
FT                   /translation="MVASQKPVLFNERSFSIKFYGDANHLLFERTINRTDQQQLQTLVH
FT                   VLNTEKHPRIATGIDKLRICDFQTAQAIFIDVAEKYPDDSVAQANSAAIRHIVGDDLGA
FT                   IKASNAAIFVNSTNPFGFANRAAAHYYLGNRESAITDLEECIELLSSNQNYQLWRISDY
FT                   LSKLLKQKLTTE"
FT   mobile_element  complement(649328..650989)
FT                   /mobile_element_type="insertion sequence:ISGL3b"
FT   CDS_pept        complement(649344..650912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0606"
FT                   /note="ORF_ID:gll0606"
FT                   /note="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88547"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88547"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M793"
FT                   /protein_id="BAC88547.1"
FT                   /translation="MQPSVWQPPVEPSPAEQAILKRIRRAKLFVFLRRIRHQLFDAAFQ
FT                   SELAGIYKDSPCGQPPIPPAQLALATVLQAYTGISDDETIEVLTMDRRWQMVLDCLDCE
FT                   EAPFGKATLIRFRQALIAHGLDRRLIERTIELATSDGGFGSRALRAALDSSPLWGAGRV
FT                   EDSFNLLGHAMRKALRIMVCQTGVGLAQWAEQTGTTLVAGSSLKAALDIDWSQPDECAE
FT                   ALGRLLGALESLESYLDGQTQPPQAGVARCLQAAEQVHQQDVQLNSRGQFVLRRGVSRE
FT                   RRISIEDPAMRHGRKSRAVRIDGYKRHVLKDIDSGLVRAVGITAANRPEAAVTRDIEAD
FT                   LEPQRVKLIELHIDRAYLSSEWVRLRPEDLRIYCKAWPVRNGPYFQKTAFVLDWEAMRI
FT                   RCPQGVTQPFEVGGKVRFPAARCRRCPLQERCTTSPKGRSVSIHPDELLLVELRERQQT
FT                   KEGRAKLRERVSVEHSLAHIGQWQGRRARYLGVRKNLFDLRRVAVVHNLHVLARQEAAG
FT                   RSQAA"
FT   CDS_pept        complement(651121..652425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0607"
FT                   /note="ORF_ID:gll0607"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88548"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88548"
FT                   /db_xref="GOA:Q7NN08"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN08"
FT                   /protein_id="BAC88548.1"
FT                   /translation="MSAVVDNILGLAERRGVSAEVFYLRVDETPVEFETNRLKSLQTKA
FT                   TAGLAVRVIADGRLGFASSTDLSRIEGLLEAAVETAASGNEAEFDFAGSGELPTARSAF
FT                   EVPPTARFVERGEALVERVRAYNPDILVSATFALRRSRVEIATTGGAHGERERVTVTAS
FT                   LSGNLVRGEDLLEAYGYGVGRDAEPDYDRLVEEVLTKFRRAERNAQVAGGSLPVVFSPR
FT                   AAAFALGGLFQTALSGQTVVQKTSPLADKIGQTLFSEQLTLCEDPSAGTAAVPFDDEGT
FT                   PTRPKCFIEQGTVREFYWDRTWASRSGQPLGGNGFRGGLGRPSPGLVNLCMAGGRVSAA
FT                   ELIRSIDEGILVEQVLGAGQSNQFAGEFSVNLDLGYKIEHGEIVGRLKNTMVAGNIFEA
FT                   FNAQLAGLSTETEWVFGSACLPTIAFAGLGVSSRG"
FT   CDS_pept        complement(652422..652751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0608"
FT                   /note="ORF_ID:gll0608"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88549"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88549"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN07"
FT                   /protein_id="BAC88549.1"
FT                   /translation="MPEKALFEPAGLLFSIQIGCLLRRDMIQPRHCPLCTRLLRSVAVI
FT                   EDGLLHCEWDGTFHWDGQARRLRNLKSQQIWHLDVAGRVINPTRVQAVPEPRLHRRPIY
FT                   LPKLP"
FT   CDS_pept        653125..653622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0609"
FT                   /note="ORF_ID:glr0609"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88550"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88550"
FT                   /db_xref="GOA:Q7NN06"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN06"
FT                   /protein_id="BAC88550.1"
FT                   /translation="MDTGGKSLSSKHRLSYQDVYPCPICRHGEISCLVLTEAFACNFCR
FT                   HIFTADLEENTLRVEDSSQPLSWRWNGRHWQSIHREDFDLTLVIWIVGLALVIFPPTLV
FT                   WFSYRSLPEPPLLFPLIWTVLTLVAHLGLVGWLLAEHYQFPPYIAGKIRLRTWMEHRES
FT                   KT"
FT   CDS_pept        653917..654552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0610"
FT                   /note="ORF_ID:glr0610"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88551"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88551"
FT                   /db_xref="GOA:Q7NN05"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN05"
FT                   /protein_id="BAC88551.1"
FT                   /translation="MEPVLDFFRYLGNFEELIRAGGYVALTAIIFVETGLLIGFFLPGD
FT                   SLLVAAGVLIAATGLLNIWVLAALLCTAAIVGDTVGYWIGAKAGPRLFSREKSLLFAKD
FT                   HLIKAERFYTKYGAKTILLARWVPIVRTFAPVVAGAARMHYPTFLLFNVVGGVTWIGSL
FT                   LIGSYFLGQLIPDLEKNVHIVVAVVVLLSILPPIIEYLKARREPDASR"
FT   CDS_pept        654755..654910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0611"
FT                   /note="ORF_ID:gsr0611"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88552"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88552"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN04"
FT                   /protein_id="BAC88552.1"
FT                   /translation="MLQARASVENTPFERLMELAEEGAAESRLRGIGATPKFEDLPEDL
FT                   RRSLGG"
FT   CDS_pept        654951..655157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0612"
FT                   /note="ORF_ID:gsr0612"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88553"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88553"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN03"
FT                   /protein_id="BAC88553.1"
FT                   /translation="MRSTLPRAPSALAEASMARASARCHNRGQLKRQLGGRSAADDFLS
FT                   AADLYSKLGDAHREQISRHLSRR"
FT   CDS_pept        complement(655144..655785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0613"
FT                   /note="ORF_ID:gll0613"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88554"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88554"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN02"
FT                   /protein_id="BAC88554.1"
FT                   /translation="MVQVVAAGDLEFIDLETKFGLARTFDNSVFPEWQGGLPAITEVEQ
FT                   KALDRVRNQFLYIVKFGALEEIVKMVVLSPLLDLAGFYEPPFRLRTEQSVELLTEDDGR
FT                   LVRGRIDVLVFNELLWALVIESKRSDYGVSAALPQGLFYMFCSPKSQQPAYGLVTTGMD
FT                   FVFVKLLRDDQPRYALSRMYTLINPGNDLYDVLRVLKRLGHEIVQSPIDG"
FT   CDS_pept        complement(655817..657976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0614"
FT                   /note="ORF_ID:gll0614"
FT                   /note="similar to ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88555"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88555"
FT                   /db_xref="GOA:Q7NN01"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN01"
FT                   /protein_id="BAC88555.1"
FT                   /translation="MLLATLAKMLIKLTAPTPDERPLEPQCAIGGRLNAPVPVSPWPSP
FT                   ATVQLNANVGGSQGRQMSPYTRQMISLSDAFEDVARVLPGYEVRQPQLDMARAVERGFA
FT                   ERIAVVAEAGTGTGKSFSALVPAILSGKRVVISTATIALQEQYLYKDIPLLQKALPVRF
FT                   EARLVKGRSHYVSKRRWSESLLAPGITWLREWYEQTESGDLADLPTSPPSEIWDDIRSD
FT                   KDDCLREKCPHFDSCFYFESRRSLGQAQILITNHALLLIDRASHGQILPDFDLLVIDEA
FT                   HQFAEYATRALTLTLSNFGMGRTLSRIKKQFPNLGIALARAEAEANAFFEVLLTEAHQT
FT                   RRYNLDPAMADDLSAAVVRLLQSLKELNLGSEDNLETNVARMRRDRLVETLTGYEGNLR
FT                   VLAEPGENWVNWVEYQTTRGGGTNVALNCTPLDVAPPLGQWFSHPDGPTAVWMSATLST
FT                   AGADPFDFFRRQVGLPAGTAEERIFASPFDYPSQGLLYLPTHLPDPNDASYANAIAAEI
FT                   EKLVNFSEGRAFVLFTSLQQMKQVYALLEAKLLWPAQHQEQMPKRRLVEWFRTVKNPVL
FT                   FATASFWEGVSVEGPQLSLVVIDRIPFQSPGDIVYDARCELLSRTSGDRWAWFDRLALP
FT                   YAQLRLKQGAGRLVRTRTDKGIVAILDPRMHRKAYGKTILKSLPPMQVSRRFDPRLFRA
FT                   FIDPAGTGVSVEDDELWVQDFGLGI"
FT   CDS_pept        657994..658245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0615"
FT                   /note="ORF_ID:gsr0615"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88556"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88556"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NN00"
FT                   /protein_id="BAC88556.1"
FT                   /translation="MPDVTLSLPDEILLALKLTPNQLGDEMRFAAAVKLYELERLSSGA
FT                   AANLAGVPRTVFLSKLADYGVSSFRLGKEELSEDMRSA"
FT   CDS_pept        658238..658723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0616"
FT                   /note="ORF_ID:glr0616"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88557"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88557"
FT                   /db_xref="InterPro:IPR021799"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMZ9"
FT                   /protein_id="BAC88557.1"
FT                   /translation="MPEVIADTSPLQYLYQAEILDLLRLLYGYIVLPQAVADELAAGRT
FT                   RRVTLPDPASILWMSVRRVLPTKLLQMTSDLGAGEREVLALAVEMPGSLVLLDDGLARR
FT                   YARLLNLQLAGTLGVLLKAKQEKHINAVKPAVDRLEALGFRLAPSTRAAVLELAEEV"
FT   CDS_pept        complement(658740..661433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0617"
FT                   /note="ORF_ID:gll0617"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88558"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88558"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMZ8"
FT                   /protein_id="BAC88558.1"
FT                   /translation="MKKKDGFTPVEHLVDIVAIGQVDHPQLSCGFYILQRKQAFRCVFA
FT                   LRTPGIHACQSPEAMADACAGLVALCRDLPTGGRLSVRLSSFAESESRLAQLEQLRGRE
FT                   VGEPVDWLIAGEQQRVQGLAADGRRKVSELLLFACWGEWSAQAASRDWIDRVALGVQEW
FT                   WLSYLGEGAAESQARLHRLVSHAYAHCRQWLHLLNLTARLAVVPLGAEELMAWAWKQFN
FT                   TGSPPPPPRLLRLSGGGLCEQSHGDLDFRSALFESPPRLSAEKVSIGTPEAGMRHCAVL
FT                   VWDEKPSGFADPAAQLRYLWNLMARQEVVDTEIVVEISTVNERTSRDNAVRLQRQASAG
FT                   LKTSQRQGKLVDVPQQLKLEEAAELEKSFIEGARPVYLAVCVLVWRSDPLLLAEGCRFI
FT                   SGFFNRPARVVREVSYAWKVFFQSLPFVWEGLLVAPFDRRLELLDEEAPGFLPLVRLAS
FT                   IDREGVELLSEEGQTPLWLDLYRRHRNLALFGTTRSGKSVLLEVLMRHALARRVPVVAM
FT                   DFPKPDGSSTFSDLTAFVEGAYFDVGRHALNLFELPDLAGLEERVRAERLEEFQEFLVS
FT                   ALLVMVLGRDVQDPLLSQTVRSLLQLAAGAFFKDPAIRRRYEAATRAGPFTTPWRDYPS
FT                   LPDLLPFLEAGRLGIDTDQSSLRPAFEHIRLRLTYWMGSRVGARLSSPSTIRADAALLV
FT                   FALRNVSNAEDMTVLALANYAAALRRALATPASLFILDEAPILFECAEIANLVGRLCAN
FT                   GAKAGVRVIISAQDPDTIEKAPNSSKIFQNLRTRLIGRIEASAIPSFARVFGYTPASLA
FT                   RNASAQFFPNAREVFSRWLLDDGGLLTPVRYYPSFRSLAVVANNPDEQREREAFLAEVG
FT                   RRYPDRLSALSAFTEHYLRMLRDEPG"
FT   CDS_pept        complement(661430..661693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0618"
FT                   /note="ORF_ID:gsl0618"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88559"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88559"
FT                   /db_xref="GOA:Q7NMZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMZ7"
FT                   /protein_id="BAC88559.1"
FT                   /translation="MRKLNRRLGQKADFLNLVPGDLVFPWLLTVIGGYFVLSGILGLNW
FT                   IWTGTFVVWACALWLLLAGRRPHRFFGQMLDPPALARTRQLR"
FT   CDS_pept        complement(661704..662066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0619"
FT                   /note="ORF_ID:gll0619"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88560"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88560"
FT                   /db_xref="GOA:Q7NMZ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMZ6"
FT                   /protein_id="BAC88560.1"
FT                   /translation="MRKYLSLPAWLLRAVLAALLPVADGLIHPRPAHAVFFENARVWLN
FT                   ELFLSTGNLTAAFGVDMTVNVLRAVLLVWIALGIVRTVQAARNDEDWQTTARVPILATI
FT                   SIVVGDVITSLIIPSA"
FT   CDS_pept        complement(662302..663576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0620"
FT                   /note="ORF_ID:gll0620"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88561"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88561"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR024408"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMZ5"
FT                   /protein_id="BAC88561.1"
FT                   /translation="MDLSRDLALRAVALGNAPPERAERAQTGWDELRDAEETQGTFVRN
FT                   REAVRSLQRQLVFLGYTTGAGPSSGATIDGRFGPGTERAVHTFQREHGLAVGNFDRKTA
FT                   QSLVQAVAERATQLPATTLAQHTAILDGNLDRRTHLGIDHRSHLEAAAQGDGKEPVIPA
FT                   KFLYALVQQESTGGTFSRPRWEGSFAGSLGAMQRELQGHRPTLDNLDPERNQVQIDELF
FT                   ERAGASSRRLPGVLARMAGDKPDSRAKLEAMRTFAAFESGQLRELSTTFGYGQIAGFQT
FT                   LDRHWQQQAGRSGPQLLQALQSPDPKVQLDTLASFVRHGEDARGRHGGLLTAMQSGNCE
FT                   QMAASHNGAAWRTYNPGYALNLNRFAREYEQSEQDRLPGAAVGLSTQDPFAEARKSAYA
FT                   RSRLQLFDTPAPRIPLSVEPPTPSL"
FT   CDS_pept        complement(663620..664015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0621"
FT                   /note="ORF_ID:gll0621"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88562"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88562"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMZ4"
FT                   /protein_id="BAC88562.1"
FT                   /translation="MDTLNVQIPEHLAQRLLAASRQSECTPQEYVLAALDWCLTQQLDP
FT                   IDPEAVEPGALPEEARPVRLGDVRDLLLAEQMNQGAYLAARLDGLELAIRSLLNLELQT
FT                   DKRGSETLFQAIHQALSEELAQRGYSF"
FT   CDS_pept        complement(664020..665318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0622"
FT                   /note="ORF_ID:gll0622"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88563"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88563"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMZ3"
FT                   /protein_id="BAC88563.1"
FT                   /translation="MSGTLQIPQTTSPTCGNYAVLICCLQHSVGGAPMSISHLQVLADL
FT                   RHRSDPDAAERLSLGKALLAIKAQRIYQRLGFARFESFLDSRECPFGHTVCRHAMRLAE
FT                   RTDLHGALELGVGRLTELMRLQPEATTCLLTQGIPAGRLEAVSVRVLRRYILQMQGRSA
FT                   ARISVPVGDESTVCPQQVIERCDGQAREVLLNLLLEQQFGQDLARVQVLLQGRATPVQS
FT                   GAPLEAFWPDTRRGVPQRWVALTAHLEGLERALGGNPAKAAALLQRLRQPIEAWERAVF
FT                   YLDLCRRDAGRRDYYVQIHSACAAVEKILAGRDWHFNTDQGYLNAQLARGRQSRPVRLK
FT                   PFWRRLFNEVAPPQEFQDFLGQLACEVQAGEWCIRCDDSYQADFTLGCLRQRTAKLFWQ
FT                   IAAAHLDVERLRVLWQEGGRPREQVVHLQLSAA"
FT   tRNA            665365..665449
FT                   /product="trnS-UGA"
FT   CDS_pept        665560..665889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0623"
FT                   /note="ORF_ID:glr0623"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88564"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88564"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMZ2"
FT                   /protein_id="BAC88564.1"
FT                   /translation="MHVGNRPAIDMTTNNGLPPDVSARLDRIEVLVAANSEQITANSTA
FT                   IARLEANQAAMSERVNIIAERVDTLAESIRVLVPIIQSIQSDVRGLQLENRRILDILQQ
FT                   RGGNG"
FT   CDS_pept        665994..666581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0624"
FT                   /note="ORF_ID:glr0624"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88565"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88565"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMZ1"
FT                   /protein_id="BAC88565.1"
FT                   /translation="MDRVCWGPTAAHLRKKQRASRAWCSVCPSDMHVGNRPAIDMTTNN
FT                   GQPPEYSSRLDRIEAIVAATSEQIAANAIALSRLEESVARHDSVLERLEESVARHDSVM
FT                   GAIQTSIAANAAAIDRLEANQAAGSERLNILTERVNTVSESVNQVSRIAFATFQRFDAM
FT                   QVEIHDLRTDVRGLQLENRRILNILEQRGNNG"
FT   CDS_pept        complement(666613..668673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0625"
FT                   /product="prolyl endopeptidase"
FT                   /note="ORF_ID:gll0625"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88566"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88566"
FT                   /db_xref="GOA:Q7NMZ0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMZ0"
FT                   /protein_id="BAC88566.1"
FT                   /translation="MTSPFTYPPSRRDDQVDDYHGTPVADPYRWLEDAESPGTKAWVEA
FT                   QNQVTFGFLETIPEREAIRERLTHIWNYERYGTPFREGGRYFLFKNTGLQNQSVLYTVP
FT                   DLEGELRLLLDPNALSADGTVALSGLAVSDDGKYLAYGTSASGSDWQQWRVLDIETGED
FT                   LPDMVQWVKFSGASWLKDGKGFFYSRYDEPNAAGQFQDVNYFQKLYFHRLGTPQDQDVL
FT                   VYERKDQKEWGFGGEVSEDGRYLVISVSQGTDPKNRVFYKDLADPASAVVELLPEADAA
FT                   YEFIDNDGPLFWFTTDKDAPRGRVVAIDITQPLHLNELIPESEDTLQGVSILDNKFFAN
FT                   YLKDAHTQVRIYDLQGQYVGEVELLGIGSAGGFGGKRTDTETFYAFTSFTTPTTIYRYD
FT                   IPTAKSTVLFQPKVDFDPTAYTTEQVFFNSKDGTRIPMFITYKKGTPRNALNPTYLYGY
FT                   GGFNVSITPTFSPSNLLWLEMGGLYAVPNLRGGGEYGEDWHQAGTRLNKQNVFDDFLAA
FT                   AEYLIANKYTSPEKLAIGGGSNGGLLVGAAMTQRPELFAAALPAVGVMDMLRFEQFTIG
FT                   WAWVSDYGSSQDPEQFQALYAYSPLHNLKAGTRYPATLVTTADTDDRVVPGHSYKFTAA
FT                   LQAAQAGEGPVLIRIETKAGHGAGKPTTKLIEEAADRWAFLVANLRMQLKF"
FT   CDS_pept        669214..669975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0626"
FT                   /note="ORF_ID:glr0626"
FT                   /note="similar to carboxyl-terminal processing protease"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88567"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88567"
FT                   /db_xref="GOA:Q7NMY9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMY9"
FT                   /protein_id="BAC88567.1"
FT                   /translation="MPLRKIHAIRRKLPFTIWVASSFFALRPSRFQGVSVRFSSIGLWV
FT                   VTVALGLSSATSGGAQTPTCPQREPQRFSGVGLEMGFDPAGSMSVLRAIENSPAARSGL
FT                   QAGDRVVAVDGVPVAKLKGEAAARIRGEMGSSVNLTVRRGESDFDAVLTREEITVPPRS
FT                   VVGIGVTLGASKKGEPMIQTVFPNSPASEAALRSGDVIVSVDGKPAGKAADGALQGLLR
FT                   GEEGVAVLVGIRRNRLVTDYSITRLRFIPGC"
FT   CDS_pept        complement(669982..670764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0627"
FT                   /note="ORF_ID:gll0627"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88568"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88568"
FT                   /db_xref="GOA:Q7NMY8"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMY8"
FT                   /protein_id="BAC88568.1"
FT                   /translation="MWEFLYDHLGFDLGVEPWDFAIIFALVFVEGALSADNAAVLAALT
FT                   RTLPTDEERRRSLRYGIIGAFVFRFFAVLFAAWLIDNWPLKLAGALYLIYLAVSHFLKG
FT                   KDEDEDVVAEEKKLLSNPLFRATLGRLSPFWRVIVLVELTDIAFSVDSITAAVAFSDKA
FT                   WVVIVGGILGIVTMRFVAELFIKLIDRYVRLETAAFLAVGFIGFKMMTEVVANQLLPKL
FT                   HFETPEWVVLGVVAAIFAWGFTKKNVESDVEEEASLRS"
FT   CDS_pept        670885..671304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0628"
FT                   /note="ORF_ID:glr0628"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88569"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88569"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMY7"
FT                   /protein_id="BAC88569.1"
FT                   /translation="MMHHQQILKLQTRGQSLYPITGAVGEVVNQSGVQMGLCTLFLRHT
FT                   SASLLIQENADPDVLADLESFLAKLVPEDARSYRHNAEGPDDMPAHIRTALTHTSENIP
FT                   VSDGRLVLGTWQGIYIWEHRRHRQLREVVVHIAGN"
FT   CDS_pept        671339..673576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0629"
FT                   /product="exodeoxyribonuclease V alpha chain"
FT                   /note="ORF_ID:glr0629"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88570"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88570"
FT                   /db_xref="GOA:Q7NMY6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMY6"
FT                   /protein_id="BAC88570.1"
FT                   /translation="MGLAMQRSIEGLAGGERDEMLQGVVERVTFHNPQNGYTIARVAVR
FT                   GLADLATVVGNFAQLQPGQTMQFWGCWKDHPQYGPQFLAHRHEETRPATIGGLEKYLGS
FT                   GLIKGVGPVTARRIVAHFGLASLEIIESDCSRLAEVPGVGAHRIRLIQAAWQEQKAIKE
FT                   VMLFLQSHQVNTTHAVKIFKTYGDEAIERVRTNPYQLAQDIWGIGFRTADQIAQNLGVA
FT                   PDSDERLKAGILYALITATEEGHCYLPLEEMLDQAVALLRLEEVAESVRPRLVEMARAL
FT                   VREGQIKAERPSGGAEAPVVCFQPSLWQCEVGLARRLCERPPAPVDTGRVEAWLERYTH
FT                   HHGLQLSAEQRQAVMLAAREPVTVLTGGPGTGKTLTTRAVAALWKAMGKKVLLASPTGR
FT                   AAQRLAEVSGQEAKTIHRLLEFDPSTMGFKRCAENPLDAQAFVIDEASMIDVVLAYNLL
FT                   KAIPAGAQVLLVGDQDQLPSVGPGNVLADLVRSPAIPTARLTQVFRQAAASRIITNAHR
FT                   INSGQMPDLAGEGSDCLFIEAHEPAQVVERVREFVVQELPRRGFRSLADAQVLCPMNRG
FT                   LVGSNHLNTVLQEALNPLPPDGGELDRGRRLFRVGDRVIQLRNNYDLGVFNGDLGTIAG
FT                   IDFENQKLQVQFFERTMGYDFADLNELSLAYAISIHRSQGSEYPVAIIPVHTQHFPMLS
FT                   RNLLYTGLTRARKLAVLVGTRKAIAIAVREVKAMQRYTRLSERLSPLQADE"
FT   CDS_pept        673629..673880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0630"
FT                   /note="ORF_ID:gsr0630"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88571"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88571"
FT                   /db_xref="GOA:Q7NMY5"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMY5"
FT                   /protein_id="BAC88571.1"
FT                   /translation="MQGPTVRISASAHRTLKELAARSGESMQTVLDRAVEEYRRGQFLE
FT                   EANRAFAALRDDPEAWQAELAEREIWDHALADDLGEEH"
FT   CDS_pept        673898..674215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0631"
FT                   /note="ORF_ID:glr0631"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88572"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88572"
FT                   /db_xref="GOA:Q7NMY4"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMY4"
FT                   /protein_id="BAC88572.1"
FT                   /translation="MWLADLDPTRGREQAGRRPCLVVSADPLNRGPAQLVVVLPITSRD
FT                   KGIPFHVGLEPPEGGVTVRSFIKCEDVRSISTQRLTEKWGAVRNETLLAVEDRLRILLS
FT                   L"
FT   CDS_pept        complement(674236..674652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0632"
FT                   /note="ORF_ID:gll0632"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88573"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88573"
FT                   /db_xref="GOA:Q7NMY3"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMY3"
FT                   /protein_id="BAC88573.1"
FT                   /translation="MSTFVLDVSVALAWCFHDEATSASWAVLDRLETEEAAVPSLWHLE
FT                   TGNILALAERKRRITAARLAEFVALIDTLAITVDEQTPYRVLSDILALARNERLTTYDA
FT                   AYLELAMRLGVPLATKDAELRQTAAKLGVELLGV"
FT   CDS_pept        complement(674649..674891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0633"
FT                   /note="ORF_ID:gsl0633"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88574"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88574"
FT                   /db_xref="GOA:Q7NMY2"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMY2"
FT                   /protein_id="BAC88574.1"
FT                   /translation="MIFTVGAFEAKTHFANLLERVARGEQIVITRHGTPVARLVPISGN
FT                   DRERAKQTITRLKEFSRGQTLEGLSIRALREEGRQ"
FT   CDS_pept        complement(674979..676997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0634"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /note="ORF_ID:gll0634"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88575"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88575"
FT                   /db_xref="GOA:Q7NMY1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMY1"
FT                   /protein_id="BAC88575.1"
FT                   /translation="MPAPGTAEPVTILLVDDRFENLLALEAVLGELGQNLVKARSGPEA
FT                   LRHLLRQDFAVILLDVQMPGMDGFETAQLIRQRERSRHTPIIFLTAYSANDSLIFKGYA
FT                   LGAVDYLLKPINPSILISKVVVFIDLFRKSAEIERQAGALVAVNRQLRSSEQRLQDFLD
FT                   NASDLIEIVSPEGRLLYVNRTWRETLAYPADDLEKMTCFDVVAPADRPLLAEALERVQQ
FT                   SQRSERLEVAFLAMGGREIAVEGSLNCQFDKGVPQAIRCIFRDITERRQAEQVRVEILR
FT                   EQVARQQAEEASRMKDEFLAMVSHELRTPLNSILGWAQLLRARRIDEKAATGALESIER
FT                   NARMQNRLIEDLLDISRVVTGQMRLELQPLELSGVIASAVEAVQPAAAVKQIQLRCRID
FT                   AAVGPVLGDVDRLHQIAWNLLANAVKFTPQGGTVEVDLAQGEIHAQLVVRDNGIGISPA
FT                   FLDQIFERFRQADSTSTRVHGGLGLGLSIVRHLVELHGGTAAAESAGKGQGATFTVRLP
FT                   LLADGTPIQDEGKLVQANGRTEALTELVQWLAGLRVLVVDDEVDAREFVATALGEYGVQ
FT                   VVTVGSVREALSALAAQKTDVLVSDIGMPGEDGYALIRELRSRGNTLPAIAFTAYARGE
FT                   DLKDALQAGFQCHVPKPVEIAQLVSAIASLSRNRKAT"
FT   CDS_pept        complement(677001..681164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0635"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /note="ORF_ID:gll0635"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88576"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88576"
FT                   /db_xref="GOA:Q7NMY0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMY0"
FT                   /protein_id="BAC88576.1"
FT                   /translation="MTAVSRKKAKADAAFLDLDQLLETLAAVRSGNFSVRLPTAGTGIG
FT                   SEIAATLNGIIALNEHLSVELSRVGNAVGKEGKVNQRVALGDAAGAWTFCVESINTLIT
FT                   DLAQPTTETTRVIRAVANGDLSQRIPTELDGRPLQGEFLQTAQIVNVMVEQLGSFASEV
FT                   TRVAREVGTEGKLGVQAEVRGVAGTWKDLTDNVNSMAGSLTAQVRNIAEVTTAVASGDL
FT                   SKKITVEVKGEILDLKNTINTMVDQLNSFASEVTRVAREVGSEGKLGGQAQVTGVAGTW
FT                   KDLTDNVNSMAGNLTSQVRGIARIVTAVAGGDLKRKLVLEAKGEIETLAETINEMIDTL
FT                   ATFADQVTTVAREVGIEGKLGGQARVPGASGTWRDLTDNVNELAANLTTQVRAIAEVAT
FT                   AVTKGDLTRSIAVEAQGEVAILKDNINQMIANLRETTQKNTEQDWLKTNLAKFTRVLQG
FT                   QRDLEAVSRLILSELAPLVSAQHGVFYLMDSAENRPCLKLLSTYAYRERKRLANWFFLG
FT                   EGLVGQCALEKERILLTDVPGDYIKISSGLGEAAPFNIVVLPVLFEGQVTAVIELASFR
FT                   SFSEIHLTFLDQLTESIAIVLNTIAASMRTEQLLKQSQSLAEELQSQQTELTDTNKRLE
FT                   QQANSLQASEERLKSQQEELQQTNEQLQEKARLLSIQNKEVERKNREIEQARQSVEEKA
FT                   RQLALTSKYKSEFLANMSHELRTPLNSLLILARLLSDNAEGNLSEKQVEYGRTIHSAGA
FT                   DLLGLINDILDLAKIESGTMSVEIEQMHFGDLRSQMERIFRQVANDRGLEFAVECAANL
FT                   PRAMLTDPKRLQQVLKNLLSNAFKFTALGSVTLRVEMATGGWDPASESLNRASGVVAFS
FT                   VIDTGIGIAPDKQRVIFEAFQQADGSTSRKYGGTGLGLSISREIARLLGGEIQLESEPG
FT                   RGSTFTLFLPLDAPLPGYSAGDWALFSLPEPVGATRERTPAAAMEGGWRSRAELNDDRD
FT                   NLEPEDRVLLIIEDDANFARILGDLARTHGFKAVVALGSETGLAAVRDLQPHAVLLDIH
FT                   LPGMDGWTVLDRLKHDPETRHIPVHLLSVDDAGQRGLQSGAVACLKKPVDSEQMAAIFA
FT                   RMHAFADRKVKNLLVIEDDEAQRTSIVELIGGGDVRSQAVATAQEALALLQSEPFDCVV
FT                   LDLGLPDADGQALLGQIKGSADPWNLPVIVYTGRDLTPQQERDLKRRVEAVIVKGERSA
FT                   ERLLDETARFMHRVQAELPAPQRQIIEQLRHSGSILAARKVLIVDDDVRNIFALTSALE
FT                   REGMQVLYAENGSDGIALLERTPGIDMVLMDVMMPGMDGYEATAAIRRQVRFKELPIVA
FT                   LTAKAMRGDREKCLEAGASDYITKPVDTEQLLSLLRVWLSRREN"
FT   CDS_pept        complement(681375..684191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /product="DNA polymerase"
FT                   /note="ORF_ID:gll0636"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88577"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88577"
FT                   /db_xref="GOA:Q7NMX9"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMX9"
FT                   /protein_id="BAC88577.1"
FT                   /translation="MPDSSAPVLLLVDGHSLAYRAYFAYVRGGETGLRTSGGTPTSVSF
FT                   GFLKLLLDAIERDRPSMVAVTFDTRMPTFRHEVDATYKSGRAETPDEFIDDLQNLREIL
FT                   TALDLPQFELPGYEADDLIGTLAVHGAGQGYDVKILSGDQDLFQLITDEGAPGGSIRVL
FT                   HQNTRTGTEEFGPAQVKEKLGIAPRQVVDYKALCGDSSDRIPGVRGIGAKSAVKLLEEY
FT                   GSLAQLIEAVDTIPGALGKKLKEGVEDARHSYWMATIETNVPLVVDFEACRLVGFDAER
FT                   VAPLLEKLEFRSFLRQLQRLQRSFGGTPSARPTALNEDADNPLAGIGTASEDELWFDFA
FT                   PSVPMDLEVRVVQTAEDFQAFLDALLAQDGLVAWDTETNNLDPRHARLVGIGCAWEPGV
FT                   AYYLPLAHQQGSNLETDAVVAALTPYWQDRERPKVLQNAKYDWLVLRNYGVALAGIAFD
FT                   PMLASYVLDPEGKHNLMTLAQNHLQITMGSYEALVPKGQTIDAVEIAAVSRYCGEDAAV
FT                   TLRLVPVLQAKLDEDPRLAGIFKEIEVPLEPVLARMEERGIRIDKAYLGELAQELDRDL
FT                   ESLEQEAYTLAGSKFNLGSPKQLSDLLFNKLGLSAKKSRKTSLGYSTDAAVLEKLRDDH
FT                   PIVEAILSYRTLAKLKSTYVDALPLLVDPRTDRVHTDFNQTVTTTGRLSSSNPNLQNIP
FT                   VRTSFSRRIRRAFVPEPGWLLVAADYSQIELRILAHLTQEPVLLEAFQTGGDVHTLTAR
FT                   LLLGREEVTSEERRLAKIINYGVVYGMGARRFARETGVSATEAEDFIKAFYRRYPAVFG
FT                   FMEQTRRMAVEQGYVETLLGRRRYFRGLGQLNQRDREGALRAAFNAPIQGTAADIIKIA
FT                   MVRLEQTLAGRRTRLLLQVHDELVFEMPPEERPEVEPLIRSGMENALDLLVPLKVELNA
FT                   GPNWLEAK"
FT   CDS_pept        complement(684263..685033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0637"
FT                   /note="ORF_ID:gll0637"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88578"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88578"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMX8"
FT                   /protein_id="BAC88578.1"
FT                   /translation="MMLPFPFPAAGGRADAGEQLINSVVAAAIRALLSKVEDLQIGIYC
FT                   QPMSKLLQGAIDSFNLRGRGMVIKNQFRVESLRVDTDAIAVDLGAMLGGRVRLQRPTEA
FT                   IASVVLREEDINTAFEAPLVLSKMRGMRVEGGDETLAIRQTRVQLLDDNWMDFKTEIVF
FT                   EQSGRSEPLRFKAHLATEEQRRIVLDQTDFEGQSEEACQLGHLFVAQFNRIMDLDKFNL
FT                   DGATLRVHRLRIRNQQLIFEGRAHIDHFPGQHRK"
FT   CDS_pept        685261..687021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0638"
FT                   /note="ORF_ID:glr0638"
FT                   /note="probable porin; major outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88579"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88579"
FT                   /db_xref="GOA:Q7NMX7"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="InterPro:IPR038673"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMX7"
FT                   /protein_id="BAC88579.1"
FT                   /translation="MKMRKPSLLAGTIGLLTLLGLAGPALAEPSDTQQIDQYLQQGMGD
FT                   SVAQVNSVSELTDVDPNSWAFQALKSVVERFGCLEGYPNKTFLGNRPTSRYEFAAGLNA
FT                   CLEKVNELITAATADKATKEDLATLQRLQEEFRNELAALRGRVDALEAKTKDIESKLFN
FT                   VNSKLDASVVMAATIGGGDTSKFFYTPVPVGVGPSYGDSQFSRFVATGDANAPATSLPS
FT                   RALGEANASFTARTSLNVRATFTGTDELLVRMRGVAGQDLGAVFQGIASGLGTQFYALG
FT                   PNNNAYDGSTVGGGVDGRAPVSFDKIRYTTNLFSDSFRIFVGPRIDIFEFIDTNSFANN
FT                   EEVDFSSGFFINNPLTTFIFAGPGGGFDFQLGDFLAIRAIYIAPTGGASGTRATGSLPF
FT                   GGSGLFGGSYTAVGELEINPIRTASIKLQYAHFLEQGAVLGTLLNGSGTSGVTDVYAAN
FT                   VEWAIFPSLAIFGRYGYGNSRINGAASTTFTEIESSTWQAGFALPGLFGPGNTFAAAYG
FT                   QPIRVNSGQFATGLSFVPTASEGNVEVFYRFQVSDRLSLTPDVQFYINPVNSNSNAGIT
FT                   VGTIRATFTF"
FT   CDS_pept        687127..687453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0639"
FT                   /note="ORF_ID:glr0639"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88580"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88580"
FT                   /db_xref="GOA:Q7NMX6"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMX6"
FT                   /protein_id="BAC88580.1"
FT                   /translation="MTTQTPLPPESTDYPASRRILAGVGWGVLWGGGIAAVIFPLVAAN
FT                   LTVGILLALIILIAIAMGISLHWNAAREPCPQCATVFIATPSGGRCPKCGERVRVVDRR
FT                   MIKI"
FT   CDS_pept        complement(687464..689968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0640"
FT                   /note="ORF_ID:gll0640"
FT                   /note="similar to glucosamine-6-sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88581"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88581"
FT                   /db_xref="GOA:Q7NMX5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR032506"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMX5"
FT                   /protein_id="BAC88581.1"
FT                   /translation="MNSSPPTAAPSALASAATAAIGIFFSTAAAIAAPPPNVVLIVTDD
FT                   QAWNTLAYMPKLQSQLASQGVTFTNAFAGQSLCCPSRATILTGRYPHNHGVLGNDAPFG
FT                   GALAFYDASTLPVWLQESGYRTGLFGKYFNGYSYSAFYTPPGWDEWQTFQLAGYYNYRI
FT                   NANGTIEDYGRSESNYSTDVLTQKAVAFITNSAASDKPFFLFLAPFAPHAPYTPAPRHA
FT                   GRYADIPPWRPPNYNEQDVLDKPTWVQKLRPASPQTQTDYDKERQAYLEMLLAVDDGVE
FT                   SILQALESTGQRENTLVIFTSDNGLTWGEHRWWEKGCSYEESLRVPMVVSFPGVSTAAR
FT                   QEELLVLNMDLTATIAEAAGIPIPATVDGRSLLPILKGQAVSWREQFLFEGWQLTPTHA
FT                   GVRSTAWKYMENLAGEQELYNLIDDPYELDNAVGVADYGAQVAELQATLAQMRYSAKGM
FT                   APYLLVHSPSFGNNLLEKVGENNPAVLRTDMTAWPNRYRVYRKSARDGGLLGQMTYRED
FT                   LFPEVEAIALPDINGNGAYEVAVQSLSADKSGRLIEVRDSLSGELIREVRPSSDVGKLD
FT                   VYPDLGGNGYPEIAVLSGKEGRIELFDTRTGRKTTVSLGAPPAGGLAAQEPATFGWIPD
FT                   INDNGKPEFVVLWLSRLKEVAGSQQPADPYYQVFDPLSKQTLSSVTLQSVTGVPDLVGL
FT                   PDISGNGAPEIAVLQGNAPVSVTVKDSKTGTTVATLDYPGLVYARAMAMVATEGGPEIA
FT                   VLGTGQGWSNQVILKGAASGTSRQITFDKNFLTRDLEVLADTNGNGRPELAVLLANPDS
FT                   GVLKLQLRDTGTGELVRDVLYP"
FT   CDS_pept        complement(690026..691483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0641"
FT                   /note="ORF_ID:gll0641"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88582"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88582"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMX4"
FT                   /protein_id="BAC88582.1"
FT                   /translation="MNASLPAGASSAACTPFQKVLPTILKMVCLRSQAVRLVGFGLAAT
FT                   VALSAAPVQAQVGFAPAQTFGVGTTPRGLAIGDLDGDGRIDIVTANIGNNTLSALLGGG
FT                   DGTFGDLQNYPVGSSPRAATLADLNGDGDLDAITANGGSGNLSVLRGNGDGTFAAAVNY
FT                   PVNGTFPAAVAAGDLDGDGDLDLVSTNRYSENISLLSNNGNGTFGAPRNLVLPPGPSSV
FT                   VIVDLDEDSDPDLVVGNLFSANVSVLLNNGNGTFAAPRNYAAASGTSAVGMGDLDGDGD
FT                   LDLTAVNRFADNVSVMLGNGNGTFGATRNFAVGDYPVALAIGDLDENGDLDLVTANRRD
FT                   AGNVSVLPGNGSGGFTAALTFATGGDGATGVEAGDFDGDGDLDLAVANGFASNVGVLIN
FT                   TGDGVVLPVIDSITPRRGPVGTEVTITGTGFTGTTAVTFGGASAAFTVISGTQITAIVP
FT                   AGATSGPIAVTTPAGTATSARRFRVTS"
FT   CDS_pept        complement(691525..692985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0642"
FT                   /note="ORF_ID:gll0642"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88583"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88583"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMX3"
FT                   /protein_id="BAC88583.1"
FT                   /translation="MGLFLRLGSQQSFHREFTMLLKIFSKLLPTLRSREVRLVGFGLAA
FT                   TVALSAAPVQAQVEFAPAQTFSVETTPRALAIGDINGDGDLDLVTANIGNNTLSALLGG
FT                   GDGTFAAARNFAAAGGTCAVATGDFDGDGDLDLAAANRFADNISVLSGNGNGTFGAARN
FT                   YLVDGSFPTGVAAGDLDGDGDLDLVSANRYSANISLFKNNGNGTFGIPRSLPLPAGPAE
FT                   VIFADIDEDGDPDLVVANIFSASVSVLLNDGKGTFAAARNFAAAGGTSGVVVGDFNGDG
FT                   DLDMAATSRIADKVSVMLGDGTGSFGPAQNFVVGDYPVAIAMGDLDKDGDLDLITSNRR
FT                   PASNVEVLINNGSANFSATQIFPAGGEGATYIGVGDLDEDGDLDVAVANGTASNVGVLL
FT                   NTGDGTAAPSIESIAPRSGSVGTEVTITGTGFTGATAVTFGGVSAEFTVVSGTQITAIV
FT                   PAGAASGPIAVTTPAGTNTSTRRFRITS"
FT   CDS_pept        complement(692970..693971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0643"
FT                   /note="ORF_ID:gll0643"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88584"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88584"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMX2"
FT                   /protein_id="BAC88584.1"
FT                   /translation="MQRCIHPCVQFTLSSLSVGTVLWLAPAQAQPAAVCPDRTDSRLDV
FT                   PAGVVCAIQPSLTDRAIDDGSGRGYGYHVVGIPEHPDQLQGVFVYLLGSGGKPFDPDRG
FT                   VFTPGQSMEEGMAQNHLVISLAHANADPVGSLCNNRSSCYGPVREEIVYGTPVAAEVQV
FT                   DQANSIVYRLDALIRFLKRYLPADFPFPAAISGKTINWRKLRLGGSSQGGGHAGYLARD
FT                   QTVERLCFLASPVDSTTQADPPRGSVETVSAHWVGEQSWQTPVEHIRGVVHQGDQYYAG
FT                   IVANYATLGLQKSTSESNPNHHWVELTAPTDKPHTAPANERDFAYAREWACF"
FT   CDS_pept        complement(694002..695177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0644"
FT                   /note="ORF_ID:gll0644"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88585"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88585"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMX1"
FT                   /protein_id="BAC88585.1"
FT                   /translation="MHFLFTGFSGYAMFWLVLGCTVLSWQPPTLAQVGEDVLIAGPQVG
FT                   ISDPEFDPAGGRFCWIDDEGNVWIGEVSRRSGRFSPRNGKGVLVDTGAVPPKLTRNGPE
FT                   WAFSSAGAQIVYTKYDSEGRFALGRARFDGTDWIGEVLPGGSNRYLPFGSSDAADAEPR
FT                   ISYAYHFDSESIVQVRNYWRKLDDPASEEVLTGTLFPGRWVPGLRAMLVNKLDAQGISQ
FT                   VHLYNIDTKVYEQLTFDPVSKSASIMWQAPEFNNEYVLFAVAAELRIDVYRKIDGLWQK
FT                   IHALRPPSAGPYILSPEIFVHNGKSYISMATSTVSGTSEEKLITPSDLWLVGVDPATPL
FT                   YRQLSAPEVRVRLDPEVFITDKGPYIYFTSISVPGTTSIYRVDTGLGPTQP"
FT   CDS_pept        complement(695241..696770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0645"
FT                   /note="ORF_ID:gll0645"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88586"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88586"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMX0"
FT                   /protein_id="BAC88586.1"
FT                   /translation="MLTPKMLRLSLILSLGGTLLLGAAIYGPLHAQPTTWAQRMGSATY
FT                   REGGIPTEIWRGVDTDDAGNIYLSGTFGDTATFSNASTTLTSAGEEDIAVAKYSPEGTL
FT                   LWARSFGSTLQDQALANCVDAVGNVYVTGLFTGTVRFGGTTLTSNLVPPPNSRRLAPDA
FT                   FTVKLNPDGEVLWARASGRYISGNVTPGAQVVSNLAIPVLGSECVVDATAVIISGTFGG
FT                   DQTTRVSFDGTPPVGVTADFDGFIVKYDSDGNFQWVQRTEGQTPGATNQARALGLARDG
FT                   TGDIFVGGQLEGTTRHGSTSLTAAGGADAFIGRLGPGGDWLWARSIGGTGDDVVRGVAG
FT                   AGGDLVLGGKFENSFNVLGTSTVLTSAGGEDIFVARLTGGGDLVWVRSFGGRRDDEGTE
FT                   VDFDIGGNVIIAGAYSGRFTFGSTRVRSQGGTDFLIGLLDGASGAPLSLSTPTGGSGND
FT                   YSYAVAADNLGNYIYCGFFEGTAQWGDTTLTSAGFEDAVVGKIGNSQGFAR"
FT   CDS_pept        complement(696799..698346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0646"
FT                   /note="ORF_ID:gll0646"
FT                   /note="similar to N-acetylglucosamine 6-sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88587"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88587"
FT                   /db_xref="GOA:Q7NMW9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012251"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMW9"
FT                   /protein_id="BAC88587.1"
FT                   /translation="MKTTCTFQHRPKPGSLAWAGLARFAVCLWLGLALMSTAAVAQQPP
FT                   NVVVIMTDDLSEQVFDEASGRGFLPTIASRLVNQGTRFRQSFTTQSLCCPSRATFLTGQ
FT                   YTHNHGVESNTPPDGSISAFDDRSTLATWLDAAGYRTGYVGKYLNGYGSDRNRRSPLDD
FT                   PTYVPPGWDDWQALITGTMYNYVLNDNGTLIDYGEDPAEPPEEYQTDVLAERAVAFVDA
FT                   AATAPFFLTVAPVAPHFEVAPGVSSCRLFPNSLRSIRPAPRHQGSAGQVPLPQGTAFNE
FT                   QDVTDKPTWVQAAPLLSERSIDCLGNIYRDQIESLRAVDDLTASLIAALERRGVLGNTI
FT                   VVFTSDNGYLFGQHRLTGKNVIYEESIRVPLVVRLPGSTALRLIEQLAVNIDLAPTIAA
FT                   WAGATPTLTVDGRSLVPLLANPELPGWRKRFLLEHGDVRGSGNSTGVRTGSRDTEYPNT
FT                   VFIQFDNGERELYALDADPAQLESRHLDQPDTAAALGALASELRLCSGTTCRELEDQ"
FT   CDS_pept        complement(698343..699362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0647"
FT                   /note="ORF_ID:gll0647"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88588"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88588"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMW8"
FT                   /protein_id="BAC88588.1"
FT                   /translation="MNIRTCRVRTFASLVGAALACSLQSMSAQAATALCPSGAHAQHDT
FT                   AAGVVCVIRPSLTDPEIADRGTTNLGYGYHVVGLPNDIDAARGVFFYLMGTNGKPYDPV
FT                   SQSLPSLSIVEEGIAQGFVVLQLAYPNDVAVAELCGNDGGCYGPARQEIIYGLPISAAV
FT                   EISPEQSIMHRLSALVAYLKANMPGEVVMPQAIRGAAIDWQAMRLGGSSQGGGHAGYIA
FT                   HDYPTGGVCFLASPVDTVAVTTESTTRYSAVEWIAQEGWQTPSERLKGVVHRQDGSYES
FT                   ITTNFRALGLRRSTSTLAPNNDWLVVNIPTNKPHTSPANHRDLADARAWACFASEDSL"
FT   CDS_pept        complement(700309..701190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0648"
FT                   /note="ORF_ID:gll0648"
FT                   /note="cell-division protein FtsX homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88589"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88589"
FT                   /db_xref="GOA:Q7NMW7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMW7"
FT                   /protein_id="BAC88589.1"
FT                   /translation="MIQRVTTQVDYLLREAFTGLRRNLWMIWSAVSTLAVLLFLLGLGL
FT                   RASWQLQDAVSDLGSRLEISIYLDPGVRAAAVEPDLRTLVGVDEIKSVSKEQAWAALKK
FT                   DLGVRSDPGESLGGNPLVDSLRVRIAQPEAVAPLAAQIQQIEGVEEVSYGSEAAQRLDQ
FT                   IQQAMRWVGLALTAVLGVATVAVITSTIRLIVQSRRKEIEVMQLVGATPLRISMPFILE
FT                   GLAFGIAGALIAWGLIEATSRVVAQKQLELLPFLQWQPSEPAAFTLPLILLGVGVALGM
FT                   LGSLIAVRRAIR"
FT   CDS_pept        complement(701204..701932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0649"
FT                   /note="ORF_ID:gll0649"
FT                   /note="cell-division ATP-binding protein FtsE homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88590"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88590"
FT                   /db_xref="GOA:Q7NMW6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMW6"
FT                   /protein_id="BAC88590.1"
FT                   /translation="MFDLPSTPSEADSTGFTGEAIACLHNVSKIYPNGCRGLHSVNLQI
FT                   RKGDFLFITGPSGAGKSTLLKLLYGAEMPTEGQVEIEGNLFHRLRGRALAHLRRRIGVV
FT                   FQDYQLIPTKTVEENVAVVLHAQGACRTEIQRRVGPTLRMVGLAPKAKCFPDQLSGGEQ
FT                   QRVSIARAVVHTPPLLLADEPTGNLDAHNAWSVLQILKRLHDLGVTVIVTCHNEQLVEA
FT                   FARRVVRIEAGILRELPVLT"
FT   CDS_pept        complement(701932..702657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0650"
FT                   /note="ORF_ID:gll0650"
FT                   /note="probable UDP-N-acetyl-D-mannosaminuronic acid
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88591"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88591"
FT                   /db_xref="GOA:Q7NMW5"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMW5"
FT                   /protein_id="BAC88591.1"
FT                   /translation="MTALPTAPILDLPVHLSADYTRSLVELVEAAQGGHVITLNAEMAM
FT                   LAQREENLARLIRRADLVVPDGAGVVWALQRVGRRVRRCAGIDLVESALRQLAPRHTRI
FT                   FLLGAAPGVAEAVGEGWRRQYPGLVVAGARDGFFGPDEASAVLEGIARSRPQLVLAGLG
FT                   VPKQEYWIEQARRRLTDVVFVGVGGSFDIWSGTKARAPRWLRENYLEWLYRLYREPWRA
FT                   KRMLALPKFALAILRGVRR"
FT   CDS_pept        complement(702794..703327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0651"
FT                   /note="ORF_ID:gll0651"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88592"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88592"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMW4"
FT                   /protein_id="BAC88592.1"
FT                   /translation="MACKPMVALRPLPVAAPVAPVVLPERSPQLLLDVFLRRWSLRSPR
FT                   SRLLRLVSELNRAGWNCAVVDGGSHTASWQLLTGSGRNRRVQASSIADGLHRLEALQRC
FT                   EQFDLVILHEILCSPGRVRDWLAWTPGRGAVLWIRRGEAVLLEEHDNRTYPPRLEAFGR
FT                   LVEKVLHLLDRWGG"
FT   CDS_pept        complement(703381..703689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhE"
FT                   /product="NADH dehydrogenase subunit 4L"
FT                   /note="ORF_ID:gll0652"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88593"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88593"
FT                   /db_xref="GOA:Q7NMW3"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMW3"
FT                   /protein_id="BAC88593.1"
FT                   /translation="MPSLNAFLLVGAALFCIGFYGLVTSRNAVRVLMSIELLLNAVNIN
FT                   LIAFSNFLDPNNIRGQLFAIFVITVAAAEAAVGLAIVLAIYRNRDTIDMENFNLLKW"
FT   CDS_pept        complement(703706..704299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhG"
FT                   /product="NADH dehydrogenase subunit 6"
FT                   /note="ORF_ID:gll0653"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88594"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88594"
FT                   /db_xref="GOA:Q7NMW2"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMW2"
FT                   /protein_id="BAC88594.1"
FT                   /translation="MTFSEGVQLVSFIILTAIVLGGAAGVVLLRSMVHSAFLLGLVFIG
FT                   AAGLYVLLNADFVAAAQILIYVGAVNVLILFAIMLVNKRIPTDRPAFSPRNAVTGLVCA
FT                   GLFALLAVCIFQVPWQIQEPVAMNTVVEIGKRFFSEFLLPFEVASVLLLLAMVGAIILA
FT                   QREYVPDRVEGEPEPLALPERPREEVDTTPTGRR"
FT   CDS_pept        complement(704296..704925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhI"
FT                   /product="NADH dehydrogenase subunit I"
FT                   /note="ORF_ID:gll0654"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88595"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88595"
FT                   /db_xref="GOA:Q7NMW1"
FT                   /db_xref="InterPro:IPR004497"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NMW1"
FT                   /protein_id="BAC88595.1"
FT                   /translation="MVKFLEKVGGYARDVLESAKYIGQGMGVVFDHMRRKPVTVQYPYE
FT                   KLIPSERFRGRIHFERPKCISCEVCVRVCPINLPVVDYEFNKETKKKELNSYSIDFGVC
FT                   IFCGNCVEYCPTSCLSMTEEYELSVYDRHELNYDDVALGRLPTRVTDDPVVRPIRELAY
FT                   LPKGVMDGHLEDPGSRRAGELPEEIVARLRPADHSSGTDANKKEGE"
FT   CDS_pept        705059..706849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0655"
FT                   /note="ORF_ID:glr0655"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88596"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88596"
FT                   /db_xref="GOA:Q7NMW0"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMW0"
FT                   /protein_id="BAC88596.1"
FT                   /translation="MTFAVPNFLLIAAAVAPALFLLALLALLPKSVTRWAAPRPLWTVA
FT                   IATLTGVGSAFIALPVEMLLTSTPWRITNLGVLAVFALVAAGLAEEGAKYLVVRFYSWR
FT                   LAPFRERYDGLLYGGAVGLGFGALENVFYVSEGGLETAMVRALTAVPFHGMLGLVMGYF
FT                   LGRAKVRQLAGERWGGLHALGLFWAVLLHGLYDFFAFQASQIALVLLNGLLVVMALWCL
FT                   RTVISTRALSPSWGGCEPAAPTPFVPPPAVARNPMLAGILGLVPGLGQFYNREWQKGLF
FT                   LLAAGIINLVLLASVWLLLNAPQAAIEALFVLAGLSLAIKPEQFIQTLAAAPVLQILLA
FT                   LNAVFCLLSAFDAYRTARSGRFDYLKAPEKRIRFLQTFSASYVGHVLLLFFAVLVPVIA
FT                   GGGPKGQGEQPGQIGTIEFDLVTTPKKLDGFSGKPEGTAKGTAKKNAPKVVAQKSAPVP
FT                   VPGPQAPKAQEAQEAKGLPRSYNEYLSWKIRRYHDLYFDRVGTGQYTVVQYEIDSVGNV
FT                   TNVQVLYDHTTAPGDVAEMAAETVRRLDPALPLPKGIRSVTITELFWDGSPIGSPGSLE
FT                   QHLSELPDGREVMPYPPEQS"
FT   CDS_pept        complement(706853..707551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0656"
FT                   /product="endonuclease III"
FT                   /note="ORF_ID:gll0656"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88597"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88597"
FT                   /db_xref="GOA:Q7NMV9"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMV9"
FT                   /protein_id="BAC88597.1"
FT                   /translation="MSAIRQERRARAERLLVKLKVAYPRGLTLGLSSTNPFEYLVATVL
FT                   ATQCRDERVNKITPALFARYPDPAAFAAADYEALLPLVRPTGLGPTKARNLTAIGRLLL
FT                   ERHAGKVPATMAELTALPGVARKIANLVLADCHGIVEGVAVDTHVRRISKLLGLTDSTD
FT                   AAKIERDLMDCLPRDAWRSWNNLMVEHGRQCCVAGAPRCTACPLVEDCPGGRELTAELE
FT                   RRDAAGAVLP"
FT   CDS_pept        707667..709037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0657"
FT                   /product="serine/threonine kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="ORF_ID:glr0657"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88598"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88598"
FT                   /db_xref="GOA:Q7NMV8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMV8"
FT                   /protein_id="BAC88598.1"
FT                   /translation="MSGSFARPDTLVGRTVGRYRLVEKIGAGGMGSVYRAVHIEIEDLV
FT                   VAVKLLLPGLIDDEALRRRFKDEAAICARLSERSSHIVQIRDYGILEDLDLPYFTMEYL
FT                   QGRSLQHLMHKVAAPVHQGLAIARQICLGLRVAHDMNVVHRDLKPSNIHLIPDLQLGEK
FT                   VKLLDFGIARLVRDAQRGPLTQGYLGTPQYSAPEQLRGLEVDARADIYSLGMILYELFS
FT                   GVCPFAVEDQNFETWYVLHTEGEPSPMAAANPRRPVPMAIEQLVLHCLAKKPADRPAGV
FT                   SEILERLELVMGHLPPAPPAAAIPPPPTITLSAEQVAHLEKQLATQVGPIAPTLVRRAL
FT                   GSSHTPGELVEQLAAQLPATQREKFSRTVLANLSAQTSAAPSPGVREGSVPPVLRLDPR
FT                   FVERCGHELSRLVGPIAAFLLQSALKETPPTPAVLVERLAALVGDQAKAEQLRRKLL"
FT   CDS_pept        complement(709047..709949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0658"
FT                   /note="ORF_ID:gll0658"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88599"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88599"
FT                   /db_xref="GOA:Q7NMV7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMV7"
FT                   /protein_id="BAC88599.1"
FT                   /translation="MLKNLKLRTKFSLVAIVVFAGGLVASATVLSLVLEQRAQDEVADK
FT                   AAALLQTINAVRNYTDVRIKPLLKDKAATSPVFISETASGFAANEVFEGLRKNSDYRNF
FT                   VYKEAAPNPTNLRDKADDFEAALVARFAADPTIKELTGFRSQPGGDVFYIARPLKVDSP
FT                   SCLQCHSTPQVAPKNLIITYGPDNGFGWKVGQVIAAQVISVPVDEVYASAQRSWVLVVG
FT                   VLVGIFAVLVFLVNELLKRTVVLRISRMAATADAVSTGKTEADFAEDAADEIGVLASAF
FT                   NRMKSSLEIALKLLNQQPR"
FT   CDS_pept        710071..711003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0659"
FT                   /note="ORF_ID:glr0659"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88600"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88600"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMV6"
FT                   /protein_id="BAC88600.1"
FT                   /translation="MAMLYNNSKAKSRAATQSSPSRRWWLLWLLPLWLVAGCSEAPVER
FT                   MGKLTLGTVSYDEGQQTLDRYARFKDYLAQQTQSVVEVEPAYNEQRALERIRSRSWSLV
FT                   FASPGLTALAIQQAQYEPLFPLQGVNNRRSILVVRKDSPVRAIADLADRPVALGQVGSI
FT                   TGYYFPLYNLYGLTLSELMFAPTPRMVLEWVASGKAAAGALSKEEFDQQAAQIAGAAFR
FT                   ILAADSHVVPTGALLVSPAIERNRQEQLRKILRETPGILAQEAGFIPNAPLPDYGYLFS
FT                   VVERVRSIFPDTPNAAQLKPARLFKQQSR"
FT   CDS_pept        711108..711644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0660"
FT                   /note="ORF_ID:glr0660"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88601"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88601"
FT                   /db_xref="GOA:Q7NMV5"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMV5"
FT                   /protein_id="BAC88601.1"
FT                   /translation="MADEHAVVGTFASHDDAEAAVLALEKAGFDMHKISIIGKDYRTTQ
FT                   QVRGFVTWRDTAKEGAISAGYWGGFFGGLFGILVGAGVLFIPGVGQVVIAGPIAGVLAG
FT                   WLEGLLLGAAGGAAAGGLVGALVGLGIPEGKAIKYDSDIQAGKFLVLVTGGEEDRARAE
FT                   QALAAAGLATAEAIA"
FT   tRNA            complement(711675..711747)
FT                   /product="trnP-UGG"
FT   CDS_pept        711860..713014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0661"
FT                   /note="ORF_ID:glr0661"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88602"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88602"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMV4"
FT                   /protein_id="BAC88602.1"
FT                   /translation="MHKKLCVCALTLLAPLSFAGAWHLSLPAAAQTGPTDVLVSGPSAV
FT                   VDPEFDQQFARFTWNDDKGNVWIGTVDPATGDFLPPAGNNTLVDTGAVPVAVSGNGPEW
FT                   VYTAAGPQIVYTKYGTNGRIAVARAQENGSGWAGGIIENGENRTFPIGSQDRRDPAPRL
FT                   SYVGRNSAGKQVTLWRELDDAASEVEVPNALPPGGRWVPGRRELVFIGKAGRGRQAFRY
FT                   DVDSRQLEQLTDDAGQKFNILMWQAPEFDDEYVFFTLTDETSIGVYRKIEGTWTKINTL
FT                   KPPAAGQYLWSPEVFVHNGKSYIFMVTSTSRDQNSRTVPTDIWMAGIEPDAPFYRQVSD
FT                   TTLKVRKDPEVFITAQGPYIYYLALPDPQTSTIYRADTGLGAAR"
FT   CDS_pept        complement(713022..713273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0662"
FT                   /note="ORF_ID:gsl0662"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88603"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88603"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMV3"
FT                   /protein_id="BAC88603.1"
FT                   /translation="MPTIHYKGWTIRVYPVADGTLAELTDPQGRTYHEPRILVSTPEQA
FT                   SFYAKKCINWLSTAAARKGRPSAAKETARPQEAVGKTG"
FT   CDS_pept        complement(713404..714021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0663"
FT                   /note="ORF_ID:gll0663"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88604"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88604"
FT                   /db_xref="GOA:Q7NMV2"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NMV2"
FT                   /protein_id="BAC88604.1"
FT                   /translation="MNWPLALGIWAASYLAGSLPAGYLAGRRLKNIDIREFGSGSTGAT
FT                   NVLRTLGRGPAAAVLLFDVFKGLFAVWLARTLAGGEDAGAWIVLGAGLAAIVGHSWPVW
FT                   LAFRGGKSVAVSVGLLLGMHWPVALTVAAVWGVCFAVTRIVSFASIVAAAATPLCFYLW
FT                   RAPLPFTLFGLLGGIYIVWRHRGNIERLLQGTEPKIGDPAAH"
FT   CDS_pept        complement(714018..714632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0664"
FT                   /note="ORF_ID:gll0664"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88605"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88605"
FT                   /db_xref="GOA:Q7NMV1"
FT                   /db_xref="InterPro:IPR021467"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMV1"
FT                   /protein_id="BAC88605.1"
FT                   /translation="MHLSKSVGSTIPSRPPSHQVKAACIASVGWPVVLPPDWKASREVP
FT                   QPHEGASPRRGTMGTALRSAPPVDRLRSNDPFAPPETSKIVVAPRPWLSLAVSALGVLA
FT                   TGWVLGVGVALIVFGLFLGFQTVTVRIVFGAEAFEVWQYRRRVVSFPYNEWLSWRVFWP
FT                   GVPILFYFREVYSPHFIPMLFSHRQLVAGLQKFLPPAVQRR"
FT   CDS_pept        714596..715756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0665"
FT                   /product="serine/threonine kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="ORF_ID:glr0665"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88606"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88606"
FT                   /db_xref="GOA:Q7NMV0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMV0"
FT                   /protein_id="BAC88606.1"
FT                   /translation="MESLTQPISIGALIDGRYRLTRYIDGGGMGKVYEAVDTRLGDKAV
FT                   AVKLLQQNLNVDDRLFEQLRRRFEQEAQLCALLGGQHGIIAVSDYGLDGPQPYLVMEYL
FT                   GAAPRGRSLKELVSAEGPLSPERTVRLAVQICESLQYAHGVRTHLGGRQITGVVHRDIK
FT                   PSNIFVIDRALVGETTKVLDFGIAKAVSDVTIAMGTNMGFVGTCDYASPEQLRGEELDA
FT                   RSDIYSLGIVLYQMLTGQLPLQPKTHSFAGWYQAHNHESPVPLPRLAVGQAIPPRVAAV
FT                   VMACLEKEPARRPASMQELSQRLQDELLKAAPAPVAPEREAPPPASDEALGAALAAAWP
FT                   VLRERMERWRSQALDRLEKLPGRIRLGVGLLAAALALKTGRRKCDD"
FT   CDS_pept        715779..716309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0666"
FT                   /product="molybdopterin biosynthesis protein"
FT                   /note="ORF_ID:glr0666"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88607"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88607"
FT                   /db_xref="GOA:Q7NMU9"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMU9"
FT                   /protein_id="BAC88607.1"
FT                   /translation="MSAIKIGILTASDRASAGVYEDLSGPAIVETLNSFLLSAWQPVYR
FT                   LIGDERALIEAELICLIDEAGCCLVVTTGGTGPALRDVTPEATEAVCEKMLPGFGELMR
FT                   AVSLKYVPTAILSRQTAGIRGGALIVNLPGKPKSIRECLEAVFPAVPYCIDLIGGPYLE
FT                   TNPEIIRAFRPRS"
FT   CDS_pept        716391..716723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0667"
FT                   /note="ORF_ID:glr0667"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88608"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88608"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMU8"
FT                   /protein_id="BAC88608.1"
FT                   /translation="MKITQPEALACLKIMVRVAMADGYLKEDERLAIGLASRSMGLRDE
FT                   LSIETLMVKEDSFEELLVKVQSPEARTALLKAAASMSAVDGERSAEEQTMLDQIEAAFR
FT                   VPNPGA"
FT   CDS_pept        716780..717508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0668"
FT                   /note="ORF_ID:glr0668"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88609"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88609"
FT                   /db_xref="GOA:Q7NMU7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR026461"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMU7"
FT                   /protein_id="BAC88609.1"
FT                   /translation="MSRVSIVIPALNEATNLGRTLRLLKALDPPAHEILVVDGGSADGT
FT                   AAVARAFGLRVLESPRGRAVQMNLGGEAATGDILCFLHADTLVPDDCVEVMMRTLADPG
FT                   TACAGFVSLMAGPETTRWGISLHNYLKTYYAPLLFRPRLFFKGLRLLFGDQVIFCRRSQ
FT                   FLECGGFDPKMVILEEADLCLKMVRFGRIRQINRVVHSSDRRVVRWGSFKATAVYMYIG
FT                   FLWGLGASPAYLKRFYADIR"
FT   CDS_pept        complement(717595..718497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0669"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /note="ECF subfamily"
FT                   /note="ORF_ID:gll0669"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88610"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88610"
FT                   /db_xref="GOA:Q7NMU6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMU6"
FT                   /protein_id="BAC88610.1"
FT                   /translation="MAAQRTAMDDLETFQQHRGMLFAIAYRMLGTVADAEDMVQETFLR
FT                   WQQASAAGVQSQKSYLAAVVTRLSIDHLRSARVRREQYVGPWLPEPLAQTAADPLQQSE
FT                   LADSLSMAFLVLLESLSPLERAVFLLSEVFEYDHAEIARIVDKSPANCRQILRRARRHL
FT                   AERQPRFRSSRPHSEKLVARFLQACSGGDLEGLLAVLAPEVTLVGDGGGKVAATIRPLQ
FT                   GAARVARFFVALRRRVGHFTLMPTVINGQSGIAFLVAGNLQSAMTFDITEAGIQTIYSV
FT                   RNPEKLQRFAQSLGMPLPP"
FT   CDS_pept        complement(718499..719104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0670"
FT                   /note="ORF_ID:gll0670"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88611"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88611"
FT                   /db_xref="GOA:Q7NMU5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMU5"
FT                   /protein_id="BAC88611.1"
FT                   /translation="MIDHIGIAQSDSRPPVTSGPAVSSCLYKRYNRSFQMDNRLAFENI
FT                   EPAAYRALLGLGSYVESSGLDPKVLDLIKIRASQLNGCAFCLDMHTTEARKAGEAEQRL
FT                   HALAAWREAPFFSPTERAALAFGEALTQMAQERIADAVYTELAQHFSQEDAGKLLMAVI
FT                   AINAWNRLAVATGLVAGTQEQHFRQLRQRGILAGEAVK"
FT   CDS_pept        complement(719101..719715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0671"
FT                   /product="TetR family transcriptional regulatory protein"
FT                   /note="ORF_ID:gll0671"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88612"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88612"
FT                   /db_xref="GOA:Q7NMU4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMU4"
FT                   /protein_id="BAC88612.1"
FT                   /translation="MLSGVSAENEQTKNPPGRPRSSRADQAILGAAAELLAEVGYQAMS
FT                   IEAVALRAGVSKPTIYRRYASKEELVADAIETLRQEVAIPDTGSLQTDIDSLLAEAIQM
FT                   VQTPLARQTMAMIISSATSSPQFARIYATKYLMPRREAFGAILERAKARNEIRAATDND
FT                   LFFDFVSGIMFHALIFEPTAEPYEAYIRRAVRFLLGGAAVR"
FT   CDS_pept        719809..720339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0672"
FT                   /note="ORF_ID:glr0672"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88613"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88613"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMU3"
FT                   /protein_id="BAC88613.1"
FT                   /translation="MDGKARPLYLDKGSTQTLREGLKEYYAAYPNLTDPRELNEAFARI
FT                   ILAHDVSHVVYGCDTGMYDELKLLPLTWWTSDYHFSDHLRTLRDPTIGPAVAIMYGDLI
FT                   KQHGTLWLYSSIFVEFPKLVPELTALWLRNRRRQRFVPFLQFEPLLARTLLDIRQEFEL
FT                   LPFIGRTARCRIR"
FT   CDS_pept        720451..720996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0673"
FT                   /note="ORF_ID:glr0673"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88614"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88614"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMU2"
FT                   /protein_id="BAC88614.1"
FT                   /translation="MSRVSFRVISTPAAVLLVFAISGPVSCPMLAQTKGGPVGKAAVAE
FT                   LMRSRQCVSCNLAGANLSNMDLSGVDLSFASLRAVNLRGSDLTGALLNGADLRGAKIEG
FT                   ANLTGVGCFNCQLGGASLRGATMAGMTLSNADLTGADLSNTDFARAGGLARSTIGAILP
FT                   DGTICRPPATSPGVCPYR"
FT   CDS_pept        complement(721182..721973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0674"
FT                   /note="ABC transporter permease protein NodJ homolog"
FT                   /note="ORF_ID:gll0674"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88615"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88615"
FT                   /db_xref="GOA:Q7NMU1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMU1"
FT                   /protein_id="BAC88615.1"
FT                   /translation="MKALATAAAVSPWGVYSVWRRHADVYRITWLSNLLPPMSEPILYL
FT                   FAFGAGLGPMIGSFEYLGSTLTYAQFLGPGMIAVAVLFQSFFEGAYASFIRLSFQKTWQ
FT                   ALLTAPLSYTDVFLGDWLWATTKGVIGGSATGLVVVLLGLYPPVGLLYSLPVMVLGGML
FT                   FGACGLVTAGTVRIIDQVNLPTFLFIIPMFALSGTYFPRTNLPGVSRYFAEILPLAPVV
FT                   DFLRWPYGLPSYWPWQLVGLVVLIAVAGSWAWWAIRQRIYL"
FT   CDS_pept        complement(721970..722890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0675"
FT                   /note="ABC transporter ATP-binding protein NodI homolog"
FT                   /note="ORF_ID:gll0675"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88616"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88616"
FT                   /db_xref="GOA:Q7NMU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015851"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMU0"
FT                   /protein_id="BAC88616.1"
FT                   /translation="MQSSTRVDLVAQQLQKQYGDRAVVRGVSFALHPGEILGLLGPNGA
FT                   GKSTTLGMLYGLVVPTAGQATLGPFDVRRQGREARRLMGVVMQENNLDPDFDVLGNLLT
FT                   FARYYRLGAGEARERAMALLAQMGLTERAKDSTEALSGGMKRRLVLARALINDPKVVFL
FT                   DEPTTGLDPDARQDFWRLVAGLRAAGRGVLLTTHYMDEAERLCDRLLLMKEGQVVGEGE
FT                   PRTVIAREVGHEVAEVEGVDPRLLTDLAARSGSWTRPFGGSTLVPLPADGEALWQAIVE
FT                   LKPARLTRRRANLEDVFLQLTGGRL"
FT   CDS_pept        722994..723335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0676"
FT                   /note="ORF_ID:glr0676"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88617"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88617"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMT9"
FT                   /protein_id="BAC88617.1"
FT                   /translation="MTFSEPPKPEQKEVANPAQEIQSQGEDLGYQLTPESLNTQPTPED
FT                   LLQAAAAYAQAAMGSGCDIRGFRQVSDSPETWEATVSNAGKTGVLVAKRVPGGYDLKVK
FT                   SDTVQGIYD"
FT   CDS_pept        complement(723396..723590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0677"
FT                   /note="ORF_ID:gsl0677"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88618"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88618"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMT8"
FT                   /protein_id="BAC88618.1"
FT                   /translation="MRWFALVAQYVSEAILQIFFPDRDEFPKYGFEVFKGEIAGDFEGW
FT                   PERPSCRIDRHRPVANEAT"
FT   CDS_pept        723697..724335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0678"
FT                   /product="thymidylate kinase"
FT                   /note="ORF_ID:glr0678"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88619"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88619"
FT                   /db_xref="GOA:Q7NMT7"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NMT7"
FT                   /protein_id="BAC88619.1"
FT                   /translation="MFITFEGGEGCGKTTQLTLLGDWLEKRCHRVVRTREPGGTALGRS
FT                   LRGLLLDARSEITPTAELLLYATDRAEHLARVVRPALASGAAVLCDRFSDSTVAYQGYG
FT                   RGLDLGLIERLNAIATGGLLPDLTFWLKLDPQAGLVRRLASNGNTPDRIEAETLAFHQR
FT                   VHMGFAALANRYPGRIRPVDAGLSVEATAEQIRSAVDVFLNENQSKLEK"
FT   CDS_pept        724361..724906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0679"
FT                   /note="ORF_ID:glr0679"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88620"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88620"
FT                   /db_xref="GOA:Q7NMT6"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMT6"
FT                   /protein_id="BAC88620.1"
FT                   /translation="MVKVVGLCGSLRPGSHAEKALLLALAAAAGAGAEVEYLDFKQLNL
FT                   PFCHGGDEYPDHPDVEVLKRKVKEADALLIATPEYHGSFSGVIKNALDLMSFEELSDKV
FT                   FGLVSVLGGGQNNNALNDLRTVARWVHAWVVPEQVAIGQAWKQFDAEGNLTDPKLKDRL
FT                   DKLAYALVKAARMLRTTA"
FT   CDS_pept        complement(724903..726639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0680"
FT                   /note="ORF_ID:gll0680"
FT                   /note="probable gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88621"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88621"
FT                   /db_xref="GOA:Q7NMT5"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMT5"
FT                   /protein_id="BAC88621.1"
FT                   /translation="MKLHSALLLASLLVLSCAATAAALPGGDRGGTYFSTRSPVIAKNG
FT                   MAATSHPLATQIAVDVLKKGGSAVDAAIAANAALGLMEPTGNGIGGDLFAIVWDPRARK
FT                   LAGLNASGRSPLGLDYERLKSAVGGSPTIPIFGPLPVTVPGAVDGWFMLHGRYGRLPIA
FT                   ELLAPAVRYAREGVPVPQMIAGYWQSNLRRFERDKDQIPELANFRKTYLIAGNPPAEGE
FT                   IFRNPDLALTLEKIGKGGRDVFYKGEIADTIDAYMQRVGGYLRRTDFERHTGTWVEPVR
FT                   VNYRGYDVYELPPNGQGIAALQMLNILEGFDLKKMGHNSADYLHAQVEAKKLAFADRAR
FT                   YYADPDFSKMPVAGLLDKTYASDRRRLIAMDRAQSRQAAGLPPAADTIYLTTADKDGMM
FT                   VSLIQSNYVGMGSGLVPDGLGFMLQDRGAQFSLTPGHPNVYAPGKRPFHTIIPAFVSKD
FT                   GEPFMSFGVMGGDMQPQGHVQILCNIIDFGMDVQQAGDAARYYHTGDNDPDGRVMVDGG
FT                   TLNLESGVGEDSRTELARRGHRLAATSPGAYGGYQVIQWDQVNRVYRGASEMRKDGQVS
FT                   GF"
FT   CDS_pept        complement(727412..729556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0681"
FT                   /product="prolyl endopeptidase"
FT                   /note="ORF_ID:gll0681"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88622"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88622"
FT                   /db_xref="GOA:Q7NMT4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMT4"
FT                   /protein_id="BAC88622.1"
FT                   /translation="MNALFGLCAVALAISLDASCALAQNLAASAPRLTYPPTERVEQFD
FT                   DYHGTRVADPYRWLEDPNSPKTRAWVEAQNKVTFAYLEGIPYREPLKERLTKIWNYEKY
FT                   GIPNREGDRFFFTRNSGLQNQSVLYNAAKLGDAPRVLLDPNTLSKDGTVALTGIDITDD
FT                   GRYLAYGTAASGSDWQQWHVREVATGRDLPDVIKWVKFSEASWLKDGKGFFYSRYDEPN
FT                   AATQFQDVNYFQKLYFHRLSTPQAQDVLVYERKDQKEWGFGGEVSEDGRYLVINVSQGT
FT                   DPKNRVFYKDLQNNSGRVMELLPDADAAYTFIGNDGPRFWFVTDKEAPRGRLVLIDTTR
FT                   PLQLQEVVPQTDATLQSADIVGERLFLRYLKDARSQVKVFDLKGKFLSEVAFPGLGTVT
FT                   GFGGKRTDTETFYAFTSFTTPTTIYRYDIPTAKSTVLFQPKVDFDPTAYTTEQVFFNSK
FT                   DGTRIPMFITYKKGTPRNALNPTYLYGYGGFNVSITPTFSPANLLWLEMGGLYAVPNLR
FT                   GGGEYGEDWHQAGTRLNKQNVFDDFLAAAEYLIANKYTSPEKLAIGGGSNGGLLVGAAM
FT                   TQRPELFAAALPAVGVMDMLRFEQFTIGWAWVSDYGSSQDPEQFQALYAYSPLHNLKAG
FT                   TRYPATLVTTADTDDRVVPGHSYKFTAALQAAQAGEGPVLIRIETKAGHGAGKPTTKLI
FT                   EEAADRWAFLVANLRMQLKF"
FT   CDS_pept        complement(729628..730578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodB"
FT                   /product="superoxide dismutase"
FT                   /note="ORF_ID:gll0682"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88623"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88623"
FT                   /db_xref="GOA:Q7NMT3"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMT3"
FT                   /protein_id="BAC88623.1"
FT                   /translation="MVLGVLLTGKARYSPLLKAACNFPAGRAPCGSPEAKTGSLCQEFV
FT                   SMKCSVSTLVGTLCLTAAALLSTAAEAQINIPTPTITPPTVTVPSVQPPSVTMPSATQA
FT                   STTASGYPYKLAPLPYDYSALEPYIDAETMKLHHDKHHQAYVDNLNKALEKYPDLQKKS
FT                   PEQLLRDLKQVPEDTRAAVRGNGGGHVNHTMFWEIMKPKGGGEPAGPIAAAIRTNFGSF
FT                   DAFKTQFNEAGTKRFGSGWVWLVSNPGGKLEIVSTANQDSPIADGKYPIMGNDVWEHAY
FT                   YLKYQNRRADYLSAWWNTLNWDEINRRFQKASTGL"
FT   CDS_pept        complement(730637..731512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0683"
FT                   /note="ORF_ID:gll0683"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88624"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88624"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMT2"
FT                   /protein_id="BAC88624.1"
FT                   /translation="MASMSEDTLIYVGCQGWRYPDWRLASAEAVGDLSAPFYPPRLPAA
FT                   RELKHYARTFDLVEVDSTFYAVPQIRVVKNWATQVPETFRFTLKLPRTLTHEYRLARGR
FT                   ATLSAFCECARPLGVQLAAILIQLPPSFATDEFAALERFLPHLPADLPFAVEFRDPAWL
FT                   SERTVELLAAHRIALTLGDTPWIPTPLALAWLDRLPTDWLYLRLMGSKSNGLEHFTHRQ
FT                   FDRTDTLDAWAAAVWRLAEGGKRVYVLLDNHFEGFSPGSATLLVRKLGLAERPFPHDCP
FT                   AESEQLGLEW"
FT   CDS_pept        731519..732466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0684"
FT                   /note="ORF_ID:glr0684"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88625"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88625"
FT                   /db_xref="GOA:Q7NMT1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMT1"
FT                   /protein_id="BAC88625.1"
FT                   /translation="MERALALPQILAVGLIGSPVVHSCRIMATVLRFSERPLVRIALFL
FT                   AGLLALWLPGVLVWLFVTGWRPGMPFETLSTSQTLGAAVILYAAILAVLRLLAHRLDGR
FT                   SLAQYGLARDWANLLLAGIGLVIGVVGLSLLVAAEAALGWVSWHPEKIAGLAIPLAEGL
FT                   AVGLAVGFIEELLFRGFLLQTFAQRYGAWAGAVASAALFAAAHFIKAPEIILATWPQFP
FT                   ALFAAGLLLAFARLRSAGRLGLAVGLHAGWVWTYYVVSTQGMALYDRPEVPQWLTGLGG
FT                   HPLAGAAGVLLLAAVALLLARLPLPTPEKLPKHR"
FT   CDS_pept        complement(732649..733023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0685"
FT                   /note="ORF_ID:gll0685"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88626"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88626"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMT0"
FT                   /protein_id="BAC88626.1"
FT                   /translation="MLMNAGTLSVMDISDMDNLSAERFSVNRSNLEQAEDGRLQGISLE
FT                   ASEASRGGASGRRGCTPAALGSDDDFRKSIGFCGRRLRAGVEARLACRLLQTERGSSQD
FT                   SEGEDDLQPPPKGEPNAAGR"
FT   CDS_pept        733016..733384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0686"
FT                   /note="ORF_ID:glr0686"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88627"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88627"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMS9"
FT                   /protein_id="BAC88627.1"
FT                   /translation="MSIPAPDPRSFLPLTPAAFHILLALAEGERHGYGISKEVKDRTDG
FT                   AVRLGPGTLYRSIKQLLGDGWIEESDERADPDLDDQRRRYYRLSPLGRRIAAAEAARLA
FT                   DLVDLARARRLLPGADPA"
FT   CDS_pept        733821..736346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0687"
FT                   /product="glycogen phosphorylase"
FT                   /note="ORF_ID:glr0687"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88628"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88628"
FT                   /db_xref="GOA:Q7NMS8"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMS8"
FT                   /protein_id="BAC88628.1"
FT                   /translation="MQPPPPQTPPDMPLEEPSAAPGVEALRQAIVDNLRYVLGKDPSQA
FT                   GAQDFLAALAHTVRDPLLHRWRNTRQAYFDCGARVVCYLASQYRPGPQLVANLVSAGLY
FT                   ARSVEALAGLGVRLEDLLALEREPQLGRREGSRQAASLAEALATQQMPAIGYGLRYEFG
FT                   SEQVIRDGWPFERPVPWRFADDPWEIPRPEYRVEVPLGGRTEAHLDGENRYRVRWLPEG
FT                   AVIGEPYDRLVPGYRTHTVNTLRLWSARASEQFDAPVANPEEYARAVEAKLDCELITRV
FT                   PYPAGDGPHHQRLRLQQQYLLACCSVHDIVRLFTQTGRPLGELPERAAIHIDDSHPPIA
FT                   IAEWMRILVDRHDLGWEEAWEMTGRMFSATAHTWAVETLECWPVALVERWLPRHLEILR
FT                   EIDRRFRLQLQALLVDEAQIARLSLFADDQVRLAHLACIACHTVVGTSESATGQLAQTV
FT                   LADFHRLWPQKFQTIGAGVSTRRWLVLANPPLARLIGERIGPHWLTHPEGLDALRRHAA
FT                   DPDFQRSWRQIKQAHKRSLAAQLLATSGVALSSEALFDIRLEPFEGCRRQLLSALYIVT
FT                   LFNRLQSEPGANIVPRAFIFSGWPRPGDPLGRLTVKLIHAVGAVVNADPIVAGRIRVVF
FT                   VPEPTVALTQKIFAAADLAEQDALPGFQAGDTGSLCAALNGALLLGSPDGINLEIERTV
FT                   GRERFFEFGLSTGEGQALKLTEYQPMAFYHSNPLLRQVVDQIATGYFSHGDSEQFKPIV
FT                   AAMVEDDEALNLVDYQSYVDGQGSVDAAYRDLALWTRLSIESVSRLGAVCCDRTAREYC
FT                   SRIWRLQPVKVHLDAYSQQVIALKGREHL"
FT   CDS_pept        736371..736613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0688"
FT                   /note="ORF_ID:gsr0688"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88629"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88629"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMS7"
FT                   /protein_id="BAC88629.1"
FT                   /translation="MTTPTLHTVRKIAHAADSRPVCSIGCLHCGSPIAWHRDGTVWHGH
FT                   CAQCTRILRGRLGDSGCIEATYLPQDDFYLSVRGC"
FT   CDS_pept        736711..737079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="ORF_ID:glr0689"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88630"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88630"
FT                   /db_xref="GOA:Q7NMS6"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMS6"
FT                   /protein_id="BAC88630.1"
FT                   /translation="MNKIEAIIQPSRLDAVEQALAAIGVQGMTVSRVEGFGRQRGHSVI
FT                   FRGFGSAAQFLAKLKLEIVVPDEFTETVVERIVQAARTGSVGDGKIFVLPVTQAVRVRT
FT                   GECDLEAVRFESPAVLIH"
FT   CDS_pept        737087..737641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0690"
FT                   /note="ORF_ID:glr0690"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88631"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88631"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMS5"
FT                   /protein_id="BAC88631.1"
FT                   /translation="MFTKILVALDQSSSNELVFEKAFALARLGGGSLMLMHVLSGDEDN
FT                   SPGLVVPAITDFHPLSFDDETLAFYRREWERYEQLGRAMLQMFAERAAAVGVIAEFSQS
FT                   AGSPGPQICQLARAWSADLIVTGRRGRRGISEMLLGSISNYVLHHAPCSVLVVTGAEDE
FT                   DKPLPIEAGLQKPATRRGRAP"
FT   CDS_pept        complement(737589..737888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0691"
FT                   /note="ORF_ID:gsl0691"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88632"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88632"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMS4"
FT                   /protein_id="BAC88632.1"
FT                   /translation="MTPMNTAQKIAAILKSRLHASVVEIEDQSDRHAGHAGAAGGGGHY
FT                   NVLIVSERFGGLPAIRRHRLVYEALAAEMGSAIHALSLRALAPDEWQASADRPQ"
FT   CDS_pept        738218..738580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0692"
FT                   /note="ORF_ID:glr0692"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88633"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88633"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMS3"
FT                   /protein_id="BAC88633.1"
FT                   /translation="MASVYASNLPPELRNLPVPNQHRSTRNDTLRATGLPVKNLRWEQQ
FT                   RLYVIDRCNKVHVAQMFPHLYQECLQEAAMMLNRLELERKRLIHPDRWGPGLSNENADY
FT                   PILSRLLRLGYTLQRA"
FT   CDS_pept        complement(738926..740482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0693"
FT                   /note="ORF_ID:gll0693"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88634"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88634"
FT                   /db_xref="GOA:Q7NMS2"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMS2"
FT                   /protein_id="BAC88634.1"
FT                   /translation="MENFDFVVLGAGLGGLSAAACLTRQGHRVAVLEQHYLPGGCCHTF
FT                   DYGDYRFCADVHYVSQCAPEQTIGQFLRHIDRQIEFNSLDPECIDRVVTPEADFAIPLG
FT                   WERLRERLIATFPEETVAIRRYCDAISGLHEEMRALLREVNWFDQKWSDWLKLPKYWNL
FT                   FARRHWTLQDLYDEVGLSPKLQAILAGQSGDYALPPAEIALYTHTSLVRDYAEGAYYPR
FT                   HHFKHFVDTIASAIVEGGGAVHYRTPVEQIHIKDHRVDGIVAAGKLYRAAAYISDLDPK
FT                   LTVGLMDDPTALSERERQRLTGYEYSASAFNVYLGLDKTFDPSRYGIGNWNIWYYPDGD
FT                   LNGAYRRQLTDDLERPWIFLSCPTLKSNEPGMAPAGNHVLEIATVCAYAPFKQLRETKP
FT                   EAYKARKREVYRQVMESTRDLIPDIDKYVRMKIFGTPTTSEFYLGQPEGNIYGAKLIPS
FT                   QVGLHRLGYRTELPNLFLVGASAGYPSVPGVIGNGMDVAQLLTGQPIRSRPGSARPLVR
FT                   S"
FT   CDS_pept        complement(740651..743221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0694"
FT                   /product="glycogen phosphorylase"
FT                   /note="ORF_ID:gll0694"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88635"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88635"
FT                   /db_xref="GOA:Q7NMS1"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMS1"
FT                   /protein_id="BAC88635.1"
FT                   /translation="MTLSEYQATWKKRPEKHAALPTDLKKHVLRTPQVRVQVEDDRTGM
FT                   DTETLKRAFLDNLYYIQAKDLQNATPYDLYMALSWTVRDRLLQRWIHTQETYLKQDVRS
FT                   VCYFSAEYLPGRQLGNALVNVGLYEPARTFLRELGFELVDLMEQENEPGLGNGGLGRLA
FT                   ACFMDSLATLGVPAIGYGIRYEFGIFAQTIQGGWQFEQPDRWLRYGNPWEIPRPEYLVE
FT                   VKFGGHTEAYTDPQGRYRVSWVHERSVLGTPYDTPVPGYRTNTVNTLRLWSARATEDFD
FT                   FQVFNSGDFARAVAGKTYSENITKVLYPNDNTYQGKELRLEQQYFFVSCSLQDILRRYW
FT                   DHHVDLDSFTDKVTIQINDTHPAIGIAELMRLLVDEYLIEWDRAWQITQKVFAYTNHTL
FT                   LSEALERWPVSLFGRLLPRHLEIIYEINERFLHLARSRFGNDEARIARLSLIQEGSEKY
FT                   VRMANLACVGSHAINGVAKLHTELLEQDVLADFYALTPEKFSNKTNGVTPRRFVLLSNP
FT                   KLALLYTERLGQEWIRDLALLRKLEDHLHDADFRASWKQIKADNKHDLAEYILHFNGIE
FT                   VAPDSLFDIQVKRVHEYKRQLLMLLYVITLYHRLKQNPAMALQPRTFIFAGKAAPGYTM
FT                   AKLIIKCIHSVAAIINADPDVGGRLKVVFLANFNVSLAQRIYPAADLSEQISTAGKEAS
FT                   GTGNMKFAMGGALTIGTLDGANIEIREQVGPENFFLFGLTAQQVYALKARGYHPNDYYQ
FT                   TNTELRSVIDLVASGHFSPGRPDLFRPLVDALMARDEYLLFADYQVYLDCQQQVDAAFA
FT                   DSERWTTMSILNAVRMGYFSSDRSMGEYCRDIWKTGPVAVELNG"
FT   CDS_pept        743363..744052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0695"
FT                   /note="ORF_ID:glr0695"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88636"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88636"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMS0"
FT                   /protein_id="BAC88636.1"
FT                   /translation="MVCSNPAVLVLEKSMTAIVAPVAGEQRILLHKVSWQLFEALLEEL
FT                   GDNRSIRLTYARGTLEIMSPLMAHENSKRLLEKFIDILVEELELNVKSSGSMTCKRDDL
FT                   EQGAEPDSGFYIANESRVRSKSRIELPLDPPPDLVVEVEYSRSAVDKLKLYAAMEVPEF
FT                   WRYDGESLRIFRLEAGEYALVENSPTFAPVLTSEIPRFLALSPQSGETAAVRSFRDWVR
FT                   QMKMRRI"
FT   CDS_pept        complement(744156..744368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0696"
FT                   /note="ORF_ID:gsl0696"
FT                   /note="similar to methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88637"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88637"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMR9"
FT                   /protein_id="BAC88637.1"
FT                   /translation="MNGLGSRLSGAPWLRPDAHRGIVLLSGREIEKMRRAGQLAAQLLA
FT                   HLEPMVHPGIHTLAINNEAERWTLK"
FT   CDS_pept        744448..744723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsr0697"
FT                   /note="ORF_ID:gsr0697"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88638"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88638"
FT                   /db_xref="GOA:Q7NMR8"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR012869"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMR8"
FT                   /protein_id="BAC88638.1"
FT                   /translation="MCAKASKSRSDGGMGGKTDLDRVVAYVPTELKKELEQWAEAEERS
FT                   VSWLVAKLIDRALQQRRERGTLPGEDGFVLAFTKTGPGKTAIEQTG"
FT   CDS_pept        744754..745632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0698"
FT                   /note="ORF_ID:glr0698"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88639"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88639"
FT                   /db_xref="GOA:Q7NMR7"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMR7"
FT                   /protein_id="BAC88639.1"
FT                   /translation="MIQRVATATGHTDACGGPARKRCRQFHLKAAIVAFQAVLGLLAPS
FT                   PSQAQPEPPILAVPVSTSPETLPTQSEVELPPVDLLPAPEPLSQPEPQLETPPLLLPPE
FT                   PQPPPTPKRAQPDKTAPSIAYPPYEEAARRDLRLVASHSTIRGRKEYLSNEAAWAFTRM
FT                   RAAAAKAGVRLILISGFRDRTRQARIFAKQIARKGSLAAALKLVAPPGFSEHHTGYAMD
FT                   LGDALYPKTHLETTFENTPAFRWLSRNAARFGFELSYPPGNAVGVGYEPWHWRWVGSKK
FT                   GKILFSAAKGE"
FT   CDS_pept        complement(745636..746124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0699"
FT                   /note="ORF_ID:gll0699"
FT                   /note="probable tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88640"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88640"
FT                   /db_xref="GOA:Q7NMR6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMR6"
FT                   /protein_id="BAC88640.1"
FT                   /translation="MPPAAMGREAFHVVLVDPEIPPNTGNVARTCAATGTSLHLVGTLG
FT                   FQLSDKYLKRAGLDYWEHVDLHYHPDLGALLEQQSAQRFVLTSARRGVCLWDFAFQPGD
FT                   WLVFGSESRGLPEGLLSDERHPVVTIPLAEPAVRSLNLSNAVAVVLFESLRQLDPPSS"
FT   CDS_pept        complement(746099..747079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0700"
FT                   /note="ORF_ID:gll0700"
FT                   /note="probable glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88641"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88641"
FT                   /db_xref="GOA:Q7NMR5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMR5"
FT                   /protein_id="BAC88641.1"
FT                   /translation="MPQSISVVVPVFNEQENLPQLYRRLTAVLSGLGGSYEIIFVDDAS
FT                   SDRTPHLVRQFIQADPRVRLLSFSRNFGHQVAVTAGLNFTGGEAVVIMDGDLQDPPELL
FT                   PRLLDQWRAGFKVVFARRTQRGREPASKRLFAFLYYRLLQRLAEVQMPVDSGDFCLLDR
FT                   QIVDLLNAMPERNRYLRGLRSWVGFDQAEVTFERPARLAGEPKYTFTKSLALALDGLVS
FT                   FSRLPLRLATWLGFFTGFLALIMVGLVIYWRFFTASPLNGFGALAAAVFFIGAVQLITV
FT                   GILGEYVGRIYEEIKNRPLYILKDAQGFERPVPGRVGNAPSSNGP"
FT   CDS_pept        747151..748320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0701"
FT                   /product="UDP-N-acetyl glucosamine-2-epimerase"
FT                   /note="ORF_ID:glr0701"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88642"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88642"
FT                   /db_xref="GOA:Q7NMR4"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMR4"
FT                   /protein_id="BAC88642.1"
FT                   /translation="MQYLDRTREGARLEGYTVAMSKVAIVLGTRPEAVKLAPVILGFRN
FT                   CPHLHTRVILTGQHREMLYQTLAWFGIEADADLQIMTPRQSLADITCRALVGLEAVLTD
FT                   ERPDLVLVQGDTTTTFAAALAAFYQKIALGHVEAGLRTGVADDPYPEEMNRRLTSRLAA
FT                   LHFAPTMRAAENLKREGILDHVYLTGNTVIDALHTIASRKPECPVAGLDWEKSRVMLVT
FT                   AHRRENWGQPLENIAHALIDILEAHPDTALVLPLHKNPTVREPLQGILGAHPRAFLDEP
FT                   FDYPQLVGALQRSTLVLTDSGGLQEEAPAFGKPVLVLRETTERPEAIEAGVALKVGTDR
FT                   TAIARAAHALLTDDALYGQMARAVNPFGDGHATGRILRSTLAFLGLPSD"
FT   CDS_pept        748538..749236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0702"
FT                   /note="ORF_ID:glr0702"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88643"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88643"
FT                   /db_xref="GOA:Q7NMR3"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMR3"
FT                   /protein_id="BAC88643.1"
FT                   /translation="MGVAERIEWLRGQLPAAVRLVAVTKQVPVERIREAYDCGLRDFGE
FT                   SRIQEVQQKIPQLTDLQGVSWHLIGSLQRNKARPALEVFDWIHSVDSLPLAERLASLMD
FT                   SVGRRPRLLLQVKLAADPTKSGWSQAELEAALPRLAALPQLDIRGLTAIAPLGLGEQGN
FT                   RTLFGQVAALARDLGRRAGEAGWQHIRMEELSMGMSGDYPQAIAAGATMVRLGQVLFGS
FT                   RLPLRRNGDE"
FT   CDS_pept        749223..749807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf50"
FT                   /note="ORF_ID:glr0703"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88644"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88644"
FT                   /db_xref="GOA:Q7NMR2"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NMR2"
FT                   /protein_id="BAC88644.1"
FT                   /translation="MVMSSFWSKVKDFVGFGDPLEYEEDGEEYEQVYREENKREEARRA
FT                   TAGTAAAATPTAAAQASDAAPMGSGPARKRVRAGNVIGMPNSGVNEVLVIEPRSFEEAP
FT                   QIVQHLRDRKSVILNLTLMDSDQAQRSVDFVAGATFAIDGHQERVGDGIFLFTPSSVMI
FT                   STEMPSQLRQANQAFGGNFRLNPEAPRRAQG"
FT   CDS_pept        749838..750629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0704"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /note="ORF_ID:glr0704"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88645"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88645"
FT                   /db_xref="GOA:Q7NMR1"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMR1"
FT                   /protein_id="BAC88645.1"
FT                   /translation="MNLGIVGGGAMAEALIAGLIAGAVYAPSEIAVSDPVAERGEWLHR
FT                   RYGVVAVTDNLVPAAAPTLLLAVKPQAFAVVSNQVAAHVRSELVVSILAGVPLARLQAA
FT                   FTGRAVVRAMPNTPALVRSGITALSRSERVTPEQFAVARTLFACVGEVVEVPESAMDAV
FT                   TGLSGSGPGYLALVVEALIDGGVAAGLPRATASQLVLATLRGSAELLIQEKLHPAVLKD
FT                   RVTSPGGTTIAGIEQLEGRSVRGAFIEAVQAATRRARELSG"
FT   CDS_pept        complement(750633..751163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0705"
FT                   /note="ORF_ID:gll0705"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88646"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88646"
FT                   /db_xref="GOA:Q7NMR0"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMR0"
FT                   /protein_id="BAC88646.1"
FT                   /translation="MGAMRNRLGWIFSMVRRQGWPLPACCWALAAAPAFCQTAQVPFES
FT                   TAGLIVVQARINQGPPAAFIVDTGASVSLLSDRFVRERRLPVRAQRVQLSGIGSARSQS
FT                   AATMDLDTIQIGPVVARRQAAIVQNLGTFEAILKRPLAGVLGYTFLKHYRLTIDYDRRS
FT                   LWLEQGPVPTEPN"
FT   CDS_pept        751221..751988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /product="phosphorybosilformimino-5-amino-phosphorybosil-4-imidazolecarboxamideisomerase"
FT                   /note="ORF_ID:glr0706"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88647"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88647"
FT                   /db_xref="GOA:Q7NMQ9"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NMQ9"
FT                   /protein_id="BAC88647.1"
FT                   /translation="MDIIPAIDILDGRCVRLYQGNYQLAETYGEDPVAVACNWAKLGAP
FT                   RLHVVDLDGARQGMPVHLDALEAIVTQVPCPVQFGGGLRSIEAVSAVLDRGVDRVILGT
FT                   AAVENPALIRECCERFGGRIAVGLDARGGQVAVRGWRETSEVEVTELAGEMEKLGVSAI
FT                   VYTDILKDGTLTGPNLVELQRLTDAVKVPIIASGGVGTLADVLYLLALEPRGLQGVIIG
FT                   RALYTGDVDLAEALRAAGPSRWQDLPPDDVAFA"
FT   CDS_pept        751988..752836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0707"
FT                   /note="ORF_ID:glr0707"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88648"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMQ8"
FT                   /protein_id="BAC88648.1"
FT                   /translation="MVGDTLEQLLPHWMLSMVRLLFCSMLALSLAGPLAPPLLAQEPKA
FT                   ASNPELKAYQVKVRDRVLEYWQPPDIDSDTRLQVLVRVDRDGKVSKREVKTLGDAPPSK
FT                   AAEEAVLDAIGRAQPFPTVPPNVAPFYVEVRFNLKVAAKTLPTPRCYPVATFIDLPAEQ
FT                   QPAVKSAITNLTGLLRDSVGEKEIFSIVDDRAKADLLIEASSDPTMARNDKTSFIGSYT
FT                   VNEALTTGTARLGLKIERAQISVLSNSASMRCSCWAAVWAYPAREALPIRSCRRRGWRR
FT                   G"
FT   CDS_pept        752953..753708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /product="glucose inhibited division protein B"
FT                   /note="ORF_ID:glr0708"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88649"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88649"
FT                   /db_xref="GOA:Q7NMQ7"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NMQ7"
FT                   /protein_id="BAC88649.1"
FT                   /translation="MDSGALWQDLGWQPDTLQARSFERLYALVLAGNTRLNLTRITGRE
FT                   EFWEKHLFDSLRGLAAFQDQKEPSLIDIGTGAGFPGLPIAIAHPDWYVVLVDSVRKKIA
FT                   FVLSTIQALGLTNAQALTGRAEDLAHRREHRESYDLAVLRAVAQANVCAEYALPFVKLG
FT                   GAAVLYRGNWEVQEEVELARACRALGGEIVEVDAFELPVSRAVRHCVVIRKTGPGLRVF
FT                   PRPAGLPTQHPLGAIEGAPRVESEEPEEP"
FT   CDS_pept        complement(753705..754280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0709"
FT                   /product="LexA repressor protein"
FT                   /note="ORF_ID:gll0709"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88650"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88650"
FT                   /db_xref="GOA:Q7NMQ6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMQ6"
FT                   /protein_id="BAC88650.1"
FT                   /translation="MITLRQKEFLQQLIETYGSTPLPPIRTLAQELDQHRTTVYRWLQL
FT                   LEQMGYLKAQGNRYYIDPDLLGIPLLENRVPAGSPVTVEEDLLNSRMSLDEYLVEERTG
FT                   TFLLRVKGDSMIEAGIFEGDIVVVNQNRRAADGDVVIARVDGEMTLKTLRRRNQQTWLE
FT                   PANSRYSPIHPASGLEVLGVVVGLVRKY"
FT   CDS_pept        754448..754897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0710"
FT                   /product="nucleoside diphosphate kinase"
FT                   /note="ORF_ID:glr0710"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88651"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88651"
FT                   /db_xref="GOA:Q7NMQ5"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NMQ5"
FT                   /protein_id="BAC88651.1"
FT                   /translation="MERTFIAIKPDGVQRGLVGEILQRFERRGFKLVGLKLMQVSEALA
FT                   QKHYAEHKERPFFGGLVAFITSSPVVAVVLEGKGVVATARAMMGVTNPLNSPLGTIRGD
FT                   YGIDIGRNIIHGSDSLESAEREIALWFAPAELLEWQATLGSWVYE"
FT   CDS_pept        complement(754903..755121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0711"
FT                   /note="ORF_ID:gsl0711"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88652"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88652"
FT                   /db_xref="GOA:Q7NMQ4"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NMQ4"
FT                   /protein_id="BAC88652.1"
FT                   /translation="MPFGLGLPEILVIGVIALLIFGPKKLPEMGSALGKAIRGFKSGVS
FT                   DEPAPQQSASKETAPNPPQSLPSGKDS"
FT   CDS_pept        755244..756011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0712"
FT                   /note="ORF_ID:glr0712"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88653"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88653"
FT                   /db_xref="InterPro:IPR041247"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMQ3"
FT                   /protein_id="BAC88653.1"
FT                   /translation="MEREIASLALVEPLIDKVQIKAQALSSDQSRAMAVAYLEARDVAQ
FT                   RLDDVCGPQSWSDTYQLLQAGPSEWVVECRLSVHPPGEGARPVTKCDVGLGEDAKAAYS
FT                   DAFKRAAVKFGLGRFLYTLPKVWGDYDSAKRRFSEPAAVRAQMLAAFSGRPEGGASPST
FT                   VAKESPHLSEKQLHWLSEDLLRRPGVEALFVEHFEKIESLSKAKRALGYLLSETKGDLR
FT                   PRFERVGTTEEWRKYIDAAKQLPIALPVAATGV"
FT   CDS_pept        756048..756458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0713"
FT                   /note="ORF_ID:glr0713"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88654"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88654"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMQ2"
FT                   /protein_id="BAC88654.1"
FT                   /translation="MFKKLSPNLFVEDVGRALDFYETVLGFKRLMTLPEQAPFAWGLVQ
FT                   AGGVELMFQSFGSLEEDPLPIEGRQAGGTLNLYIEVEDIDALYEKLRTQVSVVREPNTT
FT                   FYGMREFLMLDPNGYLLTFAQPVEPAGAPAGG"
FT   CDS_pept        complement(756409..757800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0714"
FT                   /note="ORF_ID:gll0714"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88655"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88655"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMQ1"
FT                   /protein_id="BAC88655.1"
FT                   /translation="MRNLWWMGLGLAASLVIQAPALRAQVNFAPARNIPVGLYPGTALT
FT                   GDLDGDGDLDVVAATQDSDDVSILINNGDATFAPARFVPVGDSPETIAVGDLDGDGDLD
FT                   IAAANRLSDDLTILKNNGSAIFTASQVVSLREDPFFMVTGDFDDDGDLDLAIANRFDDS
FT                   VTILPNNGSANFTVGSEFGVGDGPFGLTRGDFDGDGDLDLATSNRFSNDVSVLFNNGAA
FT                   SFTLNQTIATGEGARALTPADLDGDGDLDLAVANRFATNLSVLKNAGNGTFAVSQTVTV
FT                   DVNPRAVVAGDLDGDGDLDVATANQESGTVSVLLNNGNAVLSPAVNFAVGSEPRSITAG
FT                   DLDGDGDLELLTANSDSDNVSVLINTEVALPTIAGFSPTSGPVGTLVTITGTNFTGASA
FT                   VTFGGAGARSFAVLSATQIQVRVPRGATTGKIVVTTPAGNATSAGNFTVTPRPGRQPVR
FT                   PAGRR"
FT   CDS_pept        758077..758592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf3"
FT                   /note="ORF_ID:glr0715"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88656"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88656"
FT                   /db_xref="GOA:Q7NMQ0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022818"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NMQ0"
FT                   /protein_id="BAC88656.1"
FT                   /translation="MPRNQRNDNFIDKSFTVMADMILQMMPVKRQAKEAFAYYRDGMAA
FT                   QADGDYAEALEYYNEALKLEEDAYDRSFIHYNIGLIHAANGAHDVALDYYDKALEENPR
FT                   LPQALNNIAVIHHFRGAKVEEEGQPEQAEEHYAKAAAAWIRAVRLAPDNYIEAQNWLKT
FT                   TGRFELLY"
FT   CDS_pept        758606..759895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /product="seryl-tRNA synthetase"
FT                   /note="ORF_ID:glr0716"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88657"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88657"
FT                   /db_xref="GOA:Q7NMP9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NMP9"
FT                   /protein_id="BAC88657.1"
FT                   /translation="MLDPKLLRDDPAKLIERLNTRGGDFTEVIEQLVALDSQRRASQTA
FT                   FNRAQAEGNQIGKQVGERLRRGTAVGDPEVLALKQRGIDLKATLALLQDQERELAERFA
FT                   ALLPTLPNVPRPEVPIGKDENDNREMRFWGTPPIFDFEPAAHWDLGERLGLMNFARATL
FT                   VAQARFVTLMGDGALLERALIAFMLDRHRAHGYIEILPPYLVNTASMTGTGQLPKFAED
FT                   SFRCRDDDLWLIPTAEVPVTNLYRDEILTDMQLPIHHCAFTPCFRREAGSYGRDTRGLI
FT                   RLHQFHKVELVKFCRPEHSPTEHEKLVADAEDVLQQLELPYRVIELCTGDLGFGAARCF
FT                   DLEVWLPSQNRYREISSCSNFEDFQARRANLRFKAPDKKGTEFVHTLNGSGLAVGRTFA
FT                   AILENYQNRDGTVRVPEALKPYVRRDVLSR"
FT   CDS_pept        760001..760591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0717"
FT                   /note="ORF_ID:glr0717"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88658"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88658"
FT                   /db_xref="GOA:Q7NMP8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMP8"
FT                   /protein_id="BAC88658.1"
FT                   /translation="MPVLVFDLMDTVIVDPFYREVPVYLGTSLDELIQVKHPTSWLEFE
FT                   TGLTDEMSFLARFYREDTGLKLFSPEEFKQIFFSAYRFVDGIETLLATLKANDQKLWVL
FT                   SNYSNWVLQARELLQLDRFFEGYCVSCDTGHRKPSPGAYRALMASTGAAQHLLIDDRPA
FT                   NVEGALQAGMDAILFTDTDALRRQLHSRGILGG"
FT   CDS_pept        760721..763291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0718"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /note="ORF_ID:glr0718"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88659"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88659"
FT                   /db_xref="GOA:Q7NMP7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMP7"
FT                   /protein_id="BAC88659.1"
FT                   /translation="MAVGFSLRVLVVAANGPLVHALEKTLLSGGYDLALRWAAGTASLH
FT                   QALMSERPEMILAADGPGEIDALLLLRSLTVHNCCELPLVWIGDAPSTPEGGYLNGADL
FT                   HLLVLTVERALHQAQQRRETGVARAALRRSEQRLDLFFSQSLDGFFFMMLDRPVRWDAT
FT                   VDKERTLDYVFAHQRLTRVNDALLAQYRASGEQLLGRTPADLFAHDLELGRRLWREFFD
FT                   RGKLHVETDERRFDGSPMWVEGDYSCLYDEQGRITGHFGIQRDVTVRKLAQEALRTSEA
FT                   ALQEQLQRTLLLQRICEQIRSSLESRQIFQATVDQVGQALGVNCVRILVYSPTPKPELH
FT                   FAAEYLEAGYPPVHHGSVPVAGDPHAQRVLECDRAVCSPDVYADPQLAPVHELCRSVGL
FT                   KSLLAVRTSYQGKPNGVITVQQRDRFRRWTPEEIALLEAVAAQVGIALNQAKLLEQEKA
FT                   QSLLLAEQNAALARARQAAEAASRTKNEFLATMSHEIRTPMNGVIGLADVLLADGGLTH
FT                   RQRDSIETIRASGETLLTIINDILDFSKAESGCIELETKRFDLHALLAGCVDLLRPEAT
FT                   QKHLQLCCTLHGQVPQAVVGDAARLRQILVNLIGNAVKFTTSGAVSVNVTAARPAAEPP
FT                   QKWELHFAVRDTGIGIPAERMDRLFKPFSQVDASTTRRYGGTGLGLAICKRLAELMDGR
FT                   IWVESEPGRGSTFSFTIVAAAATDAPAPAPPVEASWSKPLPLRILLAEDNPLNQKVALQ
FT                   LLRRLGYRANVATDGEEVLRALRRQRYDLVLMDVQMPMIDGLEATRRIASEFAAAERPR
FT                   IIALTAGATLQDEQACLRAGMDGFISKPIRIGELRRALERWGTG"
FT   CDS_pept        763395..764348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0719"
FT                   /product="thioredoxin reductase"
FT                   /note="ORF_ID:glr0719"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88660"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88660"
FT                   /db_xref="GOA:Q7NMP6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PDB:5J60"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMP6"
FT                   /protein_id="BAC88660.1"
FT                   /translation="MEQFDFDVVIVGGGPAGCTCALYTARSELKTVILDKNPAAGALAI
FT                   THKIANYPGVPGEMSGDHLLEVMRDQAVEFGTVYRRAQVYGLDLSEPVKKVYTPEGIFT
FT                   GRALVLATGAMGRIASIPGEAEYLGRGVSYCATCDGAFYRNREVVVVGLNPEAVEEAQV
FT                   LTKFASTVHWITPKDPHTLDGHADELLAHPSVKLWEKTRLIRIKGEEAGVTAVEVRHPG
FT                   ESDSQELLAEGVFVYLQGSKPITDFVAGQVEMKPDGGVWVDEMMQTSVPGVWGIGDIRN
FT                   TPFKQAVVAAGDGCIAAMAIDRFLNSRKAIKPDWAH"
FT   CDS_pept        complement(764354..765367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /product="phosphoribosyl formylglycinamidine cyclo-ligase"
FT                   /note="ORF_ID:gll0720"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88661"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88661"
FT                   /db_xref="GOA:Q7NMP5"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NMP5"
FT                   /protein_id="BAC88661.1"
FT                   /translation="MDYKSAGVDVEAGYEFVARIRGAVERTRRPEQLGGLGGFGGLFAL
FT                   PAGYREPVLVAGTDGVGTKLKLAFALDRHDTIGIDCVAMCVNDVLAQGAEPLFFLDYLA
FT                   TGKLSPAQLAGVVEGIAAGCLEAGCTLLGGETAEMPGFYAAGEYDVAGFCVGIVERSQI
FT                   IDGNRVQVGDALLGLSSSGVHSNGFSLVRRIVELAGLDWHHRPEDFPASLGEVLLTPTR
FT                   IYVKPVRAALEAGFDIRGIAHITGGGLIENVPRALGGLGACLERNSWPVPPVFTWLERT
FT                   GGVGRQDMDQTFNLGLGLVLACPTEQADALQAYLAKQGEQVLRIGAVVEAAGVRFA"
FT   CDS_pept        complement(765418..765843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0721"
FT                   /note="ORF_ID:gll0721"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88662"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88662"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMP4"
FT                   /protein_id="BAC88662.1"
FT                   /translation="MWLVVDSSTVVKWFFPEVLTEQALAIRRAWESSDVELIAPTLLLT
FT                   EVGNVIWKKQRNAFVTYEEGAQIVCDLLVLELPLVEAQNLLPRAYQLAAIFQRTVYDAL
FT                   YLALAEQLEAEFVTADLRLYNAVYPILKFVRYLGNYS"
FT   CDS_pept        complement(765843..766088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsl0722"
FT                   /note="ORF_ID:gsl0722"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88663"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88663"
FT                   /db_xref="GOA:Q7NMP3"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR012869"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMP3"
FT                   /protein_id="BAC88663.1"
FT                   /translation="MVNISLRDIPDDVYEQIKQMAGRERRSINQQILVLLEQATRRHRR
FT                   PAAGVLEQIDRQREAIFARVGLLPDSTEDIAEDRER"
FT   CDS_pept        766293..767573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0723"
FT                   /note="ORF_ID:glr0723"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88664"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88664"
FT                   /db_xref="GOA:Q7NMP2"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMP2"
FT                   /protein_id="BAC88664.1"
FT                   /translation="MDQPFSSKVSLKPLPRSRRSMPPSHPPKRQDVLSVFSTFLDISPE
FT                   TAALWVPDHRLRRSAQILLAEDLTKRAGADGLARALLSQWQRQPCPGLTRLHLIAYLQE
FT                   SCYWAAWKVCESRPATRSQLTDLFQAGIVKVDVILTKFNVELGFGLDSYAFNSFKNTIR
FT                   HELNRRELSSANCSSDWSLLRHTGRESLGTALRHANHPDAEIDRYVLAWLSYQRLYVPA
FT                   DASRTRRLSGPDAATWDLIAQDFNRQRPLHLPPSSPAAEAADIARWMRLCAEALRAYRP
FT                   RFVSIDAPRTDLEGTAEPLAIPTESAFDAVQRQEEREYAEAINRVLCLALDGLDPPKRR
FT                   LLDLYHGEELGQKQIAQQIGKDQGTVSRQLTRCRGELVVALAKWSQEKLNISLTCEVLK
FT                   RLEAVVDEWLCEHYGQTRCWQQESASE"
FT   CDS_pept        767570..768730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0724"
FT                   /note="ORF_ID:glr0724"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88665"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88665"
FT                   /db_xref="InterPro:IPR014951"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMP1"
FT                   /protein_id="BAC88665.1"
FT                   /translation="MTQENSPLLFDDPTALCLEISEADQERAWRECANVTHPVSHWRAF
FT                   RNRLALAVLLPWIREDIDPHAAVWPAPMALSAFWDLVGGTALTANGKRWVICLDEADGT
FT                   APVHIPQEWLDIPAWAADYYLLVHFDLAGQWLRVSGWTTHRQIKTLGRFDPRDRTYYLD
FT                   ETFIQTGLGGLWAITTGELLLTEPTRASQSELPGLTVPQARALIERLGNPEISEPRLEV
FT                   PFEQWAALVSYDGWCQELYARRQGLPPQWSVLEWIKNGVSELAREAGWSVSNPIGAEAR
FT                   SAGSNLVFFTRVLSIADKTCELCIEQITPGVWRFCLRTTLWNSRLPAGTTLRLLTENLQ
FT                   SFENNEVHAHTAVEELAIDLTLEEGEGIVWEIETAPKHFQREILQF"
FT   CDS_pept        complement(769814..774829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0725"
FT                   /product="WD-40 repeat protein"
FT                   /note="ORF_ID:gll0725"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88666"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88666"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037783"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMP0"
FT                   /protein_id="BAC88666.1"
FT                   /translation="MSPLALRVSPNGEASRFWMLLVGVDGYLDPGLADLRYCVADCEAL
FT                   AGALQAVCCETISPMLFVHHDGTDAGASLERVRASLRQIVDAAGAEDTVLFYFSGHGLL
FT                   HRGQAVLCLANTRLADLEGTGLRFAELMAGFERCRAERQLVWLDACHSGGIDLGVTEAQ
FT                   SADPTGPLVEALRQRAARSRCFYALLSCDRQQVSWAFPELGHGVFTHFLLKGLEGAAAD
FT                   AQGRIEADALYRYVYHRTLRYVDRLNQQQRLISQQRRGGAPLPEYRLQTPQKIVNVVGE
FT                   LLIGSIPGPAPGGPVGRALVVDGSVGSEAVLAFGRLLLGASGYRDQTQYWSPAHQGLSL
FT                   REALSRALAYDASVPPLQTVLIYLHGRIEASADGESWLVLREGVRLSRSALRLELRRAA
FT                   ASRQIVVLDCPGACDLDDWVGELRLEGDQSQCLIAAAAPLSDPDRFTRVLVHTLESSGD
FT                   ARSGLAVTEWIKLIDRELAPGGIRLHLWLAGSQGVIEVLPGTAGQSPTAATVDLGVSPY
FT                   KGLRPFQEADSAFFCGRDALVGKLVAAVRSQPFVAVIGASGSGKSSLVQAGLVAQLRQG
FT                   KQVLGSEGWWIKTLLPGSYPFAALARLLFEGRTAEEDEMALGVEDFVRRLRERPEPIVL
FT                   LVVDQFEELFTLAAAEERDRFVELLEGALRYAPDRFKLVITLRADSITPCLEYPILAAA
FT                   LQRSSVLVPPRLSREDYRAVILEPASKVGLQVEAELVEILLDELNHSAGELPLLEFVLE
FT                   QLWKQRSGPLLTRRAYEGDIGGLRGALERKADEVYESLKELDARECARWLMLNLVQLGE
FT                   GTEDSRRHLPRNRLISRRYSSKLVERVLNAFLKAKLLVVDAAEEEESGSSTATVEVAHE
FT                   VLIRSWGRLREWLADNRSRLRTQRQIEQAADHWQSKNRETDYLLRGSDLTEAEQLFLRD
FT                   EDMLSPKETAFIEISLQLRAQQLQLERKRTHQLRRLAGVLALLAVVAMGFGITAYWQSL
FT                   KSQEREIDALINSAQLRFANHQHLEALVELMRAQSLVQQTWTSSLQLREKTRIALQQSV
FT                   YSNRQINRLEGHSDFISQVSFSSSRKLMASASWDRTIRLWQLDGMPIKILKGHANNITS
FT                   ICFSPDGEFMASADDRGSIYLWTSKGELRTVIRGHNATIWSLRFSPDSKLLASASQDKT
FT                   VRLWNRNGKILRTLMGHQDEVMSVDFSPDGQTLASASWDGTVRMWGIQGNLISILKEHK
FT                   DGIWSVAFSPDGQRLASAGQDKTLRLWNVHGQLLHTLSDNTTPFLSVRFSPDGSILASG
FT                   SVDKTVRLWSREGVLLSSLHGHTGRVNSLDFSADGRILASASDDKTLLLWRLYGPPLTA
FT                   FRGHGQWVSCVGFSPDSQAFATAGGDGTLDLWDRQGRLENRVIPPATIFALAYSPDGTI
FT                   IASGGNDRAVRLWTRHGSYLSQFDKQGAAVTSLSFSPNGNLIAAGGPDGLVWLWGHKGK
FT                   LFKKISTGHAELAVVRFGPRGLFLATAGGVDRTIRIWSQTGTLLRTLRGHPDLITDLTF
FT                   SPDNQVLVSASRDGTLRYWTIAGQLLKTINAHSNRVTSIDFSADGKTVASAGADGTVRL
FT                   WGPVGESVAVLYGHKDSVGAVRFSPDSKILLSGAADGSVFLWQAWRTEANWLLNESCKQ
FT                   LQSYLRSNITAQSFIQDLCSVSIHRINSDAQTP"
FT   CDS_pept        complement(774919..775638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0726"
FT                   /note="ORF_ID:gll0726"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88667"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88667"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMN9"
FT                   /protein_id="BAC88667.1"
FT                   /translation="MPEFTTTDLSRPTDFPAEIALPPADLWSDEPPMESDRHRKQMDLL
FT                   IRSLESGWQSRQDFYATGNLTIYFSPHQSKSEDFRGPDFFVVLGTERRDRRSWIVWHED
FT                   GKYPNVIVELLSASTAAVDRGLKKQIYQDTFRTPDYFWFDPEGTEFRGFHLVDGRYEEL
FT                   SPDERGRLWSRQLELYLGVYEGWLRFFTPDGQLVLLAEEQEKQRADQEGQRADAAQQRA
FT                   EQLASYLRSQGVDPDQL"
FT   CDS_pept        775813..777819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0727"
FT                   /product="DNA ligase"
FT                   /note="ORF_ID:glr0727"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88668"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88668"
FT                   /db_xref="GOA:Q7NMN8"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7NMN8"
FT                   /protein_id="BAC88668.1"
FT                   /translation="MSTTVPPEIEEHTRTLRALLHRWGYAYYVLDAPEVSDAIYDQHYR
FT                   ELVDLESRYPELVSPDSPTRRVGERPASAFVSVTHRVPMFSLENAFSQAELEKWGERLL
FT                   RAIGPGLEFICELKIDGSATALSYEDGVLVRGATRGDGVEGEEITQNLRTIRAIPLKLL
FT                   GGEVPAVLEVRGEAFIPRDEFERINQERQAAGEKLFANPRNACAGTLRQLDSRVVASRR
FT                   LGFFAYTAHYGRAESQWEALAELESHGFRVNPHRSLCRDLAEVRTFCEHWENHRHELPY
FT                   DTDGVVVKVNAFDHQREVGFTSKFPRWAIAFKYPAEEKSTVVEAIAVQVGRTGALTPVA
FT                   ELQPVAVAGTTVSRATLHNQDRIESLDVRVGDTVIIRKAGEIIPEVVRVIGELRPPEAV
FT                   PYVFPQTCPECGTAVVRAPGEAAVRCPNPRCPALIRGKLGHWCAALEIDGIGDKLIARL
FT                   VSLGLVHTVADLYELSAEQLAGLERLGARSAAKIVEQLDRSHRQPWSRVLYGLGLRHIG
FT                   ASVSVELARAFASADALARADLAAIASLYGFGEELARSVVEWFAQAENRALLERLKAHG
FT                   LQLAGGGRAAQSSALAGLTFVITGTLPTLSREECTALIESHGGKVTSSVSSRTSYVVAG
FT                   EKAGSKLARAQDLKVAVLDEEQLRALIETREMP"
FT   CDS_pept        777907..778560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr0728"
FT                   /note="ORF_ID:glr0728"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88669"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88669"
FT                   /db_xref="GOA:Q7NMN7"
FT                   /db_xref="InterPro:IPR009793"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMN7"
FT                   /protein_id="BAC88669.1"
FT                   /translation="MKQLLYWAAEALAALSRNLRWMGWNLFLALVPLALSFWLFDPKRR
FT                   RSPLWWGVAAVWLAFLPNAPYVLTDVIHLIEQIRGRGYSAWVITLALIPQYLLFILGGF
FT                   EAYVLSLVLMGRYLRRQGLARFILPVELAIHALSAVGIYLGRFQRFNSWDIITQPDAIV
FT                   DDLFNDLIDKEPLLVMGISFAVVAGLYYLLKVVSLALIYYWRRGRTPDGAEWTA"
FT   CDS_pept        complement(778967..781672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0729"
FT                   /note="ORF_ID:gll0729"
FT                   /note="probable aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88670"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88670"
FT                   /db_xref="GOA:Q7NMN6"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMN6"
FT                   /protein_id="BAC88670.1"
FT                   /translation="MRVFREKVQVSMFRQLTGLTGLAIIAVLAVPAQAEPKFSFATTPG
FT                   QLPRDVIPTRYAVEITPDPKSLTTIGTEVIDIEVRKPTRTVVLNALNLKVDKARLDGQL
FT                   PGTVKIDPAKQTATITFARPIATGPHKLSLAFVGQVNAQAEGLYYVRYKTDKGEKLMFG
FT                   TQMEPTDARRMFPLWDEPVFRTPFALTVNLPENFKAVSNMPVASEKRLGGGLKSIAFAP
FT                   TPKMPSYLLVLCAGELESLDDQASGVKIGVVTTEGKSQNGRYAQEALKKLLPYYNDYFG
FT                   VGYALPKLDQIAVPGGFGGAMENWGGITYNEAILLYDPARSSQSTKEAIFNVVAHEVAH
FT                   QWFGNLVTMAWWDNLWLNEGFASWMDTKATDHFNPEWEVWLRANAAKNVAMQSDARSTT
FT                   HPIQQPVTDPAQAASAFDEITYQKGEAFIRMLEAYLGEAKFRDGIRRYMKAHTLSNTTT
FT                   ADLWAALEEASGQPVQAIAAGWTEQPGFPVVTVSSRCEGGKQRLALRQDRFTVNDPNAK
FT                   ALLWKVPITYGEVGSDKVESFLLADKTATTTAEGCGAPVKLNRGDTGYYRVKYEGDLFN
FT                   QLKQNFSRLQTADRVNLLSDTWALVQAKQAGARDYLSLAEAAKADTNLAVWQQILATLG
FT                   EIDRLQIGQPGREPFQTYARALLQPVYQRVGWDAQPGELETTGLLRSSVLASLGKFKDE
FT                   AVVAEARRRFEAFVRAPESLAPNLRPPVLSVVGRYADQATYDQLLSLARKTQSTEEKRN
FT                   YYAALAGALDPKLAQQTLALSLKSEEEPNLSTNLVLQVAGSGEHREMAWEFAKQNYKAL
FT                   LDKRAFFNRYKYLPGLVANFTEPERAQEFEAFAKANLPAEALPEVSKGAEFVRASAGIK
FT                   EQQMGEVDSWACSRTKIEGGKGTQFCLGVN"
FT   CDS_pept        complement(781743..784499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0730"
FT                   /note="ORF_ID:gll0730"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88671"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88671"
FT                   /db_xref="GOA:Q7NMN5"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR032534"
FT                   /db_xref="InterPro:IPR033413"
FT                   /db_xref="InterPro:IPR034032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMN5"
FT                   /protein_id="BAC88671.1"
FT                   /translation="MLVFSTKLRALRLSGSLPDISHPSDVKTQMQSHLCILAVLGHFLL
FT                   LAVPAAAQTPALSASGGGLLAAAVREDEKSFDEVVRGYRASQGLFTVYTNLEENRVLIE
FT                   IAPEQFERLFLCNVTLEAGDGLYFDSGAMLDNFPFIFKRVGKRIQLIHKNVYYRAETGT
FT                   PIGRAVERAVSSSIVGSAKIESRPHPERKSVLVDLSSFFVQDYAGVANALGRHKIDFAF
FT                   DRNESYLGPVSAFPLNVEIEAVLHFKNNRPRGTDGRIADGRSMQHRYRYSLSTLNESGG
FT                   SYRPRPADDRVGHFLTLHQDYTDPTAETPYVRYINRWHLEKADPSAALSPPKQPIVFWL
FT                   ERTVPLEYREAVREGVLLWNRAFEGIGIQGALEVRQQPDDAEWDPADVRYNTVRWIVNP
FT                   GGAYAVGPARANPFTGQIYDADIRISADLVRYLVREREDYVAPLAGPAALTPLLTRLPV
FT                   SQLCQFQAGLASEAAFGWSVLAARLGGLDPSAREAKAYIHDAIRALVAHEVGHTLGLRH
FT                   NFRASAAHTHTHLHDRSRTQKTGVSASVMDYNPVNLAPRGKPQGEFWNSGLGEYDYWAI
FT                   AYAYKPFEATEESVGLARIAERNLPYGTDEDAFGFDARGIDPVTSPFDLGSDPIRFYRE
FT                   RIEMAGELLATAERGYLRKGERYQKMRRLFSQALRAHATAAASVPKFVGGLYHRRHHRG
FT                   DAGDQLPFEPVSAARQHEALAFLGRYIFGARAFAFSPSLLNQLPPERFEDFSNTPFYIA
FT                   RIDYPVHDQVLDIQKRALGRLYHPIALQRLADLPLHYPKGQPRFTLADMFSNVRSVIWE
FT                   EVARHQSISSFRRNLQRAHLAQLLALVGPNPQAALWSALGIAAASGASAPPEDAASLAR
FT                   ADLTALRTQIRRALAAGKLDALTRAHLDASLARITALIEPGSGRSGD"
FT   CDS_pept        complement(784486..784842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gll0731"
FT                   /note="ORF_ID:gll0731"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC88672"
FT                   /db_xref="EnsemblGenomes-Tr:BAC88672"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q7NMN4"
FT                   /protein_id="BAC88672.1"
FT