(data stored in ACNUC1829 zone)

EMBL: BC001374

ID   BC001374; SV 2; linear; mRNA; STD; HUM; 1513 BP.
XX
AC   BC001374;
XX
DT   09-MAR-2001 (Rel. 67, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 16)
XX
DE   Homo sapiens CD151 molecule (Raph blood group), mRNA (cDNA clone MGC:1524
DE   IMAGE:3051297), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1513
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1513
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (12-DEC-2000) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; bbae82355242095259ec908737bebde8.
DR   Ensembl-Gn; ENSG00000177697; homo_sapiens.
DR   Ensembl-Tr; ENST00000322008; homo_sapiens.
DR   Ensembl-Tr; ENST00000397420; homo_sapiens.
DR   Ensembl-Tr; ENST00000397421; homo_sapiens.
DR   Ensembl-Tr; ENST00000530726; homo_sapiens.
XX
CC   On Aug 19, 2003 this sequence version replaced gi:12655048.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 4 Row: g Column: 19
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34328913.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below
CC   and these differences were also compared to chimpanzee genomic
CC   sequences available as of 09/15/2004.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1513
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_15"
FT                   /clone="MGC:1524 IMAGE:3051297"
FT                   /tissue_type="Colon, adenocarcinoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..1513
FT                   /gene="CD151"
FT                   /note="synonyms: TSPAN24, GP27, SFA1, PETA-3, RAPH, MER2"
FT   CDS_pept        84..845
FT                   /codon_start=1
FT                   /gene="CD151"
FT                   /product="CD151 molecule (Raph blood group)"
FT                   /db_xref="GOA:P48509"
FT                   /db_xref="H-InvDB:HIT000030358.17"
FT                   /db_xref="HGNC:HGNC:1630"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48509"
FT                   /protein_id="AAH01374.1"
FT                   /translation="MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALK
FT                   SDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLE
FT                   IIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQD
FT                   WRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRV
FT                   IGAVGIGIACVQVFGMIFTCCLYRSLKLEHY"
FT   misc_difference 662
FT                   /gene="CD151"
FT                   /note="'A' in cDNA is 'G' in the human genome; no amino
FT                   acid change. The chimpanzee genome agrees with the cDNA
FT                   sequence, suggesting that this difference is unlikely to be
FT                   due to an artifact."
FT   misc_difference 1072
FT                   /gene="CD151"
FT                   /note="'G' in cDNA is 'A' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 1077
FT                   /gene="CD151"
FT                   /note="'T' in cDNA is 'C' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 1195
FT                   /gene="CD151"
FT                   /note="'T' in cDNA is 'C' in the human genome. The
FT                   chimpanzee genome agrees with the cDNA sequence, suggesting
FT                   that this difference is unlikely to be due to an artifact."
FT   misc_difference 1287
FT                   /gene="CD151"
FT                   /note="'G' in cDNA is 'C' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 1413
FT                   /gene="CD151"
FT                   /note="'A' in cDNA is 'T' in the human genome. The
FT                   chimpanzee genome agrees with the human genomic sequence
FT                   and not the cDNA."
FT   misc_difference 1489..1513
FT                   /gene="CD151"
FT                   /note="polyA tail: 25 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1513 BP; 301 A; 459 C; 443 G; 310 T; 0 other;
     cggacgcgtg gtagcctaga gtcctgggga gcttctgtcc acctgtcctg cagaggagtc        60
     gtttccagcc cggctgcccc aggatgggtg agttcaacga gaagaagaca acatgtggca       120
     ccgtttgcct caagtacctg ctgtttacct acaattgctg cttctggctg gctggcctgg       180
     ctgtcatggc agtgggcatc tggacgctgg ccctcaagag tgactacatc agcctgctgg       240
     cctcaggcac ctacctggcc acagcctaca tcctggtggt ggcgggcact gtcgtcatgg       300
     tgactggggt cttgggctgc tgcgccacct tcaaggagcg tcggaacctg ctgcgcctgt       360
     acttcatcct gctcctcatc atctttctgc tggagatcat cgctggtatc ctcgcctacg       420
     cctactacca gcagctgaac acggagctca aggagaacct gaaggacacc atgaccaagc       480
     gctaccacca gccgggccat gaggctgtga ccagcgctgt ggaccagctg cagcaggagt       540
     tccactgctg tggcagcaac aactcacagg actggcgaga cagtgagtgg atccgctcac       600
     aggaggccgg tggccgtgtg gtcccagaca gctgctgcaa gacggtggtg gctctttgtg       660
     gacagcgaga ccatgcctcc aacatctaca aggtggaggg cggctgcatc accaagttgg       720
     agaccttcat ccaggagcac ctgagggtca ttggggctgt ggggatcggc attgcctgtg       780
     tgcaggtctt tggcatgatc ttcacgtgct gcctgtacag gagtctcaag ctggagcact       840
     actgaccctg ccttgggcct tgctgctgct gcacccaact actgagctga gaccactgag       900
     taccaggggc tgggctccct gatgacaccc accctgtgcc atcaccataa cctctgggga       960
     ccccaacctc agaggcagct tcaagtgcct tttgctgcgc accaatgccc agcaggggag      1020
     gtgagggggg ctggcggggc gaagtttggg gggtgttttg tggggctccc cggacatact      1080
     ctctgcctgg tggtcagatg caggttggaa ggggccttgc tgagtggcgc aaggccgagc      1140
     gttcccagca gggggagaaa cccttcacac cccaggccct tcaggaactg gggctttgcc      1200
     ttgcagccac atggccccat cccagttggg gaagccaggt gagctctgac ccttgggcct      1260
     gggcctctgc ccctcccaac ccagccgtcg tctccctcga cagcgcccct gctgtcttcc      1320
     ccaccgcagt caccaccacc cgaaatgcca cgtggtcact gtgcactgcc ctgttcatgt      1380
     gcctctgcgg ggcagggcct tcctggtttt gtacactgct gtacccagat gcctacaacc      1440
     atccctgcca catacaggtg ctcaataaac acttgtagag cagatggaaa aaaaaaaaaa      1500
     aaaaaaaaaa aaa                                                         1513
//

If you have problems or comments...

PBIL Back to PBIL home page