(data stored in ACNUC31108 zone)

EMBL: BC002349

ID   BC002349; SV 2; linear; mRNA; STD; HUM; 927 BP.
XX
AC   BC002349;
XX
DT   09-MAR-2001 (Rel. 67, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Homo sapiens CD63 molecule, mRNA (cDNA clone MGC:8339 IMAGE:2819554),
DE   complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-927
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-927
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (05-FEB-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; dbeb30d23170585dea17ecfa272b9679.
DR   Ensembl-Gn; ENSG00000135404; homo_sapiens.
DR   Ensembl-Tr; ENST00000257857; homo_sapiens.
DR   Ensembl-Tr; ENST00000420846; homo_sapiens.
DR   Ensembl-Tr; ENST00000546939; homo_sapiens.
DR   Ensembl-Tr; ENST00000549117; homo_sapiens.
DR   Ensembl-Tr; ENST00000550776; homo_sapiens.
DR   Ensembl-Tr; ENST00000552692; homo_sapiens.
DR   Ensembl-Tr; ENST00000552754; homo_sapiens.
XX
CC   On Aug 19, 2003 this sequence version replaced gi:12803090.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: DCTD/DTP
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 1 Row: a Column: 18
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34328936.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..927
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_7"
FT                   /clone="MGC:8339 IMAGE:2819554"
FT                   /tissue_type="Lung, small cell carcinoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..927
FT                   /gene="CD63"
FT                   /note="synonyms: TSPAN30, LAMP-3, OMA81H, ME491"
FT   misc_difference 1
FT                   /gene="CD63"
FT                   /note="1 base at the 5' end does not align to the human
FT                   genome."
FT   CDS_pept        86..802
FT                   /codon_start=1
FT                   /gene="CD63"
FT                   /product="CD63 molecule"
FT                   /db_xref="GOA:P08962"
FT                   /db_xref="H-InvDB:HIT000030817.15"
FT                   /db_xref="HGNC:HGNC:1692"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="InterPro:IPR042028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08962"
FT                   /protein_id="AAH02349.1"
FT                   /translation="MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQ
FT                   GATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAG
FT                   YVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKN
FT                   RVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIV
FT                   FACCLVKSIRSGYEVM"
FT   misc_difference 885..927
FT                   /gene="CD63"
FT                   /note="polyA tail: 43 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 927 BP; 222 A; 196 C; 278 G; 231 T; 0 other;
     ggccgggggg cgcagctaga gagccccgga gccgcggcgg gagaggaacg cgcagccagc        60
     cttgggaagc ccaggcccgg cagccatggc ggtggaagga ggaatgaaat gtgtgaagtt       120
     cttgctctac gtcctcctgc tggccttttg cgcctgtgca gtgggactga ttgccgtggg       180
     tgtcggggca cagcttgtcc tgagtcagac cataatccag ggggctaccc ctggctctct       240
     gttgccagtg gtcatcatcg cagtgggtgt cttcctcttc ctggtggctt ttgtgggctg       300
     ctgcggggcc tgcaaggaga actattgtct tatgatcacg tttgccatct ttctgtctct       360
     tatcatgttg gtggaggtgg ccgcagccat tgctggctat gtgtttagag ataaggtgat       420
     gtcagagttt aataacaact tccggcagca gatggagaat tacccgaaaa acaaccacac       480
     tgcttcgatc ctggacagga tgcaggcaga ttttaagtgc tgtggggctg ctaactacac       540
     agattgggag aaaatccctt ccatgtcgaa gaaccgagtc cccgactcct gctgcattaa       600
     tgttactgtg ggctgtggga ttaatttcaa cgagaaggcg atccataagg agggctgtgt       660
     ggagaagatt gggggctggc tgaggaaaaa tgtgctggtg gtagctgcag cagcccttgg       720
     aattgctttt gtcgaggttt tgggaattgt ctttgcctgc tgcctcgtga agagtatcag       780
     aagtggctac gaggtgatgt aggggtctgg tctcctcagc ctcctcatct gggggagtgg       840
     aatagtatcc tccaggtttt tcaattaaac ggattatttt ttcaaaaaaa aaaaaaaaaa       900
     aaaaaaaaaa aaaaaaaaaa aaaaaaa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page