(data stored in SCRATCH zone)

EMBL: BC002146

ID   BC002146; SV 1; linear; mRNA; STD; MUS; 1053 BP.
XX
AC   BC002146;
XX
DT   09-MAR-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus ORM1-like 2 (S. cerevisiae), mRNA (cDNA clone MGC:7263
DE   IMAGE:3484833), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1053
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1053
RA   Strausberg R.;
RT   ;
RL   Submitted (31-JAN-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; dacc3de91a295442d30db8c31216d8d6.
DR   Ensembl-Gn; ENSMUSG00000025353; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017885; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017860; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017823; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017824; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017647; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018279; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017208; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017617; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017723; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017718; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017797; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017746; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018319; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016993; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017267; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000026409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217685; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000219215; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000219524; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027547; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0027519; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0027483; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027496; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027305; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028003; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026901; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0027234; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027356; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027342; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0027470; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027332; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028027; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026606; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026823; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 7 Row: i Column: 11
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21313281.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1053
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="MGC:7263 IMAGE:3484833"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1053
FT                   /gene="Ormdl2"
FT   CDS_pept        192..653
FT                   /codon_start=1
FT                   /gene="Ormdl2"
FT                   /product="Ormdl2 protein"
FT                   /db_xref="GOA:Q9CQZ0"
FT                   /db_xref="InterPro:IPR007203"
FT                   /db_xref="InterPro:IPR029886"
FT                   /db_xref="MGI:MGI:1914094"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CQZ0"
FT                   /protein_id="AAH02146.1"
FT                   /translation="MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHVVLLSIPFFSI
FT                   PVVWTLTNVIHNLAMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSI
FT                   SPIVLYLLASFYTKYDAAHFLINTASLLSVLLPKLPQFHGVRLFGINKY"
FT   misc_feature    219..650
FT                   /gene="Ormdl2"
FT                   /note="ORMDL; Region: ORMDL family. Evidence form suggests
FT                   that ORMDLs are involved in protein folding in the ER"
XX
SQ   Sequence 1053 BP; 273 A; 255 C; 237 G; 288 T; 0 other;
     ctggagacca caggtgtaag agccagcgct gtgccccaag ccggacgggc tcctgaagct        60
     ggcagggaaa ttctttcatt cccaagactt caggggattt tggcttttca ggagacagct       120
     ggggaacaag ctcaatcagg gctaatgagg agactgagtt ggactcctgc ctgatccctc       180
     actgtggtag gatgaatgtg ggggtggcac acagcgaagt aaaccccaac actcgagtga       240
     tgaacagtcg gggcatctgg ctggcctaca tcatcttggt aggactgctg catgtggttc       300
     tcctcagcat ccctttcttc agcattcctg ttgtctggac cctgaccaac gtcatccata       360
     acttggcaat gtatatcttc ctacatacag tcaaagggac gccctttgag acccctgacc       420
     aaggaaaggc tcggcttttg acacattggg agcagatgga ctatggacta cagtttacct       480
     cctcgcgaaa gttcctcagc atctctccta ttgtacttta cctcctggcc agcttctaca       540
     ccaagtacga tgctgctcac ttcctcatca acactgcctc gctgctcagc gtgctgctgc       600
     ctaagctacc ccagttccat ggggttcgtc tctttggaat caacaaatac taaaagatgg       660
     tttgctagtt ctgcaggcat tgagggaagg cactggaact aatatataat gttttccctt       720
     ctccacacta tcttctgtat cttggaagcc tgagagataa gataaaccta tctaaactcc       780
     aagaaggaag aaactggaaa atggggttcc tgggtccagt cttcataggg tcaagattct       840
     ctgaatcagg aaaggtggat gaggttaagg gcactaccac tcactctcct ctatctagca       900
     agaagccatc attgtttggg cagcttttct ggtgattatg tttttccata tcttctaaac       960
     ctaccaactt caagttctgt tttgctgtat atttttctta aaataaagtc tttcagttat      1020
     ggctgaaatt tgataagcaa aaaaaaaaaa aaa                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page