(data stored in ACNUC1829 zone)

EMBL: BC000389

ID   BC000389; SV 2; linear; mRNA; STD; HUM; 1352 BP.
XX
AC   BC000389;
XX
DT   09-MAR-2001 (Rel. 67, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens tetraspanin 4, mRNA (cDNA clone MGC:8437 IMAGE:2821236),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1352
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1352
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (15-NOV-2000) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7f30c67a666384313dc7b14c45214640.
DR   Ensembl-Gn; ENSG00000214063; homo_sapiens.
DR   Ensembl-Tr; ENST00000397397; homo_sapiens.
DR   Ensembl-Tr; ENST00000397404; homo_sapiens.
DR   Ensembl-Tr; ENST00000397406; homo_sapiens.
DR   Ensembl-Tr; ENST00000397408; homo_sapiens.
DR   Ensembl-Tr; ENST00000397411; homo_sapiens.
DR   Ensembl-Tr; ENST00000409543; homo_sapiens.
XX
CC   On Aug 19, 2003 this sequence version replaced gi:12653240.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: DCTD/DTP
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 1 Row: e Column: 20
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 68799924.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genomic
CC   sequences available as of 09/15/2004.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1352
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_7"
FT                   /clone="MGC:8437 IMAGE:2821236"
FT                   /tissue_type="Lung, small cell carcinoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..1352
FT                   /gene="TSPAN4"
FT                   /note="synonyms: TETRASPAN, TSPAN-4, NAG-2, NAG2"
FT   CDS_pept        136..852
FT                   /codon_start=1
FT                   /gene="TSPAN4"
FT                   /product="tetraspanin 4"
FT                   /db_xref="GOA:O14817"
FT                   /db_xref="H-InvDB:HIT000029578.19"
FT                   /db_xref="HGNC:HGNC:11859"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:O14817"
FT                   /protein_id="AAH00389.1"
FT                   /translation="MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLS
FT                   SSFPSLSAANLLIITGAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILF
FT                   FAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNAT
FT                   RVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTF
FT                   AMTMYCQVVKADTYCA"
FT   misc_difference 301
FT                   /gene="TSPAN4"
FT                   /note="'C' in cDNA is 'T' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the cDNA
FT                   sequence, suggesting that this difference is unlikely to be
FT                   due to an artifact."
FT   misc_difference 1334..1352
FT                   /gene="TSPAN4"
FT                   /note="polyA tail: 19 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1352 BP; 232 A; 436 C; 415 G; 269 T; 0 other;
     cgggaggcgg cggcgcagag cttggggctt ccttggtcgc acccaccacc tgcctgccca        60
     ctggtcagcc ttcagggacc ctgagcaccg cctggtctct ttcctgtggc cagcccagaa       120
     ctgaagcgct gcggcatggc gcgcgcctgc ctccaggccg tcaagtacct catgttcgcc       180
     ttcaacctgc tcttctggct gggaggctgt ggcgtgctgg gtgtcggcat ctggctggcc       240
     gccacacagg ggagcttcgc cacgctgtcc tcttccttcc cgtccctgtc ggctgccaac       300
     ctgctcatca tcaccggcgc ctttgtcatg gccatcggct tcgtgggctg cctgggtgcc       360
     atcaaggaga acaagtgcct cctgctcact ttcttcctgc tgctgctgct ggtgttcctg       420
     ctggaggcca ccatcgccat cctcttcttc gcctacacgg acaagattga caggtatgcc       480
     cagcaagacc tgaagaaagg cttgcacctg tacggcacgc agggcaacgt gggcctcacc       540
     aacgcctgga gcatcatcca gaccgacttc cgctgctgtg gcgtctccaa ctacactgac       600
     tggttcgagg tgtacaacgc cacgcgggta cctgactcct gctgcttgga gttcagtgag       660
     agctgtgggc tgcacgcccc cggcacctgg tggaaggcgc cgtgctacga gacggtgaag       720
     gtgtggcttc aggagaacct gctggctgtg ggcatctttg ggctgtgcac ggcgctggtg       780
     cagatcctgg gcctgacctt cgccatgacc atgtactgcc aagtggtcaa ggcagacacc       840
     tactgcgcgt aggccgccca ccgcccgctt ctctgccaaa aggacgccca cggggagatg       900
     gccgcaccca cagctgcctt tcccaccacc agcctcggtg ctctgcccca tgctgggagg       960
     agggagggag ggacaggtgc ctggagcccc cggaaccctg tttctggaag gccctagctc      1020
     aggtggcttc agggcctccg gaccccccct gggaggggtg gccacgtgct ggctgcggaa      1080
     cccagggcag gggtgggagg ggcctccagc actttttata tttacgtatt ctccaaagca      1140
     gtgttcacac gggagccagc ctgtggcccc cagcctcctg gaaaacaggt tggcgctgga      1200
     ggagccgggt cttggcatcc tggaggtggc cccactggtc ctggtgctcc aggcggggcc      1260
     gtggacccct cacctacatt ccatagtggg cccgtggggc tcctggtgca tcttaataaa      1320
     gtgtgagcag caaaaaaaaa aaaaaaaaaa aa                                    1352
//

If you have problems or comments...

PBIL Back to PBIL home page