(data stored in SCRATCH zone)

SWISSPROT: YQXC_BACSU

ID   YQXC_BACSU              Reviewed;         281 AA.
AC   P19672;
DT   01-FEB-1991, integrated into UniProtKB/Swiss-Prot.
DT   07-JUL-2009, sequence version 3.
DT   11-DEC-2019, entry version 120.
DE   RecName: Full=Putative rRNA methyltransferase YqxC;
DE            EC=2.1.1.-;
GN   Name=yqxC; Synonyms=yqiF; OrderedLocusNames=BSU24260;
OS   Bacillus subtilis (strain 168).
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
OX   NCBI_TaxID=224308;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA].
RC   STRAIN=168 / JH642;
RX   PubMed=8969508; DOI=10.1099/13500872-142-11-3103;
RA   Mizuno M., Masuda S., Takemaru K., Hosono S., Sato T., Takeuchi M.,
RA   Kobayashi Y.;
RT   "Systematic sequencing of the 283 kb 210 degrees-232 degrees region of the
RT   Bacillus subtilis genome containing the skin element and many sporulation
RT   genes.";
RL   Microbiology 142:3103-3111(1996).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RC   STRAIN=168;
RX   PubMed=9384377; DOI=10.1038/36786;
RA   Kunst F., Ogasawara N., Moszer I., Albertini A.M., Alloni G., Azevedo V.,
RA   Bertero M.G., Bessieres P., Bolotin A., Borchert S., Borriss R.,
RA   Boursier L., Brans A., Braun M., Brignell S.C., Bron S., Brouillet S.,
RA   Bruschi C.V., Caldwell B., Capuano V., Carter N.M., Choi S.-K.,
RA   Codani J.-J., Connerton I.F., Cummings N.J., Daniel R.A., Denizot F.,
RA   Devine K.M., Duesterhoeft A., Ehrlich S.D., Emmerson P.T., Entian K.-D.,
RA   Errington J., Fabret C., Ferrari E., Foulger D., Fritz C., Fujita M.,
RA   Fujita Y., Fuma S., Galizzi A., Galleron N., Ghim S.-Y., Glaser P.,
RA   Goffeau A., Golightly E.J., Grandi G., Guiseppi G., Guy B.J., Haga K.,
RA   Haiech J., Harwood C.R., Henaut A., Hilbert H., Holsappel S., Hosono S.,
RA   Hullo M.-F., Itaya M., Jones L.-M., Joris B., Karamata D., Kasahara Y.,
RA   Klaerr-Blanchard M., Klein C., Kobayashi Y., Koetter P., Koningstein G.,
RA   Krogh S., Kumano M., Kurita K., Lapidus A., Lardinois S., Lauber J.,
RA   Lazarevic V., Lee S.-M., Levine A., Liu H., Masuda S., Mauel C.,
RA   Medigue C., Medina N., Mellado R.P., Mizuno M., Moestl D., Nakai S.,
RA   Noback M., Noone D., O'Reilly M., Ogawa K., Ogiwara A., Oudega B.,
RA   Park S.-H., Parro V., Pohl T.M., Portetelle D., Porwollik S.,
RA   Prescott A.M., Presecan E., Pujic P., Purnelle B., Rapoport G., Rey M.,
RA   Reynolds S., Rieger M., Rivolta C., Rocha E., Roche B., Rose M., Sadaie Y.,
RA   Sato T., Scanlan E., Schleich S., Schroeter R., Scoffone F., Sekiguchi J.,
RA   Sekowska A., Seror S.J., Serror P., Shin B.-S., Soldo B., Sorokin A.,
RA   Tacconi E., Takagi T., Takahashi H., Takemaru K., Takeuchi M.,
RA   Tamakoshi A., Tanaka T., Terpstra P., Tognoni A., Tosato V., Uchiyama S.,
RA   Vandenbol M., Vannier F., Vassarotti A., Viari A., Wambutt R., Wedler E.,
RA   Wedler H., Weitzenegger T., Winters P., Wipat A., Yamamoto H., Yamane K.,
RA   Yasumoto K., Yata K., Yoshida K., Yoshikawa H.-F., Zumstein E.,
RA   Yoshikawa H., Danchin A.;
RT   "The complete genome sequence of the Gram-positive bacterium Bacillus
RT   subtilis.";
RL   Nature 390:249-256(1997).
RN   [3]
RP   SEQUENCE REVISION TO C-TERMINUS.
RX   PubMed=19383706; DOI=10.1099/mic.0.027839-0;
RA   Barbe V., Cruveiller S., Kunst F., Lenoble P., Meurice G., Sekowska A.,
RA   Vallenet D., Wang T., Moszer I., Medigue C., Danchin A.;
RT   "From a consortium sequence to a unified sequence: the Bacillus subtilis
RT   168 reference genome a decade later.";
RL   Microbiology 155:1758-1775(2009).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 205-281.
RC   STRAIN=168 / EMG50;
RX   PubMed=2507400; DOI=10.1016/0378-1119(89)90247-3;
RA   North A.K., Smith M.C.M., Baumberg S.;
RT   "Nucleotide sequence of a Bacillus subtilis arginine regulatory gene and
RT   homology of its product to the Escherichia coli arginine repressor.";
RL   Gene 80:29-38(1989).
CC   -!- SIMILARITY: Belongs to the TlyA family. {ECO:0000305}.
DR   EMBL; D84432; BAA12577.1; -; Genomic_DNA.
DR   EMBL; AL009126; CAB14357.2; -; Genomic_DNA.
DR   EMBL; M27869; AAA22207.1; -; Genomic_DNA.
DR   PIR; G69967; G69967.
DR   RefSeq; NP_390306.2; NC_000964.3.
DR   RefSeq; WP_003230264.1; NZ_JNCM01000036.1.
DR   SMR; P19672; -.
DR   STRING; 224308.BSU24260; -.
DR   PaxDb; P19672; -.
DR   PRIDE; P19672; -.
DR   EnsemblBacteria; CAB14357; CAB14357; BSU24260.
DR   GeneID; 938651; -.
DR   KEGG; bsu:BSU24260; -.
DR   PATRIC; fig|224308.179.peg.2644; -.
DR   eggNOG; ENOG4105DX0; Bacteria.
DR   eggNOG; COG1189; LUCA.
DR   HOGENOM; HOG000009215; -.
DR   InParanoid; P19672; -.
DR   KO; K06442; -.
DR   OMA; VLMVKPQ; -.
DR   PhylomeDB; P19672; -.
DR   BioCyc; BSUB:BSU24260-MONOMER; -.
DR   Proteomes; UP000001570; Chromosome.
DR   GO; GO:0008168; F:methyltransferase activity; IEA:UniProtKB-KW.
DR   GO; GO:0003723; F:RNA binding; IEA:UniProtKB-KW.
DR   GO; GO:0032259; P:methylation; IEA:UniProtKB-KW.
DR   GO; GO:0006364; P:rRNA processing; IEA:UniProtKB-KW.
DR   CDD; cd00165; S4; 1.
DR   Gene3D; 3.10.290.10; -; 1.
DR   InterPro; IPR004538; Haemolysin_A/TlyA.
DR   InterPro; IPR002877; rRNA_MeTrfase_FtsJ_dom.
DR   InterPro; IPR002942; S4_RNA-bd.
DR   InterPro; IPR036986; S4_RNA-bd_sf.
DR   InterPro; IPR029063; SAM-dependent_MTases.
DR   PANTHER; PTHR32319:SF0; PTHR32319:SF0; 1.
DR   Pfam; PF01728; FtsJ; 1.
DR   Pfam; PF01479; S4; 1.
DR   PIRSF; PIRSF005578; TlyA; 1.
DR   SMART; SM00363; S4; 1.
DR   SUPFAM; SSF53335; SSF53335; 1.
DR   TIGRFAMs; TIGR00478; tly; 1.
DR   PROSITE; PS50889; S4; 1.
PE   3: Inferred from homology;
DR   PRODOM; P19672.
DR   SWISS-2DPAGE; P19672.
KW   Methyltransferase; Reference proteome; RNA-binding; rRNA processing;
KW   S-adenosyl-L-methionine; Transferase.
FT   CHAIN           1..281
FT                   /note="Putative rRNA methyltransferase YqxC"
FT                   /id="PRO_0000049845"
FT   DOMAIN          6..67
FT                   /note="S4 RNA-binding"
FT                   /evidence="ECO:0000255|PROSITE-ProRule:PRU00182"
FT   CONFLICT        205..210
FT                   /note="HADVLK -> CMLIAQ (in Ref. 4; AAA22207)"
FT                   /evidence="ECO:0000305"
FT   CONFLICT        243..281
FT                   /note="HLHWPGEGQEGQELPEEEIMRVVEEAHKTLKEKKADVPE -> QFALAGRGT
FT                   GRPGTAGRRDHARCRRST (in Ref. 1; BAA12577 and 4; AAA22207)"
FT                   /evidence="ECO:0000305"
SQ   SEQUENCE   281 AA;  31274 MW;  1D6257EF5BFABA45 CRC64;
     MTSKKERLDV LLVERGLAET REKAKRAIMA GIVYSNENRL DKPGEKIDRD LPLTVKGNPL
     RYVSRGGLKL EKALKEFPVS VKDKIMIDIG SSTGGFTDCA LQNGAKQSYA VDVGYNQLAW
     KLRQDERVVV MERTNFRYAT PADFTKGMPE FATIDVSFIS LRLILPVLRT LLVPGSDCMA
     LVKPQFEAGR ESVGKKGIVR DPKVHADVLK RMISFSAAEG YICKGLSFSP ITGGDGNIEF
     LLHLHWPGEG QEGQELPEEE IMRVVEEAHK TLKEKKADVP E
//

If you have problems or comments...

PBIL Back to PBIL home page